Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR085W8.263ON52152127400.0
SAKL0H17006g8.263ON53152217290.0
KLLA0F19162g8.263ON52852217280.0
TDEL0F039008.263ON55954417140.0
KLTH0G13662g8.263ON51950117040.0
CAGL0L12254g8.263ON57448617060.0
NCAS0B050208.263ON56849216930.0
Ecym_43078.263ON53452116890.0
KNAG0G020408.263ON59149616860.0
NDAI0B019908.263ON58850816630.0
YLR089C (ALT1)8.263ON59249116590.0
Kwal_56.237918.263ON51849116510.0
Smik_12.1488.263ON59249116540.0
Skud_12.1578.263ON59248816480.0
ZYRO0C01628g8.263ON53448616390.0
Suva_10.1738.263ON59253516370.0
Kpol_392.58.263ON51252015810.0
KAFR0B027308.263ON53949315830.0
TPHA0J007508.263ON52252215810.0
YDR111C (ALT2)8.263ON50748815700.0
Suva_2.2718.263ON50748815650.0
Skud_4.3728.263ON50748815590.0
KNAG0M012108.263ON52149515600.0
Smik_4.3578.263ON50748815570.0
Kpol_543.398.263ON49249015530.0
KAFR0B055308.263ON51448915240.0
NCAS0B038408.263ON49749115030.0
TBLA0E044408.263ON56249415010.0
TPHA0A018008.263ON49849214900.0
KAFR0B05520singletonON51048814750.0
NDAI0J013608.263ON50149214430.0
TBLA0F030608.263ON50049314250.0
TBLA0G01630singletonON50050213850.0
KLLA0F03509g2.252ON3871881491e-09
Kpol_1039.222.252ON3861921436e-09
Kwal_34.160181.472ON3791651428e-09
CAGL0J05126g1.321ON4333531357e-08
SAKL0D11528g1.472ON3831521321e-07
KLTH0G19646g1.472ON3791511322e-07
KNAG0B053201.321ON4331681312e-07
TPHA0O014501.321ON4431691261e-06
KLTH0G09614g2.252ON3891301241e-06
TPHA0F012602.252ON3921991242e-06
NCAS0B064402.252ON3851451232e-06
Ecym_32902.252ON3861471213e-06
Kpol_1035.231.321ON4443431213e-06
ADL249W2.252ON3871971205e-06
NCAS0G040501.472ON3841651187e-06
TDEL0D019001.321ON4433221197e-06
Suva_6.1361.321ON4441391188e-06
SAKL0D06886g1.321ON4473231189e-06
YJL060W (BNA3)1.321ON4441391171e-05
Smik_10.1801.321ON4441361171e-05
NCAS0A092001.321ON4453221161e-05
Skud_10.1561.321ON4601391161e-05
Kwal_14.25741.321ON4433221162e-05
ZYRO0G20636g1.321ON4533551152e-05
KNAG0E018502.252ON3841941142e-05
KLLA0F01617g1.321ON4443571152e-05
AEL170C1.321ON4583301142e-05
KLTH0H10648g1.321ON4433701143e-05
YIL116W (HIS5)2.252ON3851881124e-05
YGL202W (ARO8)3.511ON5001461126e-05
NDAI0G057601.321ON4481701109e-05
SAKL0H21824gna 1ON4991951109e-05
KNAG0G005501.472ON3871641081e-04
Ecym_6319singletonON3541561081e-04
SAKL0F02156g3.511ON4981541091e-04
TDEL0C040902.252ON3831471081e-04
KLLA0F10021g3.511ON4973231082e-04
Smik_7.693.511ON5001461082e-04
Ecym_7228na 1ON4881541072e-04
NDAI0B045502.102ON5651601062e-04
KAFR0J015802.252ON3831501053e-04
ZYRO0A01672g2.252ON3861301053e-04
TPHA0D033703.511ON4971191053e-04
KAFR0A017101.321ON4353531053e-04
Kwal_47.17462na 1ON4921541044e-04
Suva_7.613.511ON5001461045e-04
Skud_9.552.252ON3851881035e-04
Smik_9.532.252ON3881921028e-04
SAKL0E08492g2.252ON3841461019e-04
KLTH0G19624gsingletonON4681851010.001
Kwal_47.189823.511ON4962221010.001
Kwal_23.48882.252ON3891301000.001
Ecym_62921.321ON430219980.002
ZYRO0C06028g3.511ON496220970.004
KNAG0B006603.511ON496122970.004
KLTH0B00176g8.204ON448184960.004
KAFR0D014203.511ON492188960.005
Skud_7.693.511ON500146950.005
KLLA0A04906gna 1ON480139940.006
NDAI0I028303.511ON500188940.007
KAFR0B023808.204ON443182940.007
NDAI0B037302.252ON386195930.008
CAGL0C01243g2.252ON383174910.014
KLTH0G02002g3.511ON496126910.016
CAGL0G01254g3.511ON504122900.021
Suva_9.782.252ON386172890.026
Ecym_55428.204ON446242870.049
AFR548C3.511ON497154860.066
TDEL0D057903.511ON497122850.087
Kpol_278.23.511ON498122850.092
Kwal_26.77682.475ON422174850.093
KLTH0D05478g2.475ON421131840.12
SAKL0E02948g2.475ON423197830.14
NCAS0E006703.511ON497148810.23
CAGL0K08580g2.475ON453184800.34
NDAI0D028804.53ON44770800.39
Kpol_480.11.472ON380166790.40
TBLA0B009902.102ON546162800.41
KNAG0G016808.204ON452189790.43
Kwal_8.5858.204ON44683780.52
TBLA0B093302.420ON40890760.92
YFR055W (IRC7)na 2ON34051741.4
TDEL0A016008.204ON47533741.7
KLLA0F13640g2.475ON418163741.9
Skud_15.5017.57ON136554742.0
NDAI0C050108.453ON537121722.9
TPHA0F004204.53ON44270723.0
NDAI0C059608.204ON47834723.1
NCAS0A038308.204ON44633723.4
Smik_5.3198.204ON44334714.1
NDAI0K02720na 3ON407221704.7
ABL038W2.475ON443240705.1
AGR141C8.204ON438172705.1
Suva_5.2818.204ON45034705.8
NCAS0A041702.420ON421221696.5
YER152C8.204ON44334697.0
TPHA0G031602.475ON443178689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR085W
         (521 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...  1060   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   670   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   670   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   664   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   660   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   661   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   656   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   655   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   654   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   645   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   643   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   640   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   641   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   639   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   635   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   635   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   613   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   614   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   613   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   609   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   607   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   605   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   605   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   604   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   602   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            591   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   583   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   582   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   578   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   572   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   560   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   553   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              538   0.0  
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    62   1e-09
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    60   6e-09
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    59   8e-09
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    57   7e-08
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    55   1e-07
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    55   2e-07
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    55   2e-07
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    53   1e-06
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    52   1e-06
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    52   2e-06
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    52   2e-06
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    51   3e-06
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    51   3e-06
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    51   5e-06
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    50   7e-06
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    50   7e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    50   8e-06
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    50   9e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    50   1e-05
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    50   1e-05
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    49   1e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    49   1e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    49   2e-05
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    49   2e-05
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    49   2e-05
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    49   2e-05
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    49   2e-05
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    49   3e-05
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    48   4e-05
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    48   6e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    47   9e-05
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    47   9e-05
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       46   1e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    46   1e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    47   1e-04
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    46   1e-04
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    46   2e-04
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    46   2e-04
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    46   2e-04
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    45   2e-04
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    45   3e-04
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    45   3e-04
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    45   3e-04
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    45   3e-04
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    45   4e-04
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    45   5e-04
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    44   5e-04
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    44   8e-04
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    44   9e-04
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    44   0.001
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    44   0.001
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    43   0.001
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    42   0.002
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    42   0.004
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    42   0.004
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    42   0.004
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    42   0.005
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    41   0.005
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    41   0.006
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    41   0.007
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    41   0.007
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    40   0.008
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    40   0.014
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    40   0.016
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    39   0.021
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    39   0.026
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    38   0.049
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    38   0.066
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    37   0.087
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    37   0.092
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    37   0.093
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    37   0.12 
SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {...    37   0.14 
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     36   0.23 
CAGL0K08580g Chr11 complement(865470..866831) [1362 bp, 453 aa] ...    35   0.34 
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      35   0.39 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    35   0.40 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    35   0.41 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    35   0.43 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    35   0.52 
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    34   0.92 
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    33   1.4  
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    33   1.7  
KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]...    33   1.9  
Skud_15.501 Chr15 (890201..894298) [4098 bp, 1365 aa] {ON} YOR33...    33   2.0  
NDAI0C05010 Chr3 (1164977..1166590) [1614 bp, 537 aa] {ON} Anc_8...    32   2.9  
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    32   3.0  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    32   3.1  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     32   3.4  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    32   4.1  
NDAI0K02720 Chr11 complement(610291..611514) [1224 bp, 407 aa] {...    32   4.7  
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    32   5.1  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    32   5.1  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    32   5.8  
NCAS0A04170 Chr1 (847181..848446) [1266 bp, 421 aa] {ON} Anc_2.420     31   6.5  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    31   7.0  
TPHA0G03160 Chr7 (672920..674251) [1332 bp, 443 aa] {ON} Anc_2.4...    31   9.0  

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/521 (98%), Positives = 512/521 (98%)

Query: 1   MAIGMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVR 60
           MAIGMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVR
Sbjct: 1   MAIGMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVR 60

Query: 61  GKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEM 120
           GKIPTRA         HPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEM
Sbjct: 61  GKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEM 120

Query: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDN 180
           PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDN
Sbjct: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDN 180

Query: 181 VYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWST 240
           VYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWST
Sbjct: 181 VYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWST 240

Query: 241 NPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           NPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY
Sbjct: 241 NPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300

Query: 301 QDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFR 360
           QDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFR
Sbjct: 301 QDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFR 360

Query: 361 EELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLL 420
           EELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLL
Sbjct: 361 EELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLL 420

Query: 421 WKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVP 480
           WKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVP
Sbjct: 421 WKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVP 480

Query: 481 GTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           GTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD
Sbjct: 481 GTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/522 (60%), Positives = 402/522 (77%), Gaps = 2/522 (0%)

Query: 2   AIGMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVRG 61
           ++ MLR  ++G     +    L  R  SS     +F PA+ ++L D+NENV++AKYAVRG
Sbjct: 10  SLRMLRTTTAGNIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRG 69

Query: 62  KIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLE-M 120
           KIP +A          P SLPF +II ANIGNPQQL QKPLTFYRQV+SL+QNP +LE +
Sbjct: 70  KIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEI 129

Query: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDG-IPANPD 179
           P E L Q +K D + RA R+L + GGSVGAYS SQGV G+R+TVA FI +RDG   A  +
Sbjct: 130 PREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAE 189

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +++LTAGAS+AVS +LS  C+GP+TGVLIPIPQYPLYTA++  NN+ ALPYYL+E   WS
Sbjct: 190 DIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWS 249

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299
           TNP+E+E+V+ +S  + + PKCLVVINPGNPTG++LS + +E I  +AAKYGIVVIADEV
Sbjct: 250 TNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEV 309

Query: 300 YQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGF 359
           YQ+NVF  A+FHSMRKVLK+LQ +    + N+QLASLHS SKG+SGECGQRGGYMEL+GF
Sbjct: 310 YQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGF 369

Query: 360 REELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQL 419
             ++R+VF+KLASISLCPVVTGQALVDLMV PP  GD SYEQ  +E   I+  L+ R+ +
Sbjct: 370 SHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASM 429

Query: 420 LWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTV 479
           L++TF  LEGIEC  PQGA+YLFP+L L  KA++ A+ L +  DE YC ELL+ TGICTV
Sbjct: 430 LYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTV 489

Query: 480 PGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           PG+GFGQ+PGTYH+RTTFL PGT WI++W++FHKKFY++YRD
Sbjct: 490 PGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/522 (61%), Positives = 399/522 (76%), Gaps = 6/522 (1%)

Query: 1   MAIGMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVR 60
           ++ GM+R N+       L+  +     L+ ++  +   PA  ++L DVNENV+KAKYAVR
Sbjct: 12  ISSGMIRVNAPA-----LKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVR 66

Query: 61  GKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEM 120
           G+IP RA          P SLPFSKII ANIGNPQQL QKPLTFYR+V+SL+Q+P+LLE 
Sbjct: 67  GRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEE 126

Query: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRD-GIPANPD 179
             E LQ  +K D + RA+R+L + GGSVGAYS SQGV+G R TVA FI +RD G  + P+
Sbjct: 127 ADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPE 186

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           ++YLTAGAS+AVS +LS  CKGP TGVLIPIPQYPLYTA++  NN+  LPYYL E   WS
Sbjct: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299
           T+P+E+E+V+LD+ ++ I P CLVVINPGNPTG++LS + ++ I  +AAKYGIVVIADEV
Sbjct: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEV 306

Query: 300 YQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGF 359
           YQ+NVF  +KF+SM+KVL+NLQ      Y N+QLASLHS SKG+SGECGQRGGYMEL+GF
Sbjct: 307 YQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGF 366

Query: 360 REELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQL 419
             ++R+VF+KLASISLCPVVTGQALVDLMV PP  GD SYEQ  QE   I+  L+ER+  
Sbjct: 367 NHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASK 426

Query: 420 LWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTV 479
           L++TF  LEGIEC  PQGA+YL+PKL LP K I+ AQ L +  DE YC  LL+ TGICTV
Sbjct: 427 LFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTV 486

Query: 480 PGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           PG+GFGQ+PGTYH+RTTFLPPGT+W+E+W+ FHK F+DKYRD
Sbjct: 487 PGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/544 (60%), Positives = 400/544 (73%), Gaps = 24/544 (4%)

Query: 2   AIGMLRRNSS--GTAVSVLQGR---------VLRTRRLSSVKDG----------SRFVPA 40
           ++G++ R S+   T  + LQGR         + R R  SS   G            F PA
Sbjct: 16  SVGLISRASAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGLHHIYHKKCHQDFYPA 75

Query: 41  EPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQK 100
           E +T+ D+NENV+KAKYAVRG IP RA          P SLPF KI+ ANIGNPQQL QK
Sbjct: 76  ESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQK 135

Query: 101 PLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSASQGVK 158
           PL+FYRQV+S++Q P++LE   E L  +  FK D + RA+R+L+D GGSVGAYS+SQGV 
Sbjct: 136 PLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVY 195

Query: 159 GYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT 217
           G R+TVA FI  RD G PA P++++LTAGAS+AVS LLS  C+G ETGVLIPIPQYPLYT
Sbjct: 196 GIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYT 255

Query: 218 ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSV 277
           AT+  NN+  LPYYL+E  GWSTN  E+E V+ +S +  I P  LVVINPGNPTGSVLSV
Sbjct: 256 ATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSV 315

Query: 278 KDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLH 337
           + +E I  +AAKYGIVVIADEVYQ+N+F  ++FHSM+KVL+ LQ   P +Y NVQL SLH
Sbjct: 316 EAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLH 375

Query: 338 SISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDP 397
           S SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV PP  GD 
Sbjct: 376 STSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDE 435

Query: 398 SYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQK 457
           SYEQ  +E   I+ EL+ R+ LL  TF SLEGIEC  P+GA+YLFP++ LP KAI+AAQ 
Sbjct: 436 SYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQH 495

Query: 458 LGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYD 517
           L    DE YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PGT+WI+ W+DFHKKFYD
Sbjct: 496 LEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYD 555

Query: 518 KYRD 521
           +YRD
Sbjct: 556 QYRD 559

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/501 (63%), Positives = 394/501 (78%), Gaps = 5/501 (0%)

Query: 26  RRLSS---VK-DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSL 81
           RRLS+   VK D S+       TL DVN+ V+ AKYAVRG IP RA          PGSL
Sbjct: 19  RRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSL 78

Query: 82  PFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLE-MPAEWLQQAFKADVVVRARRM 140
           PF+KII ANIGNPQQL QKPLTFYRQV+SL+QNP L+E +P   L + FK D V RA++M
Sbjct: 79  PFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKM 138

Query: 141 LQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCK 200
           L+  GGSVGAYSASQGV G+R++VA+FIE RDG PA+ ++++LTAGASSAVS +LS FC 
Sbjct: 139 LKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVSAILSMFCT 198

Query: 201 GPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPK 260
           G E G LIPIPQYPLYTAT+  N+A ALPYYL+EA GWS + +++E+V+ D+ ++ + P 
Sbjct: 199 GSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPT 258

Query: 261 CLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNL 320
           CLVVINPGNPTG++LS + +E ILT+AAKY +VVIADEVYQ+N F DA F SM+KVL+ L
Sbjct: 259 CLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVL 318

Query: 321 QLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVT 380
           Q  EP  Y NVQLASLHS SKG+SGECGQRGGYMEL+GF EE+++VF+KLASISLCPVVT
Sbjct: 319 QKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVT 378

Query: 381 GQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALY 440
           GQALVDLMV PP +GD SYE   QE  +I++ L ++S LL++TF SLEG+ C  PQGA+Y
Sbjct: 379 GQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMY 438

Query: 441 LFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPP 500
           LFPKL L +KAI  A+ LG+  DE YC ELL+ TGICTVPG+GF Q+PGTYH+RTTFL P
Sbjct: 439 LFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAP 498

Query: 501 GTKWIESWKDFHKKFYDKYRD 521
           GT+W++SWK FH+KF D++RD
Sbjct: 499 GTEWVDSWKKFHQKFVDEHRD 519

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 380/486 (78%), Gaps = 1/486 (0%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           F+PAE  TL DVNE V+ AKYAVRG IP RA         +P SLPF+ II ANIGNPQQ
Sbjct: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQG 156
           L QKPL+FYRQV+SL+Q P+L+       Q   K D + RA+R+L D GGSVGAYS+SQG
Sbjct: 149 LKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQG 208

Query: 157 VKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
           V G R+TVA FI  RD GI A P++++LTAGASSAV  LLS FC+G ETGVLIPIPQYPL
Sbjct: 209 VLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPL 268

Query: 216 YTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVL 275
           YTAT+   N+ ALPYYLNE  GWST+P+E+E +ILDS + NI P  LVVINPGNPTG+VL
Sbjct: 269 YTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTGAVL 328

Query: 276 SVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLAS 335
           S + +E I TLAAKYGI+VIADEVYQ+NVF D KFHSM+KVL+ LQ+++P LY NVQLAS
Sbjct: 329 SEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLAS 388

Query: 336 LHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQG 395
           LHS SKG+SGECGQRGGYMEL+GF  ++R+V +KLASISLCPVVTGQALVDLMV PP +G
Sbjct: 389 LHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKG 448

Query: 396 DPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAA 455
           + SYEQ  +E R+I+ EL +R+ LL   F  L+GI C  PQGA+YLFPKL LP KAI+ A
Sbjct: 449 EESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEA 508

Query: 456 QKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKF 515
               +  DE YC  LL++TGICTVPG+GFGQ PGTYH+RTTFL PGTKWIE W DFH++F
Sbjct: 509 LHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEF 568

Query: 516 YDKYRD 521
           Y+K+++
Sbjct: 569 YNKFKN 574

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/492 (63%), Positives = 379/492 (77%), Gaps = 3/492 (0%)

Query: 33  DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIG 92
           + + F+PA+ +TLA++N+NV+KAKYAVRG IP RA          P SLPF  I+ ANIG
Sbjct: 77  NHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136

Query: 93  NPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA--FKADVVVRARRMLQDAGGSVGA 150
           NPQQL QKPL+FYRQV+SL+Q P++L+     L  +  FK D + RA+ +L + GG+VGA
Sbjct: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196

Query: 151 YSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209
           YSASQGV G R+TVA FI +RD G PA P++++LTAGAS+AV  LLS  CKGPETGVLIP
Sbjct: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256

Query: 210 IPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGN 269
           IPQYPLYTA++  NN+ ALPYYL+E  GWSTNP E+E V+L +K + I P  LVVINPGN
Sbjct: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316

Query: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYK 329
           PTG+VLS K +E I  +AAKYGIVVIADEVYQ+NVF + KFHSM+KVL+NLQ + P +Y 
Sbjct: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376

Query: 330 NVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMV 389
            VQLASLHS SKG+SGECGQRGGYMEL GF  E+R V +KLASISLCPVVTGQALVDLMV
Sbjct: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436

Query: 390 GPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQ 449
            PP +GD S+EQ   E + I  EL  R+  L+K F +LEGIEC  PQGA+YLFP+L LP 
Sbjct: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496

Query: 450 KAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWK 509
           KA++ AQ L +  DE YC  LL+ TGICTVPG+GFGQ PGTYH+RTTFL PGT+WIE WK
Sbjct: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556

Query: 510 DFHKKFYDKYRD 521
            FH+ FY+ YRD
Sbjct: 557 IFHQDFYNTYRD 568

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/521 (60%), Positives = 395/521 (75%), Gaps = 4/521 (0%)

Query: 5   MLRRNSSGTA-VSVLQGRVLRTRRLSSVKDGS---RFVPAEPMTLADVNENVVKAKYAVR 60
           ML +NS   A + VL G    T  L S+  G+   RF P +P+ L D+N NV++AKYAVR
Sbjct: 14  MLIKNSGLQATMDVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVR 73

Query: 61  GKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEM 120
           GKIP RA          P SLPF KII ANIGNPQQLGQKPL+F R+V+SL+++P LL+M
Sbjct: 74  GKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQM 133

Query: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDN 180
           P E L   +K D V RA+RM++D   S+GAYS SQGV G+R+TVA+++  RDG PA+ ++
Sbjct: 134 PMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAED 193

Query: 181 VYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWST 240
           ++LT GAS+  S ++   CKG E+GVLIPIPQYPLYTATIT NN VALPYYL+E  GWS 
Sbjct: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253

Query: 241 NPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           N D++ER+I++S ++ + P CLVVINPGNPTG++L V+ ME I  +AAKY IVVIADEVY
Sbjct: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313

Query: 301 QDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFR 360
           Q+NVF   KF+SM+KVL++LQ R   L+ NVQL SLHS SKGLSGECGQRGGYMEL+GF 
Sbjct: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373

Query: 361 EELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLL 420
           +++R+V +K+ASI LC  V GQALVDLM+  P  GD SYE+   E  SI + L+ERS+ L
Sbjct: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433

Query: 421 WKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVP 480
           W+TF +LEG+EC  PQG++YLFP+L LPQKAI+AA+ L +  DE YC+ELL+ TGICTVP
Sbjct: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493

Query: 481 GTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           G+GFGQ P T H+RTTFL PGT+WIESW+ FHK FYDKYRD
Sbjct: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/496 (63%), Positives = 380/496 (76%), Gaps = 7/496 (1%)

Query: 32  KDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANI 91
           K   +F PA  + +AD+NENV+KAKYAVRG IP RA          P SLPF KII ANI
Sbjct: 97  KSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANI 156

Query: 92  GNPQQLGQKPLTFYRQVISLMQNPQLL----EMPAEWLQQAFKADVVVRARRMLQDAGGS 147
           GNPQQL QKPL+FYRQV+SL+Q P+LL    E PA      +KAD V RA ++L+D GGS
Sbjct: 157 GNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAA-ATSLYKADAVRRAEKLLEDIGGS 215

Query: 148 VGAYSASQGVKGYRRTVAQFIERRDGI-PANPDNVYLTAGASSAVSCLLSTFCKGPETGV 206
           VGAYS SQGV G R+TVA FI RRD   PA P++++LTAGAS+AVS LLS FCKG +TGV
Sbjct: 216 VGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGV 275

Query: 207 LIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVIN 266
           LIPIPQYPLYTAT+  NN+  LPYYL+E  GWSTN  E++ V+LD+  RNI P  LVVIN
Sbjct: 276 LIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVIN 335

Query: 267 PGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFG-DAKFHSMRKVLKNLQLREP 325
           PGNPTG+VLS K +  I  +AAKYGIVVIADEVYQ+N+F  D KFHSM+KVL+ LQ   P
Sbjct: 336 PGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHP 395

Query: 326 TLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALV 385
             +  VQLASLHS SKG+SGECGQRGG+MEL GF  E+R+V +KLASISLCPVVTGQALV
Sbjct: 396 GKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALV 455

Query: 386 DLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKL 445
           DLMV PP +G+ SYE    E   I+ EL +R+  LW+TF  LEGI+C  PQGA+YLFP+L
Sbjct: 456 DLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRL 515

Query: 446 HLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWI 505
           +LP KA++ AQ + + ADE YC ELL+ TGICTVPG+GFGQ+PGTYH+RTTFL PGT+WI
Sbjct: 516 NLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWI 575

Query: 506 ESWKDFHKKFYDKYRD 521
           + W+ FHK+FY+KYRD
Sbjct: 576 DLWEKFHKEFYNKYRD 591

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/508 (62%), Positives = 378/508 (74%), Gaps = 7/508 (1%)

Query: 21  RVLRTRRLS----SVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXX 76
           R L TR +S     V  G  F PAE +TLAD+NENV+KAKYAVRG IP RA         
Sbjct: 81  RALMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLEN 140

Query: 77  HPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA--FKADVV 134
           +P +LPFS+I+ ANIGNPQQL QKPL+FYRQV+S++Q P +L+   + L  A  +K D +
Sbjct: 141 NPSTLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAI 200

Query: 135 VRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSC 193
            RA+ +L + GGSVGAYSASQGV G R+TVA FI  RDG  PA P++++LT         
Sbjct: 201 DRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCY 260

Query: 194 LLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSK 253
           LLS  C+GP+TGVLIPIPQYPLYTAT+  NN+ ALPYYL+E  GWSTNP E+E V+ D+ 
Sbjct: 261 LLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAM 320

Query: 254 KRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSM 313
           +R I P  LVVINPGNPTG+VL+ + +E I  +AAKYGIVVIADEVYQ+N+    KF+SM
Sbjct: 321 ERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSM 380

Query: 314 RKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASI 373
           +KVL+ LQ   P  + NVQLASLHS SKG+SGECGQRGGYMELIGF  E+RKV +KLASI
Sbjct: 381 KKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASI 440

Query: 374 SLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECN 433
           SLCPVVTGQALVDLMV PP +GD SYEQ   E R I  EL  R+  L++TF  LEGIEC 
Sbjct: 441 SLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQ 500

Query: 434 MPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHV 493
            PQGA+YLFPKL LP KA++ AQ L +  DE YC  LLD TGICTVPG+GFGQ PGTYH+
Sbjct: 501 KPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHL 560

Query: 494 RTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           RTTFL PGT+WI+ W+ FHK+FYD YRD
Sbjct: 561 RTTFLAPGTEWIKKWEAFHKEFYDNYRD 588

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/491 (61%), Positives = 381/491 (77%), Gaps = 3/491 (0%)

Query: 34  GSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGN 93
            + F PAE +TL DVNENV+KAKYAVRG IP RA          P SLPF +II ANIGN
Sbjct: 102 NNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGN 161

Query: 94  PQQLGQKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAY 151
           PQQL QKPLT+YRQV+SL+Q P+LL    + L   + FK D + RA+ +++D GGSVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 152 SASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           S+SQGV+G R++VA+FI +RD G  + P++++LTAGAS+AV+ LLS FC+GPETGVLIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270
           PQYPLYTAT+  NN+ ALPYYL+E  GWSTNP+E+E V+ ++ +  I P  LVVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330
           TG+VLS + +  I  +AAKYG VVIADEVYQ+N+F   KFHSM+K+L++LQ   P  + N
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401

Query: 331 VQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVG 390
           VQLASLHS SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 391 PPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQK 450
           PP +G+ S+E    E  SI+ +L  R+  L++TF SLEGIEC  PQGA+YLFPK+ LP K
Sbjct: 462 PPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 451 AIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKD 510
           A++ A+ L +  DE YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +WI+ W+ 
Sbjct: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWES 581

Query: 511 FHKKFYDKYRD 521
           FHK+F+D+YRD
Sbjct: 582 FHKEFFDQYRD 592

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/491 (61%), Positives = 377/491 (76%), Gaps = 1/491 (0%)

Query: 32  KDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANI 91
           KD S+       TL D+NE V+ AKYAVRG IP RA          PGSLPF KII ANI
Sbjct: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87

Query: 92  GNPQQLGQKPLTFYRQVISLMQNPQLL-EMPAEWLQQAFKADVVVRARRMLQDAGGSVGA 150
           GNPQQL QKPLTFYRQV++L+QNP L+ ++ +  L + FK D V RA++ML+  GGSVGA
Sbjct: 88  GNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGA 147

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           YS SQGV G+R +VA+FIE RDG PA+  +++LT GAS AVS +LS FC GPE G LIPI
Sbjct: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270
           PQYPLYTA++  NN+ ALPYYL+E  GWS + +++E+V+ DS K+ I P CLVVINPGNP
Sbjct: 208 PQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNP 267

Query: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330
           TG++L+   +E ++ +AAKY +V+IADEVYQ+N F DA+F SM+KVL+ LQ  EP  Y N
Sbjct: 268 TGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDN 327

Query: 331 VQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVG 390
           VQLASLHS SKG+SGECGQRGGYMEL+GF EE+++VF+KLASISLCPVVTGQAL+DLMV 
Sbjct: 328 VQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVR 387

Query: 391 PPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQK 450
           PP +GD SYEQ  QE   I+  L +RS LL++ F S+EG+ C  PQGA+YLFPKL L  K
Sbjct: 388 PPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNK 447

Query: 451 AIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKD 510
           AI  A+  G+  DE YC ELL+ TGICTVPG+GFGQ+PGT+H+RTTFL PGT+WI+SWK 
Sbjct: 448 AIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKK 507

Query: 511 FHKKFYDKYRD 521
           FH+KF + +RD
Sbjct: 508 FHEKFTEDHRD 518

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/491 (61%), Positives = 381/491 (77%), Gaps = 3/491 (0%)

Query: 34  GSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGN 93
            + F PAE +TL DVNENV+KAKYAVRG IP RA          P SLPF+KII ANIGN
Sbjct: 102 NNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGN 161

Query: 94  PQQLGQKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAY 151
           PQQL QKPLT+YRQV+SL+Q P+LL    + L   + FK D + RA+ ++++ GGSVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAY 221

Query: 152 SASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           S+SQGV+G RR+VA+FI +RD G  + P++++LTAGAS+AV+ LLS FC+GPETGVLIPI
Sbjct: 222 SSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270
           PQYPLYTAT+  NN+ ALPYYL+E+ GWSTNP+E+E V+ ++ +  I    LVVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNP 341

Query: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330
           TG+VLS + +  I  +AAKYG VVIADEVYQ+N+F   KFHSM+K+L++LQ   P  + N
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401

Query: 331 VQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVG 390
           VQLASLHS SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 391 PPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQK 450
           PP +G+ S+E    E  SI+ +L  R+  L+KTF SLEGIEC  PQGA+YLFPK+ LP +
Sbjct: 462 PPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFR 521

Query: 451 AIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKD 510
           A++ A+ L +  DE YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +WI+ W+ 
Sbjct: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 511 FHKKFYDKYRD 521
           FHK+F+D YRD
Sbjct: 582 FHKEFFDHYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/488 (62%), Positives = 377/488 (77%), Gaps = 3/488 (0%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           F PAE +TL DVNENV+KAKYAVRG IP RA          P SLPF KII ANIGNPQQ
Sbjct: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSAS 154
           L QKPLT+YRQV+SL+Q P+LL    + L   + FK D + RA+ +++D GGSVGAYS+S
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224

Query: 155 QGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213
           QGV+G R++VA+FI +RD G  + P++++LTAGAS+AV+ LLS FC+GPETGVLIPIPQY
Sbjct: 225 QGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQY 284

Query: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273
           PLYTAT+  NN+ ALPYYL+E  GWSTNP+E+E V+ ++ +  I P  LVVINPGNPTG+
Sbjct: 285 PLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 344

Query: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333
           VLS + +  I  +AAKYG VVIADEVYQ+N+F   KFHSM+K+L+ LQ   P  + NVQL
Sbjct: 345 VLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQL 404

Query: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393
           ASLHS SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV PP 
Sbjct: 405 ASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPV 464

Query: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453
           +G+ S+E    E  SI+ +L  R+  L+ TF SLEGIEC  PQGA+YLFPK+ LP KA++
Sbjct: 465 EGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQ 524

Query: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513
            A+ L +  DE YC  LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +WI+ W+ FHK
Sbjct: 525 EARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHK 584

Query: 514 KFYDKYRD 521
           +F+D+YRD
Sbjct: 585 EFFDQYRD 592

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 372/486 (76%), Gaps = 3/486 (0%)

Query: 39  PAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLG 98
           PAE + L++VNENV+KAKYAVRG IP  A          P SLPF  I+ ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 99  QKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSASQG 156
           QKPLTFYRQV+SL+Q P LLE   + L   + ++ D + RARR+L D G SVGAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 157 VKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
           ++G R TVAQFI  RDG   A  ++++LTAGASSAVS LLS  CKG ETGVLIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 216 YTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVL 275
           YTA++  NN+  LPYYL+E  GWSTNP E+E V+ ++ ++NI P  LVVINPGNPTG+VL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 276 SVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLAS 335
           S +D+  I  +AAKYGIVVIADEVYQ+NVF  A+FHSM+K+L+ LQ   P ++ NVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 336 LHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQG 395
           LHS SKG+SGECGQRGGYME+ GF  ++R+V +KLASISLCPVVTGQALVDLMV PP  G
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 396 DPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAA 455
           D SYE   QE +SI+  L ER+  L  TF SLEGIEC  P+GA+YLFP+L LP KAI++A
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 456 QKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKF 515
           +  G+  D  YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PGT+WIE W++FHK F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 516 YDKYRD 521
           Y++YRD
Sbjct: 529 YEEYRD 534

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/535 (58%), Positives = 396/535 (74%), Gaps = 20/535 (3%)

Query: 5   MLRRNSSGTAVSVLQGRVLRTRRLSSVKD---------------GSRFVPAEPMTLADVN 49
           +L+R+SS    +  Q R +  +  SS+KD                + F PAE +TL DVN
Sbjct: 60  VLQRHSSSWMAAQGQKRSISGQ--SSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVN 117

Query: 50  ENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVI 109
           ENV+KA+YAVRG IP RA          P SLPF+KII ANIGNPQQL QKPLT+YRQV+
Sbjct: 118 ENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVL 177

Query: 110 SLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQF 167
           SL+Q P+LL    + L   + FK D + RA+ +++D GGSVGAYS+SQGV+G R++VA F
Sbjct: 178 SLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADF 237

Query: 168 IERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAV 226
           I +RDG   A P++++LTAGAS+AV+ LLS FC+GPETGVLIPIPQYPLYTAT+  NN+ 
Sbjct: 238 ITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ 297

Query: 227 ALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTL 286
            LPYYL+E  GWSTNP+E+E V+ ++ +  I P  LVVINPGNPTG+VLS + +  I  +
Sbjct: 298 PLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEV 357

Query: 287 AAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGE 346
           AAKYG VVIADEVYQ+N+F   +F+SM+KVL++LQ   P  + NVQLASLHS SKG+SGE
Sbjct: 358 AAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGE 417

Query: 347 CGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQET 406
           CGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV PP +G+ S+E    E 
Sbjct: 418 CGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSER 477

Query: 407 RSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELY 466
            SI+ +L  R+  L++TF SLEGIEC  PQGA+YLFPK+ +P KAI+ A  L +  DE Y
Sbjct: 478 NSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFY 537

Query: 467 CSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           C +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +W++ W+ FHK+F+D+YRD
Sbjct: 538 CKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/520 (58%), Positives = 384/520 (73%), Gaps = 11/520 (2%)

Query: 5   MLRRNSSGTAVSVLQGRVLRTRRLSSV--KDGSRFVPAEPMTLADVNENVVKAKYAVRGK 62
           MLR  S   ++S+++   +R   LS+   +      PA+ + + D+N+NV+KAKYAVRG 
Sbjct: 1   MLR--SGNCSISLVRRVGVRRLTLSTTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGS 58

Query: 63  IPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPA 122
           IP RA             LPF  +I ANIGNPQQL QKPLTFYRQV+S++Q P+LLE  +
Sbjct: 59  IPLRAEELKLYLEAGQ-KLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLESGS 117

Query: 123 EWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRD-GIPANPDNV 181
                 FK D + RAR++L++ G SVG+YS+SQG+   R+TVA FI +RD G  + P+++
Sbjct: 118 ----NIFKKDAIERARKLLKEIG-SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDI 172

Query: 182 YLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTN 241
           +LTAGASSAV  LLS  CK  ++GVLIPIPQYPLYTAT+  NNA ALPYYL+E+ GWST+
Sbjct: 173 FLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTD 232

Query: 242 PDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
            +E+E VI DS  + I P  LV+INPGNPTGS+LSV+ ME I+ +AA +GIV+IADEVYQ
Sbjct: 233 INEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQ 292

Query: 302 DNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFRE 361
           +NVF +AKFHSM+KVL+NLQ   P  Y  VQLASLHS SKG+SGECGQRGGYMEL GF  
Sbjct: 293 ENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNP 352

Query: 362 ELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLW 421
           E+++V +KL SISLCPVVTGQALVDLMV PP +GD SYEQ   E  +I ++L  R+ LLW
Sbjct: 353 EIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLW 412

Query: 422 KTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPG 481
           + F S+EG+ C  P+GA+YLFPK+ LP K ++ +Q+L I  DE YC  LL+ TGICTVPG
Sbjct: 413 EAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPG 472

Query: 482 TGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           +GFGQ PGTYH+RTTFL PGT+WI+ W  FH +FYDKYRD
Sbjct: 473 SGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYDKYRD 512

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/493 (62%), Positives = 378/493 (76%), Gaps = 7/493 (1%)

Query: 32  KDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANI 91
           K    F PA  +T+ D+NENV+KAKYAVRGKIPTRA          P SLPF KII ANI
Sbjct: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106

Query: 92  GNPQQLGQKPLTFYRQVISLMQNPQLLEM----PAEWLQQAFKADVVVRARRMLQDAGGS 147
           GNPQQL Q+PL+FYRQV+SL+Q P LL      P       +K D ++RA+++L+D GGS
Sbjct: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGS--SAVYKKDAILRAKKILKDIGGS 164

Query: 148 VGAYSASQGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGV 206
           VGAYS SQGV G RRTVA FI  RDG  PA P++++LTAGAS+AV+ LLS  CKG +TGV
Sbjct: 165 VGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGV 224

Query: 207 LIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVIN 266
           LIPIPQYPLYTAT+  NN+ ALPY+L+E +GWS NP E+E VI  + + NI P  LVVIN
Sbjct: 225 LIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVIN 284

Query: 267 PGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPT 326
           PGNPTG+VLS + + +IL +AAKYGIVVIADEVYQ+N+F   KFHS++ VL+ LQ   P 
Sbjct: 285 PGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPG 344

Query: 327 LYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVD 386
            + NVQLASLHS SKG+SGECGQRGGYME+IGF  E+R+V +KLASISLCPVVTGQALVD
Sbjct: 345 KFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVD 404

Query: 387 LMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLH 446
           LMV PP +G+ S+     + ++I+ +L +R++LLWKTF SL+GIEC  P GA+YLFPKL+
Sbjct: 405 LMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLN 464

Query: 447 LPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIE 506
           LP +AI+ AQ+L +  DE YC ELL+ TGICTVPG+GFGQ+ GTYH+RTTFL PG +WI+
Sbjct: 465 LPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWID 524

Query: 507 SWKDFHKKFYDKY 519
           SWK FH +F +KY
Sbjct: 525 SWKQFHIEFMEKY 537

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/522 (59%), Positives = 390/522 (74%), Gaps = 6/522 (1%)

Query: 5   MLRRNSSGTAVSV---LQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVRG 61
           MLR  S+   V+    L G+ L +    S+K    F PA+ +T+ D+NENV+KAKYAVRG
Sbjct: 2   MLRSRSTNCTVNAAIALSGKRLLSLTTISLKH-KNFKPADKLTINDLNENVLKAKYAVRG 60

Query: 62  KIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLL-EM 120
           KIP RA         +P SLPF K+I ANIGNPQQL QKPLTFYRQV+SL+Q P +L E 
Sbjct: 61  KIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDET 120

Query: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDG-IPANPD 179
            +   +  +K D + RA+R+L D G SVG+YS+SQGV G R+TVA++I RRDG   A  +
Sbjct: 121 FSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAE 180

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +++LTAGASSAVS LL+  CKG E+GVLIPIPQYPLYTAT+  NN  ALPYYL E  GWS
Sbjct: 181 DIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWS 240

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299
           TN +E+E V+ ++ +  I P+ LVVINPGNPTG++LSV+ +E I  +AA +GIVVIADEV
Sbjct: 241 TNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEV 300

Query: 300 YQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGF 359
           YQ+N+F   +FHSM+KVL++LQ R P  Y+NVQLASLHS SKG+SGECGQRGGYMEL GF
Sbjct: 301 YQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGF 360

Query: 360 REELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQL 419
             E++   +KL SISLCPVVTGQALVDLM  PP +G+ SYEQ   E  +I+ EL ER+  
Sbjct: 361 STEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATY 420

Query: 420 LWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTV 479
           LWK F  +EG+ C  PQG++YLFPK+ +P KA+E AQ+L I  DELYC+ELL+ TGICTV
Sbjct: 421 LWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTV 480

Query: 480 PGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521
           PG+GFGQ PGT+H+RTTFL PGT WI+ W++FH+ F +KYRD
Sbjct: 481 PGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/488 (59%), Positives = 359/488 (73%), Gaps = 3/488 (0%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           F PA  +T  D+N  V KA+YAVRG IPTRA         +P  LPF  II ANIGNPQQ
Sbjct: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154
           L QKPLTF RQV+++++ P++L +    L     F  D + RA R+L D GGS+GAYS S
Sbjct: 80  LDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHS 139

Query: 155 QGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213
           QGV G R+TVA FI RRDG  PA P+++YLT GASSA + LLS  CK  +TG+LIPIPQY
Sbjct: 140 QGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQY 199

Query: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273
           PLYTA+ +  NA  LPYYL+E   WSTN DE+E+V+ D+ K+ I P  L+VINPGNPTG+
Sbjct: 200 PLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGA 259

Query: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333
           VLS + +  I  +AAKYGI +I+DEVYQ+N+F D KFHSM+KVL+ LQ   P  + NVQL
Sbjct: 260 VLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQL 319

Query: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393
           ASLHSISKG   ECGQRGGYME+IGF +E+R    KL SIS+C VVTGQA+VDLMV PP 
Sbjct: 320 ASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379

Query: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453
            GD SYEQ   E   I+HE+  R+ LL++TF  LEGIEC  PQGA+YLFP+L LP+KA+ 
Sbjct: 380 PGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALC 439

Query: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513
            +++LGI  DE YC+ LL+ TGICTVPG+GFGQ PGTYHVRTTFL PGTKWI+ WK+FH+
Sbjct: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQ 499

Query: 514 KFYDKYRD 521
            F+ KYR+
Sbjct: 500 DFFSKYRN 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/488 (58%), Positives = 361/488 (73%), Gaps = 3/488 (0%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           F PA  +T  D+N +V KA+YAVRG IPTRA            SLPF+ II ANIGNPQQ
Sbjct: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154
           L QKPLTF RQV+S+++ P++L +  + L     F  D + RA+R+L D GGSVGAYS S
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHS 139

Query: 155 QGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213
           QGV G R+TVA FI  RDG  PA P+++YLT GASSA + LLS  CK  +TG+L+PIPQY
Sbjct: 140 QGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQY 199

Query: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273
           PLYTA+ +  NA  LPYYL+E   WST  DE+ERV+LD+ K+ I P  LVVINPGNPTG+
Sbjct: 200 PLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGA 259

Query: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333
           VL+   +  I  +AAKYGI +I+DEVYQ+N+FGD KFHSM+K+L+ LQ   P  + NVQL
Sbjct: 260 VLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQL 319

Query: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393
           ASLHSISKG  GECGQRGGYME++GF +++R    KL SIS+C V TGQA++DLMV PP 
Sbjct: 320 ASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQ 379

Query: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453
            GD SY+Q  +E   IY+E+  R+ LL++TF  LEGI+C  PQGA+YLFPKL LP+KA+ 
Sbjct: 380 PGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALR 439

Query: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513
            +++L I  D LYC+ LL+ TGICTVPG+GFGQ  GTYHVRTTFLPPGT+WI+ W+ FH+
Sbjct: 440 ESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQ 499

Query: 514 KFYDKYRD 521
            F++KYRD
Sbjct: 500 DFFNKYRD 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/488 (59%), Positives = 362/488 (74%), Gaps = 3/488 (0%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           F PA  +T  D+N +V KA+YAVRG IPTRA         +PG LPF  II ANIGNPQQ
Sbjct: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154
           L QKPLTF RQV+S+++ P++L++  E L     F  D + RA  +L+D GGSVGAYS S
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHS 139

Query: 155 QGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213
           QGV G R+TVA FI  RDG  PA P+++YLT GASSA + LLS  CK   TG+LIPIPQY
Sbjct: 140 QGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQY 199

Query: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273
           PLYTA+ +  NA  LPYYL+E   WST  DE+E+V+ D+ ++ I P  L+VINPGNPTG+
Sbjct: 200 PLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGA 259

Query: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333
           VL+ + +  I  +AAKYGI VI+DEVYQ+NVF D KFHSM+KVL+ LQ   P  + NVQL
Sbjct: 260 VLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQL 319

Query: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393
           ASLHSISKG  GECGQRGGYME++GF +++R    KL SIS+C VVTGQA+VDLMV PP 
Sbjct: 320 ASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQ 379

Query: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453
            GD SYEQ  QE   I++E+  R+ LL++TF  LEGIEC  PQGA+YLFP+L LP KA  
Sbjct: 380 PGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFR 439

Query: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513
            +++LG+  DE YC+ LL+ TGICTVPG+GFGQ PGTYHVRTTFL PGT+WI++WK+FH+
Sbjct: 440 ESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQ 499

Query: 514 KFYDKYRD 521
            F+++YRD
Sbjct: 500 SFFNEYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/495 (58%), Positives = 364/495 (73%), Gaps = 3/495 (0%)

Query: 30  SVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQA 89
           S   G  F PA  +   D+N+N++ A+YAVRG IP +A          P  LPF+ I  A
Sbjct: 27  STVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVA 86

Query: 90  NIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQ-AFKADVVVRARRMLQDAGGSV 148
           NIGNPQQL QKPLTF RQV+S++Q P LL+   + +   A+K D   RA  +L+  GGSV
Sbjct: 87  NIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146

Query: 149 GAYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVL 207
           GAYS +QGV G R +VA FI RRD G  A+PD+++LT GAS A + LLS  C+   TG++
Sbjct: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206

Query: 208 IPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINP 267
           IPIPQYPLYTA+IT  N+V LPYYL+E  GWST  +E+E+ ++DS KR + P+ +VVINP
Sbjct: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266

Query: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPT- 326
           GNPTG+VLS   +  ILT+AAKYGIVV+ADEVYQ+N++   KFHSM+KVL++LQ   P  
Sbjct: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326

Query: 327 LYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVD 386
            Y NVQLAS+HS SKG+SGECGQRGGYMEL+GF  E+R+V +KLASIS+C VVTGQALVD
Sbjct: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386

Query: 387 LMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLH 446
           LM+ PP +GD SYE   +E + I++ ++ R  LL+ TF  LEGIEC  PQGA+YLFPKL 
Sbjct: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446

Query: 447 LPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIE 506
           L +KAIE A+ LG+  DE YC  LLD TGICTVPG+GFGQ  GTYHVRTTFL PGT+WI+
Sbjct: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506

Query: 507 SWKDFHKKFYDKYRD 521
            W+ FHK FYDKYRD
Sbjct: 507 DWETFHKAFYDKYRD 521

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/488 (59%), Positives = 359/488 (73%), Gaps = 3/488 (0%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           F PA  +T  D+N  V KA+YAVRG IPTRA          PG LPF  II ANIGNPQQ
Sbjct: 20  FKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQ 79

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154
           L QKPLTF RQV+S+++ P++L +  + L     F+ D + RA  +L+D GGS+GAYS S
Sbjct: 80  LDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHS 139

Query: 155 QGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213
           QGV G R++VA+FI +RD G PA P+N+YLT GASSA + LLS  CK  +TG+LIPIPQY
Sbjct: 140 QGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQY 199

Query: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273
           PLYTA+ +  NA  LPYYL+E   WST  DE+E+V+ D+ ++ I P  L+VINPGNPTG+
Sbjct: 200 PLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGA 259

Query: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333
           VLS   +  I  +AAKYGI +I+DEVYQ+NVF   KFHSM+KVL+ LQ   P  + NVQL
Sbjct: 260 VLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQL 319

Query: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393
           ASLHSISKG  GECGQRGGYME++GF +++R    KL SIS+C VVTGQA+VDLMV PP 
Sbjct: 320 ASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379

Query: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453
            GD SY+Q   E   I+HE+  R+ LL +TF  LEGIEC  PQGA+YLFP+L LP+KA+ 
Sbjct: 380 PGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALR 439

Query: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513
            +++LGI  DE YC+ LL+ TGICTVPG+GFGQ PGTYHVRTTFL PGT+WI+ WK FH+
Sbjct: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQ 499

Query: 514 KFYDKYRD 521
            F++KYRD
Sbjct: 500 DFFNKYRD 507

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/490 (59%), Positives = 364/490 (74%), Gaps = 8/490 (1%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           FVPAE +++ D+N++ V A YAVRG IP RA          PGSLPF KII ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQQ-----AFKADVVVRARRMLQDAGGSVGAY 151
           +GQKPLTF RQV+S+++ P +L  P E L++      ++ DV+ RAR+ML   GGSVGAY
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDP-ELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAY 121

Query: 152 SASQGVKGYRRTVAQFIERRDGIP--ANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209
           SASQGV G+R+TVA FI +RDG    A+P++++LT GASSAV  LLS  C GPE GVLIP
Sbjct: 122 SASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIP 181

Query: 210 IPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGN 269
           IPQYPLYTAT+T +N+ A+PYYL E   WSTN  E+E  I +S    + P  +V+INPGN
Sbjct: 182 IPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGN 241

Query: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYK 329
           PTG++LS  D+  I+ ++AKYGI +IADEVYQ+N+F   +FHSMRKVL NLQ   P  Y 
Sbjct: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301

Query: 330 NVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMV 389
           NVQLASLHS SKG  GECGQRGGYMELIGF++E+  + +KLASIS+C VVTGQAL+DL+ 
Sbjct: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361

Query: 390 GPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQ 449
            PP  GD SY+   +E   I  +L  R+  L+  F SLEG+EC  PQGA+YLFPKL LP 
Sbjct: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421

Query: 450 KAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWK 509
           KAIE A +L IP DE YC ELLD TGICTVPG+GFGQ PGTYH+RTTFL PGT+WIE W+
Sbjct: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481

Query: 510 DFHKKFYDKY 519
           +FH++FY+++
Sbjct: 482 EFHQQFYERF 491

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/489 (59%), Positives = 358/489 (73%), Gaps = 5/489 (1%)

Query: 36  RFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGS--LPFSKIIQANIGN 93
            F PA+ +TL D+N+NV+K++YAVRG IP RA         +  S  L F  I+ ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 94  PQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA-FKADVVVRARRMLQDAGGSVGAYS 152
           PQQL QKPLTF RQVIS++Q P+LL      +    FK+D + RA  +L   GGSVGAYS
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146

Query: 153 ASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIP 211
           +SQGV G R TVA +I  RD G  A+PD+++LT GAS A S LLS  CK   TGVLIPIP
Sbjct: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIP 206

Query: 212 QYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPT 271
           QYPLYTATIT  +A  LPYYLNE  GWSTN +E+E+V+LD+   N+ P  +VVINPGNPT
Sbjct: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266

Query: 272 GSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNV 331
           GSVLS  D+  I+ + AKYGIV+IADEVYQ+N+F D +FHSM+KVL++LQ + P  Y  V
Sbjct: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDAV 325

Query: 332 QLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGP 391
           QLASLHS SKG+SGECGQRGGYMEL+GF++E+R+  +KLASISLC V+TGQALVDLMV P
Sbjct: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385

Query: 392 PSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKA 451
           P +GD SYE    E ++I+  L+ER++ L+  FC L+G+EC  PQGA+YLFPKLH PQ  
Sbjct: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445

Query: 452 IEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDF 511
           I  A    +  DE YC  LL+ TGICTVPG+GFGQ  GTYH+RTTFL PG +W E WK F
Sbjct: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505

Query: 512 HKKFYDKYR 520
           H++F+ KY+
Sbjct: 506 HEEFFSKYQ 514

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/491 (55%), Positives = 361/491 (73%), Gaps = 2/491 (0%)

Query: 33  DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIG 92
           + + F PA  ++L D+NENVV AK+A+RG I  +A         +P  LPF +I  ANIG
Sbjct: 7   ENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIG 66

Query: 93  NPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA-FKADVVVRARRMLQDAGGSVGAY 151
           NPQ+L QKPLTF RQV+S++Q P+LL       ++  F +D   RA R+L+D GGSVGAY
Sbjct: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126

Query: 152 SASQGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           SASQGV G R+T A++I +RDG  P+ P++++LT GA+SA S LLS  C+GP+TGVLIPI
Sbjct: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270
           PQYPLYTAT+  N +  +PYYL+E   WSTN  E+E+++LDS K+ I P  +VVINPGNP
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246

Query: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330
           TG+VLS   +  I  +AAKYGIVV+ADEVYQ+N+F   +FHS +KVL+ LQ + P  + N
Sbjct: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306

Query: 331 VQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVG 390
           +QLAS+HS SKG+ GECGQRGGYMEL+GF +E+R++ +KLA +++C VVTGQA+VDLM+ 
Sbjct: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366

Query: 391 PPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQK 450
           PP +GD SYE   +E + I+  + ER++ L+  F  L+GIEC  PQGA+YL+P L L +K
Sbjct: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426

Query: 451 AIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKD 510
           AI  A+ L +  DE YC ELLD TGICTVPG+GFGQ  GTYH+RTTFL PG +WI  W+ 
Sbjct: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486

Query: 511 FHKKFYDKYRD 521
           FHK FY+KY+D
Sbjct: 487 FHKHFYEKYQD 497

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/494 (57%), Positives = 362/494 (73%), Gaps = 5/494 (1%)

Query: 29  SSVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQ 88
           S+ ++ S F  AE +   D+N NVVKAKYAVRG IP+ A         HPG+LPF  +I 
Sbjct: 72  STSREKSYF--AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVIN 129

Query: 89  ANIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQ-AFKADVVVRARRMLQDAGGS 147
           +NIGNPQQLGQKPL+F RQV+S+++ P LL+     +    +  D + RA+ +L D G S
Sbjct: 130 SNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-S 188

Query: 148 VGAYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGV 206
           +GAYS SQGV G R+TVA FI  RD G  A PD+++LTAGASSAVS +LS  CKG +TGV
Sbjct: 189 IGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGV 248

Query: 207 LIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVIN 266
           LIPIPQYPLYTAT+T N+A ALPYYL+E++GWST+ +E+ +V  DS +  I P CLVVIN
Sbjct: 249 LIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVIN 308

Query: 267 PGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPT 326
           PGNPTGSVL+V+ ++ +  +AAKYG+VVIADEVYQDN+F  ++FHSM+K+L+ LQ   P 
Sbjct: 309 PGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPN 368

Query: 327 LYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVD 386
            Y N+QLASLHS SKGL GECG RGGY E IGF  E+++V  KL+SISLC  V GQALVD
Sbjct: 369 KYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVD 428

Query: 387 LMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLH 446
           LM  PP +G+PSYE    E ++I    ++RS  L++ F SLEG+ C  PQGA+Y+FP + 
Sbjct: 429 LMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQ 488

Query: 447 LPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIE 506
           LP  AI+ AQ L I  DE YC ELL  TGICTVPG+GFGQ PGTYHVRTTFL PG +W++
Sbjct: 489 LPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMK 548

Query: 507 SWKDFHKKFYDKYR 520
            W+ FH +F++KYR
Sbjct: 549 RWEKFHIEFFEKYR 562

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/492 (57%), Positives = 357/492 (72%), Gaps = 7/492 (1%)

Query: 35  SRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNP 94
           + F P   +TL D+N  ++K +YAVRG IP RA          P SLPF+KII ANIGNP
Sbjct: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66

Query: 95  QQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQ-----QAFKADVVVRARRMLQDAGGSVG 149
           QQLGQKPL+F R+V+S++Q P +LE  ++ LQ     + ++ DVV RAR++L + GGSVG
Sbjct: 67  QQLGQKPLSFIRKVLSILQYPDILEDESK-LQTLIELRVYQKDVVRRARKLLGEIGGSVG 125

Query: 150 AYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLI 208
           AYS SQGV G ++TVA +I +RD G  A P++++LT GASSAVS +L  FC GP TGVLI
Sbjct: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185

Query: 209 PIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPG 268
           PIPQYPLYTATIT   A A+ YYLNE D WS N  EME  I +S K  I P  +V+INPG
Sbjct: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245

Query: 269 NPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLY 328
           NPTGS+L+ KD+  I+ ++AKYG+++IADEVYQ+NVF   +FHS++KVL+ LQ +    Y
Sbjct: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305

Query: 329 KNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLM 388
           + VQLASLHS SKGL GECGQRGGYMELIG  +++R   VKL SIS+C VVTGQAL+D++
Sbjct: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365

Query: 389 VGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLP 448
           V PP  GD SYE    E  +I ++L  RSQ L + F SLEG+EC  PQGA+YLFPK   P
Sbjct: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425

Query: 449 QKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESW 508
           QK I+ AQKL   AD LYC ELL+ TGICTVPG+GFGQ P TYH+RTTFL PG  WI+ W
Sbjct: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485

Query: 509 KDFHKKFYDKYR 520
           + FH +F ++YR
Sbjct: 486 RKFHTEFCERYR 497

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/488 (56%), Positives = 358/488 (73%), Gaps = 5/488 (1%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXX--XXXHPGSLPFSKIIQANIGNP 94
           F PA  +++AD+N+ ++ A+YAVRG I  RA            P S PF +II ANIGNP
Sbjct: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83

Query: 95  QQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA-FKADVVVRARRMLQDAGGSVGAYSA 153
           QQL QKPLTF RQV+S+++ P LL+     L Q  +K D + RA  +    G SVGAYS 
Sbjct: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143

Query: 154 SQGVKGYRRTVAQFIERRDGI-PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQ 212
           +QGV G R T A+FI +RD    A+ D+++LT GAS AV+ L+   C+   TG+LIPIPQ
Sbjct: 144 AQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQ 203

Query: 213 YPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTG 272
           YPLYTA+I  +NA  LPYYL+E  GWST  +E+E  ++++ +  I P  +VVINPGNPTG
Sbjct: 204 YPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTG 263

Query: 273 SVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQ 332
           +VLSV  ++ I+T+AAKYGIV+IADEVYQDN+F + +FHSM+K+L+ LQ + P  Y NVQ
Sbjct: 264 AVLSVDVIQRIITVAAKYGIVLIADEVYQDNIF-NGEFHSMKKILRQLQKKYPGKYDNVQ 322

Query: 333 LASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPP 392
           LASLHS SKG+SGECGQRGGYME++GF +E+R + +KLASI++C VVTGQALVDLMV PP
Sbjct: 323 LASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPP 382

Query: 393 SQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAI 452
             GD SYE+  +E   I+  L++R+  L+ TF +LEGIEC  PQGA+YLFP+L LP +AI
Sbjct: 383 HVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAI 442

Query: 453 EAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFH 512
           E A+KL + ADE YC +LL+ TGICTVPG+GFGQ  GTYHVRTTFL PGT+WI+ WK FH
Sbjct: 443 EEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFH 502

Query: 513 KKFYDKYR 520
           +KF  +Y+
Sbjct: 503 EKFMKEYQ 510

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/492 (54%), Positives = 353/492 (71%), Gaps = 5/492 (1%)

Query: 33  DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIG 92
           D   F PA  +++ D+N NV+KA++AVRG IP +A         +P SLPF++I  ANIG
Sbjct: 9   DLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIG 68

Query: 93  NPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA---FKADVVVRARRMLQDAGGSVG 149
           NPQ+L QKPLTF RQV+S++Q P+LL    E        +  D   RA ++L + GGSVG
Sbjct: 69  NPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVG 128

Query: 150 AYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLI 208
           AYSASQGV G R+T+A +I +RD G  A+P+++++T GA++A S LLS    GP+TGVL+
Sbjct: 129 AYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLL 188

Query: 209 PIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVIL-DSKKRNIAPKCLVVINP 267
           PIPQYPLYTA +  +NA  LPYYL E  GWS + +E+E+ I  ++  + I PK +V+INP
Sbjct: 189 PIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINP 248

Query: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTL 327
           GNPTGS+LS   +  I  +AAKYGIV+IADEVYQ+N+F   KFHS +KVL++LQ + PT 
Sbjct: 249 GNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQ 308

Query: 328 YKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDL 387
           Y NVQLASLHS SKGL GECGQRGGYME+IGF  ++R + +KLA I +CPVVTGQA++DL
Sbjct: 309 YNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDL 368

Query: 388 MVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHL 447
           M+ PP QGD SY+    E + I++++  R++ L+  F  +EGI+C  PQGA+YLFP+L L
Sbjct: 369 MILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLL 428

Query: 448 PQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIES 507
             K I+ A+K  +  DE YC ELL+ETGICTVPG+GFGQ P TYH+RTTFL PG +WI  
Sbjct: 429 STKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINK 488

Query: 508 WKDFHKKFYDKY 519
           W+ FHK F  +Y
Sbjct: 489 WEKFHKAFLKRY 500

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/493 (54%), Positives = 352/493 (71%), Gaps = 9/493 (1%)

Query: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQANIGNPQQ 96
           F+PA   +L D+NE+++KA+YA+RG IP RA         +  SLPF+KI+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWL-QQAFKADVVVRARRMLQDAGGSVGAYSASQ 155
           L Q+PLTF RQV+SL+Q P LL+     L Q+ +  D + RA ++L   GGSVGAYS+SQ
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQ 127

Query: 156 GVKGYRRTVAQFIERRDG--------IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVL 207
           GV   R+ VA+FI +RD         I     NV+LTAGAS+AV  +L  F K    GVL
Sbjct: 128 GVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVL 187

Query: 208 IPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINP 267
           +PIPQYPLYTA +T   +  LPYYLNE++ WST+P ++E++++D+ K+NI P  LVVINP
Sbjct: 188 LPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINP 247

Query: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTL 327
           GNPTG++L+   +  I+ +AA+YGIV+IADEVYQ+NV+   +FHS +KVL  L+   P+ 
Sbjct: 248 GNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSK 307

Query: 328 YKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDL 387
           Y NVQLASLHSISKG++GECGQRGGYME+ GF  +++KV +K+ASIS+C VVTGQ LVDL
Sbjct: 308 YDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDL 367

Query: 388 MVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHL 447
           MV PP  GD SYE    E   I+  L  +S  L+  F  L GI C  PQGA+YLFP+LHL
Sbjct: 368 MVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHL 427

Query: 448 PQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIES 507
            + AI AA +L +  DE YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFLPPG +WI S
Sbjct: 428 SENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINS 487

Query: 508 WKDFHKKFYDKYR 520
           W+ FH +F +KY+
Sbjct: 488 WEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 345/502 (68%), Gaps = 14/502 (2%)

Query: 30  SVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAXXXXXXXXXHPGSLPFSKIIQA 89
           S KD +   PA   +L D++++++  +YA+RG IPTRA          P  LPF KII A
Sbjct: 2   SAKDCT---PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYA 58

Query: 90  NIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQAFKA-DVVVRARRMLQDAGGSV 148
           NIGNPQQL Q+PLTF RQV+SL++ P L+      ++    A D + RA  +L   GGSV
Sbjct: 59  NIGNPQQLEQEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSV 118

Query: 149 GAYSASQGVKGYRRTVAQFIERRDG----------IPANPDNVYLTAGASSAVSCLLSTF 198
           GAYS+SQG+   R+ VA+ I +RD           I     N++LT GA++AVS +L  F
Sbjct: 119 GAYSSSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLF 178

Query: 199 CKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIA 258
            K    GVL+PIPQYPLYTA +T  N+  LPYYLNE + WST+P+E+E +I D+  RNI 
Sbjct: 179 AKDENCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIK 238

Query: 259 PKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLK 318
           P  LV+INPGNPTG++LSV+ +  I+ +AAKYGIV+IADEVYQ+N++ D KFHS +K+L 
Sbjct: 239 PTTLVIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILN 298

Query: 319 NLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPV 378
           +L+L+ P  Y NVQLASLHSISKG++GECGQRGGY EL+GF +E++K+ +KLASI +C V
Sbjct: 299 SLKLQYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSV 358

Query: 379 VTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGA 438
           VTGQ LVDLM  PP +GD SY+   +E  +I   L  +S  L+  F  L GI C  PQGA
Sbjct: 359 VTGQILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGA 418

Query: 439 LYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFL 498
           +YLFP+LHL    I  A+   +  DE YC +LL+ TGICTVPG+GFGQ  GTYHVRTTFL
Sbjct: 419 MYLFPRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFL 478

Query: 499 PPGTKWIESWKDFHKKFYDKYR 520
           P G +WI+ W+ FH +F ++Y+
Sbjct: 479 PSGIEWIKLWEKFHLEFMNQYK 500

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 93/188 (49%), Gaps = 18/188 (9%)

Query: 160 YRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTAT 219
           YR   + F + ++  P + DN+ L  G+  ++  L+   C   +  +LI    Y +YT  
Sbjct: 70  YRNKTSIF-KDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTIC 128

Query: 220 ITQNNA--VALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSV 277
              N+   V +P  L+E D +  +    E  IL++ + + + K + + +PGNPTG+ + V
Sbjct: 129 SQVNDVEYVTVPLLLSEEDKFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFIDV 184

Query: 278 KDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLH 337
             +E IL+   + G+VV+ DE Y D V G  K  S+  +         T Y+N+ +    
Sbjct: 185 NRIEKILS-QWQTGLVVV-DEAYIDFVEGSDK-GSLAPL--------ATKYENIAVLQTL 233

Query: 338 SISKGLSG 345
           S S GL+G
Sbjct: 234 SKSFGLAG 241

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 89/192 (46%), Gaps = 21/192 (10%)

Query: 160 YRRTVAQFIERRD---GI-PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
           ++  +A F  R D   GI P   DN+ L  G+   +  L+   C+     +L   P Y +
Sbjct: 62  FKTLLAGFRNRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSM 121

Query: 216 YT--ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273
           Y+  A I     V  P  + E + +  N  E    +L + K +   K L + +PGNPTG 
Sbjct: 122 YSVCANINDVEIVECPL-ITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGK 176

Query: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333
           +++ KD+E IL      G+VV+ DE Y D    +   +SM K++        T Y N+ +
Sbjct: 177 LVNKKDIEFILENWTN-GLVVV-DEAYIDFADAEGTTYSMAKLV--------TKYPNLTV 226

Query: 334 ASLHSISKGLSG 345
               S S GL+G
Sbjct: 227 LQTLSKSFGLAG 238

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 73/165 (44%), Gaps = 14/165 (8%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           Y A QG    R+ +A+     D +  + +NV LT GA +A      T     +  + I  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED-VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICIS- 112

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270
           P Y   ++      A     +L +   +  N  E+ER+I    K N   KC+V+  P NP
Sbjct: 113 PTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMI----KPN--TKCIVLNTPNNP 166

Query: 271 TGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRK 315
             SV+  + +  I  LA K+GIVV  DEVY         FHS  K
Sbjct: 167 LSSVIPTETLREIAELADKHGIVVFCDEVYS------PLFHSCEK 205

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 144/353 (40%), Gaps = 47/353 (13%)

Query: 148 VGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAV-SCLLSTFCKGPETGV 206
           V  YS ++G     +++ +  +   G   +  NV +T GA+  + SCL+     G E  V
Sbjct: 74  VNQYSPTRGRPSLIKSLVELYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDE--V 131

Query: 207 LIPIPQYPLYTATITQNNAVA--LPYY--------LNEADGWSTNPDEMERVILDSKKRN 256
           ++  P +  Y   I     V   +P +            D W  + D +E+        N
Sbjct: 132 IVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTF------N 185

Query: 257 IAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDA--KFHSMR 314
              K +++  P NP G V + +++  +  L  ++  VVI+DEVY+   F ++  +  ++ 
Sbjct: 186 NKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTESFPRIANIN 245

Query: 315 KVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASIS 374
           + + NL L            ++ S  K  +   G R G+  +I   ++L   +V  A   
Sbjct: 246 EDIANLTL------------TVGSAGKSFAA-TGWRIGW--IISKNDQLLN-YVSKAHTR 289

Query: 375 LCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNM 434
           +C   +   L +   G           Y  + R    E  ++ ++L   F  L G+    
Sbjct: 290 IC-FASPSPLQEACAGSIEHALKI--DYFPKMR---EEYRKKFEILTTAFDKL-GLNYTQ 342

Query: 435 PQGALYL---FPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGF 484
           P+G  ++   F K+ +P+  +   + L    D      L++E GI  +P T F
Sbjct: 343 PEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 71/152 (46%), Gaps = 8/152 (5%)

Query: 150 AYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209
            Y A +G    R  VA     ++ +  + DNV +T GA  A + L+S    GP   V+  
Sbjct: 54  TYGAIKGSDELRSLVASLYSDKE-VKLDKDNVLITNGAIGA-NFLVSYTLAGPGDHVICV 111

Query: 210 IPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGN 269
            P Y   ++      A      LN  + +  +  +++ +I    K N   KC+V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMI----KGN--TKCIVLNNPNN 165

Query: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
           P GSV+    +E I  LA K  I VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 8/151 (5%)

Query: 150 AYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209
            Y +  G    R  VA+ I   D I    DNV +T GA  A + L+     GP   ++  
Sbjct: 54  TYGSIWGTPVLRDLVAK-IHSSDEIQLTADNVLITNGAIGA-NFLVHYTAAGPGDHIICV 111

Query: 210 IPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGN 269
            P Y   ++  +   A     +L   DG++ N  +     L SK R    K +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQK-----LKSKVR-ANTKYIVLNNPNN 165

Query: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           P GSV+S + M  I+  A +  I ++ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 75/168 (44%), Gaps = 19/168 (11%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAV-SCLLSTFCKGPETGVLIP 209
           YS ++G     + +A       G   + DN+ +  GA+ A+ SCL+    KG E  V++ 
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLSADNITVHTGANEAIFSCLMGLLNKGDE--VIVF 134

Query: 210 IPQYPLYTATITQNNAVALPYYLN---EADG-------WSTNPDEMERVILDSKKRNIAP 259
            P +  Y + I     V     +N   E D        W  + D +E+ I      N   
Sbjct: 135 EPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTI------NSRT 188

Query: 260 KCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGD 307
           KC+++  P NP G V + +++  +  +     IV+I+DEVY+   F D
Sbjct: 189 KCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYFSD 236

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 75/169 (44%), Gaps = 15/169 (8%)

Query: 148 VGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAV-SCLLSTFCKGPETGV 206
           V  YS ++G     +++         +   P+NV +T GA+  + +CL+    +  E  V
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLKPENVLVTTGANEGILACLMGILNQNDEVIV 143

Query: 207 LIP-----IPQYPLYTATITQ---NNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIA 258
             P     IP   L    +     N    L   + +   W+ + ++ E VI +  K    
Sbjct: 144 FEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITNKTK---- 199

Query: 259 PKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGD 307
              +++  P NP G V + ++++ I  +  K+ +++I+DEVY +  F D
Sbjct: 200 --AIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYFVD 246

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 67/130 (51%), Gaps = 9/130 (6%)

Query: 175 PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT--ATITQNNAVALPYYL 232
           P + DN+ L  G+  ++  L+   C   +  +LI  P Y +Y+  A I     + +P  +
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 233 NEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGI 292
            E + +  N D+    ++++ + +   K   V +PGNPTG+++ +  +E IL+   + GI
Sbjct: 144 -EDNSFQMNTDK----VIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGI 197

Query: 293 VVIADEVYQD 302
           V I DE Y D
Sbjct: 198 VAI-DEAYID 206

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (46%), Gaps = 29/199 (14%)

Query: 160 YRRTVAQFIERRDGIPANPD----NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
           ++   A +   +D     PD    N+ L  G+   +  L+   CK     +++  P Y +
Sbjct: 62  FKTLFAHYRNSKDNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSM 121

Query: 216 YT--ATITQNNAVALPYYLNEADGWSTNPDEME-RVILDSKKRNIAPKCLVVINPGNPTG 272
           Y+  A I   + V  P  + +      N  +M+ +  L++ K++   + L + +PGNPTG
Sbjct: 122 YSVCANINDVDVVNCPLIVED------NSFQMDVKRTLETLKKDDLIRLLFITSPGNPTG 175

Query: 273 SVLSVKDMEAILTLAAKYGIVVIADEVYQD--NVFGD----AKFHSMRKVLKNLQLREPT 326
            ++++KD+  +L    K G+VV+ DE Y D    F +     ++ S+ K++        T
Sbjct: 176 KIIAIKDIIYVLE-HWKNGLVVV-DEAYVDFSTYFNEETKKTEYFSVAKLV--------T 225

Query: 327 LYKNVQLASLHSISKGLSG 345
            Y N+ +    S S GL+G
Sbjct: 226 KYPNLTVLQTLSKSFGLAG 244

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 69/145 (47%), Gaps = 10/145 (6%)

Query: 160 YRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT-- 217
           YR T + F + RD      +N+ L  G+  ++  ++   C   +  +L+  P Y +Y+  
Sbjct: 70  YRNTTSAF-KDRDLATLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVC 128

Query: 218 ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSV 277
           A I     V  P  + E + +  N D+    +LD  K +   K + + +PGNPTG  +  
Sbjct: 129 ANINDIEVVECPL-IYEDNSFQLNSDK----VLDILKNDPLIKLVFITSPGNPTGVKIET 183

Query: 278 KDMEAILTLAAKYGIVVIADEVYQD 302
           K +E +L      G+VV+ DE Y D
Sbjct: 184 KRIEKVLQ-NWDNGLVVV-DEAYID 206

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 69/147 (46%), Gaps = 12/147 (8%)

Query: 159 GYRRTVAQFIERRDGI-PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT 217
            YR   + F  + +G+ P +  N+ L  G+   V  L+   C      VL+  P Y +Y+
Sbjct: 69  NYRNNTSAF--KSEGLAPISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYS 126

Query: 218 --ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVL 275
             A I     V  P  + E + +  + D     +L++   + + K L +  PGNPTG+ +
Sbjct: 127 VFAMINDTEVVECPL-ITEDNSFDMDLDN----VLETLSNDDSIKLLFITTPGNPTGASI 181

Query: 276 SVKDMEAILTLAAKYGIVVIADEVYQD 302
           S + +E +L      GIVV+ DE Y D
Sbjct: 182 STQKIEMLLN-NWSAGIVVV-DEAYID 206

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 77/343 (22%), Positives = 134/343 (39%), Gaps = 60/343 (17%)

Query: 178 PDNVYLTAGASSAV-SCLLSTFCKGPETGVLIP-----IPQYPLYTATITQ---NNAVAL 228
           P+NV +T GA+  + SCL+     G E  V  P     IP   L    +     N    L
Sbjct: 115 PENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEL 174

Query: 229 PYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAA 288
              + +   W+ + DE  R I    K       +++  P NP G V + +++  +  +  
Sbjct: 175 DNRVTKGTEWTVDFDEFTRAITPKTK------AVIINTPHNPIGKVFTREELTKLGNICV 228

Query: 289 KYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLS-GEC 347
           +  +++IADEVY+   F D +F            R  TL + +   +L   S G S    
Sbjct: 229 ENNVIIIADEVYEHLYFVD-EFP-----------RIATLSEEIGQLTLSVGSAGKSFAAT 276

Query: 348 GQRGGYM-----ELIGF--REELRKVFVKLASI-SLCPVVTGQAL-VDLMVGPPSQGDPS 398
           G R G++     +L+ +  +   R  F   + I   C      AL +D       +    
Sbjct: 277 GWRIGWVVSQNPDLLQYASKAHTRICFASPSPIQEACSYSIDHALKIDYFENMRQEYVKK 336

Query: 399 YEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQKAIEAA 455
           ++ +T    S++ EL               G+   +P+G+ ++   F K+ +P       
Sbjct: 337 FKIFT----SVFDEL---------------GLPYTIPEGSYFVLADFSKVKIPDSYQFPE 377

Query: 456 QKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFL 498
           + +    D    + L++E G+  +P T F  IP   H     L
Sbjct: 378 EIMSKGKDFRISNWLINELGVVAIPPTEF-YIPEHEHAAENLL 419

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 89/197 (45%), Gaps = 26/197 (13%)

Query: 160 YRRTVAQFIERRDGI-PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLY-- 216
           YR   + F  R +G+ P    N+ L  G+  ++  ++   C   E  V++  P Y +Y  
Sbjct: 70  YRNAASAF--REEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKV 127

Query: 217 TATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLS 276
            A I     V +P  ++  + +  + D     IL+    + + K + + +PGNPTG+ + 
Sbjct: 128 CADINDVGYVEVPL-ISSDNSFQIDEDR----ILEQLNLDKSIKVVFITSPGNPTGACIE 182

Query: 277 VKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASL 336
           V  +E +L      GIVV+ DE Y D       F + +  L       P + K+  L  L
Sbjct: 183 VGRVEKLLR-NWTAGIVVV-DEAYID-------FSADKPSLS------PLVNKHPNLVVL 227

Query: 337 HSISKGLSGECGQRGGY 353
            ++SK  SG  G R G+
Sbjct: 228 QTLSKA-SGLAGIRLGF 243

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 74/165 (44%), Gaps = 19/165 (11%)

Query: 150 AYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209
            Y + +G    R  +A       G   N DNV +T GA +A   +  T   GP   V+  
Sbjct: 54  TYGSIKGSDKLRSLIASMY----GPEFNKDNVLVTNGAIAANFLIYYTLV-GPGDHVICV 108

Query: 210 IPQYP-LYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPG 268
            P Y  LY+        V+L   L + DG+  N + ++++I    K N   K +++ NP 
Sbjct: 109 DPTYAQLYSVPKMFGAEVSL-LKLQKEDGFIPNIETLKKMI----KSNT--KLIIINNPN 161

Query: 269 NPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSM 313
           NP GS +S + +  I  L  +  I +  DEVY+        FHSM
Sbjct: 162 NPLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 124/322 (38%), Gaps = 47/322 (14%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIP-----IPQYPLYTATITQ---NNAVALP 229
           +NV +T GA+  + SCL+     G E  V  P     IP   L    +     N    + 
Sbjct: 115 ENVTVTTGANEGILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMD 174

Query: 230 YYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAK 289
             + +   W+ + ++    I D  K       +++  P NP G V + +++  I  +  K
Sbjct: 175 QRVVKGTEWTVDYEQFANAITDKTK------AVIINTPHNPIGKVFTREELTRIGEICVK 228

Query: 290 YGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLS-GECG 348
             +V+I+DEVY+   F D+              R  TL   +   +L   S G S    G
Sbjct: 229 KNVVIISDEVYEHLYFTDS------------FTRIATLSPEIGQLTLSVGSAGKSFAATG 276

Query: 349 QRGGYMELIGFREELRKVFVKLASISLC---PVVTGQALVDLMVGPPSQGDPSYEQYTQE 405
            R G++  +    EL   +V  A   +C   P    +A+ +      S  D     Y + 
Sbjct: 277 WRVGWV--VSLNPELLS-YVSKAHTRICFASPSPLQEAVAN------SINDALEINYFEN 327

Query: 406 TRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQKAIEAAQKLGIPA 462
            R    E + +  +    F  L G+    P+G  ++   F K+ +P+      +      
Sbjct: 328 MR---QEYKHKYDIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAK 383

Query: 463 DELYCSELLDETGICTVPGTGF 484
           D      L++E G+  +P T F
Sbjct: 384 DFRIAYWLINELGVVAIPPTEF 405

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 61/139 (43%), Gaps = 15/139 (10%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIP-----IPQYPLYTATITQ---NNAVALP 229
           +NV +T GA+  + SCL+     G E  V  P     IP   L    +     N    L 
Sbjct: 116 ENVVVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELD 175

Query: 230 YYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAK 289
                 + W+ + ++ E+ I    K       +++  P NP G V +  ++  +  +  K
Sbjct: 176 QRNTRGEEWTIDFEQFEKAITSKTK------AVIINTPNNPIGKVFTHDELTTLGNICVK 229

Query: 290 YGIVVIADEVYQDNVFGDA 308
           + +V+I+DEVY+   F D+
Sbjct: 230 HNVVIISDEVYEHLYFTDS 248

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 125/323 (38%), Gaps = 47/323 (14%)

Query: 178 PDNVYLTAGASSAV-SCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYY----- 231
           P NV +T GA+ A+ SCL+    +G E  V  P     +    I       +P +     
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKEL 177

Query: 232 ---LNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAA 288
              +     W+ + DE+   I    K       L++  P NP G V + +++  I  +  
Sbjct: 178 ENRVTHGTEWTVDYDELRAAITPKTK------ALILNTPHNPIGKVFTREELLEIGNICV 231

Query: 289 KYGIVVIADEVYQDNVFGD--AKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGE 346
           +  +V+I+DEVY+   F     +  ++   + NL L            S+ S  K  +  
Sbjct: 232 ENNVVIISDEVYEHLYFTSEFTRIATLSPEIGNLTL------------SVGSAGKTFAA- 278

Query: 347 CGQRGGYMELIGFREELRKVFVKLASISLCPVVTG--QALVDLMVGPPSQGDPSYEQYTQ 404
            G R G+  ++    EL K +  +A   +C       Q      +    Q +     Y +
Sbjct: 279 TGWRIGW--IVSQNAELLK-YASMAHTRICFASPSPFQEACAKSIEIALQNN-----YFE 330

Query: 405 ETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQKAIEAAQKLGIP 461
           + R    E   +  +  + F  L G+    P+G  ++   F K+ +P+      + L   
Sbjct: 331 KMR---QEYINKFDIFTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSKA 386

Query: 462 ADELYCSELLDETGICTVPGTGF 484
            D      L++E G+  +P T F
Sbjct: 387 KDFRISYWLINELGVVAIPPTEF 409

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 15/139 (10%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIP-----IPQYPLYTATITQ---NNAVALP 229
           +NV +T GA+  + SCL+     G E  V  P     IP   L    +     N    L 
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELD 175

Query: 230 YYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAK 289
                 + W+ + ++ E+ I    K       +++  P NP G V + +++  +  +  K
Sbjct: 176 QRNTRGEEWTIDFEQFEKAITSKTK------AVIINTPHNPIGKVFTREELTTLGNICVK 229

Query: 290 YGIVVIADEVYQDNVFGDA 308
           + +V+I+DEVY+   F D+
Sbjct: 230 HNVVIISDEVYEHLYFTDS 248

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 65/136 (47%), Gaps = 9/136 (6%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLN---E 234
           +NV +T GA+  + SCL+     G E  V  P     +    +     V +P  +N   E
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELCGGKVVYVP--INPPKE 173

Query: 235 ADGWSTNPDEMERVILDSKKRNIAPKCLVVI--NPGNPTGSVLSVKDMEAILTLAAKYGI 292
            D  +T  +E   +  +  ++ I PK   VI   P NP G V + +++  +  +  K+ +
Sbjct: 174 LDLRNTRGEEW-TIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNV 232

Query: 293 VVIADEVYQDNVFGDA 308
           ++I+DEVY+   F D+
Sbjct: 233 IIISDEVYEHLYFTDS 248

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/322 (21%), Positives = 127/322 (39%), Gaps = 47/322 (14%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPY------- 230
           +NV +T GA+  + SCL+     G E  V  P     +    +     V +P        
Sbjct: 117 ENVTITTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKIVYVPINPPKELD 176

Query: 231 -YLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAK 289
             + E   W+ + ++ +  I    K       +++  P NP G V + +++  I  +  +
Sbjct: 177 QRVTEGTEWTVDMEQFKNAITSKTK------AVIINTPHNPIGKVFTREELLQIGNICVE 230

Query: 290 YGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLS-GECG 348
             +++I+DEVY+   F D +F            R  TL   +   +L   S G +    G
Sbjct: 231 KNVIIISDEVYEHLYFTD-EF-----------TRIATLSPEIGQLTLTVGSAGKTFAATG 278

Query: 349 QRGGYMELIGFREELRKVFVKLASISLC---PVVTGQALVDLMVGPPSQGDPSYEQYTQE 405
            R G++  I    EL + +V  A   +C   P    +A  +      S  D     Y ++
Sbjct: 279 WRIGWV--ISLNSELLQ-YVSKAHTRICFASPSPLQEACAN------SINDALESNYFEK 329

Query: 406 TRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQKAIEAAQKLGIPA 462
            R    E  ++ ++    F  L G+    P+G  ++   F K+ +P+      + L    
Sbjct: 330 MR---QEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGK 385

Query: 463 DELYCSELLDETGICTVPGTGF 484
           D      L++E G+  +P T F
Sbjct: 386 DFRISHWLINELGVVAIPPTEF 407

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 15/139 (10%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIP-----IPQYPLYTATITQ---NNAVALP 229
           +NV +T GA+  + SCL+     G E  V  P     IP   L    +     N    L 
Sbjct: 132 ENVTVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELD 191

Query: 230 YYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAK 289
               + + W+ + ++ E  I    K       +++  P NP G V + +++  +  +  K
Sbjct: 192 QRNTKGEEWTIDFEQFENAITSKTK------AVIINTPHNPIGKVFTREELTTLGNICVK 245

Query: 290 YGIVVIADEVYQDNVFGDA 308
           + +V+I+DEVY+   F D+
Sbjct: 246 HNVVIISDEVYEHLFFTDS 264

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 128/322 (39%), Gaps = 47/322 (14%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYY----LN 233
            NV +T GA+  + SCL+     G E  V  P     +    I       +P +    +N
Sbjct: 115 SNVQVTTGANEGILSCLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTYVPMHPPKEMN 174

Query: 234 ----EADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAK 289
               +   W+ N DE+E  I    K       L++  P NP G V + +++  I  +  K
Sbjct: 175 VRNTKGTEWTVNYDELEAAITPKTK------ALILNTPHNPVGKVFTREELLRIGEICVK 228

Query: 290 YGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLS-GECG 348
           + +V+I+DEVY+ +++   +F            R  TL   +   +L   S G S    G
Sbjct: 229 HNVVIISDEVYE-HLYFTPEF-----------TRIATLSPEIGQITLTVGSAGKSFAATG 276

Query: 349 QRGGYMELIGFREELRKVFVKLASISLC---PVVTGQALVDLMVGPPSQGDPSYEQYTQE 405
            R G+  ++    EL K +  +A   +C   P    +A  + +      G      Y ++
Sbjct: 277 WRIGW--VVSLNPELLK-YASMAHTRICFSSPSPLQEACANSLNTALDNG------YFEK 327

Query: 406 TRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQKAIEAAQKLGIPA 462
            R    E   + ++  + F  L G+    P+G  ++   F K+ +P       +      
Sbjct: 328 MR---QEYINKFKIFTRVFDEL-GLPYTEPEGTYFVLVDFSKVKIPDNYPFPEELRSKGK 383

Query: 463 DELYCSELLDETGICTVPGTGF 484
           D      L++E G+  +P T F
Sbjct: 384 DFRISYWLVNELGVVAIPPTEF 405

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/355 (21%), Positives = 139/355 (39%), Gaps = 51/355 (14%)

Query: 148 VGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAV-SCLLSTFCKGPETGV 206
           V  YS ++G      ++ +      G     +NV +T GA+  + S L+     G E  V
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYGQELKDENVTITTGANEGILSSLMGILNPGDEVIV 151

Query: 207 LIP-----IPQYPLYTATITQ---NNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIA 258
             P     IP   L    +     N    +   + E   W+ + +E+ +      K    
Sbjct: 152 FEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTSKTK---- 207

Query: 259 PKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLK 318
              L++  P NP G V + +++  I  L  +  +V+I+DEVY+   F D+          
Sbjct: 208 --ALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFLYFTDS---------- 255

Query: 319 NLQLREPTLYKNVQLASLHSISKGLS-GECGQRGGYM-----ELIGFREELRKVFVKLAS 372
               R  TL   +   +L   S G +    G R G++     EL+ +   + K   ++  
Sbjct: 256 --YTRIATLSPEIGQLTLTVGSAGKTFAATGWRIGWVISLNPELLSY---VSKGHTRICF 310

Query: 373 ISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIEC 432
            S  P+   Q  V   +    +GD     Y +  R+ Y     + ++    F  + G+  
Sbjct: 311 SSPSPI---QEAVANSIEDALKGD-----YFEAMRTDYI---RKFEIFTSVFKEM-GLPY 358

Query: 433 NMPQGALYL---FPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGF 484
            +P+G  ++   F K+++P+      + L    D      L++E G+  +P T F
Sbjct: 359 TIPEGTYFILVDFSKVNVPEDYPYPEELLDKGKDFRISYWLINELGVVAIPPTEF 413

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 80/194 (41%), Gaps = 26/194 (13%)

Query: 156 GVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
            +  YR   + F       P    N+ L  G+  ++  ++   C      +L+  P Y +
Sbjct: 65  AIAEYRNRSSTFTADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSM 124

Query: 216 YT--ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273
           Y+  A I     V  P  + E + +  + D+    +LD    +   K L + +PGNPTG+
Sbjct: 125 YSVCAKINDVEVVTCPL-ITEDNSFQMDSDK----VLDILNNDQEIKLLFITSPGNPTGA 179

Query: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333
            +    +E +L    + G+VV+ DE Y D   G                  P + K   L
Sbjct: 180 QIETARIEKVLQNWDR-GLVVV-DEAYVDFCGGSTA---------------PLVTKYQNL 222

Query: 334 ASLHSISK--GLSG 345
            +L ++SK  GL+G
Sbjct: 223 VTLQTLSKSFGLAG 236

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/357 (22%), Positives = 147/357 (41%), Gaps = 61/357 (17%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAV-SCLLSTFCKGPETGVLIP 209
           YS ++G     +++  F         N  NV +T GA+  + + L+     G E  V++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANEGILASLVGLLNPGDE--VIVF 145

Query: 210 IPQYPLYTATI------TQNNAVALPYYLNE----ADGWSTNPDEMERVILDSKKRNIAP 259
            P +  Y + I       +   +  P  L+E       W  + D + + I      N   
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTI------NERT 199

Query: 260 KCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGD--AKFHSMRKVL 317
           KC+++  P NP G V + +++  +  +  K  I +I+DEVY+   FGD   +  ++ K +
Sbjct: 200 KCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGDEFTRIATISKEI 259

Query: 318 KNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYM-----ELIGFREELRKVFVKLAS 372
            +L L            S+ S  K  +   G R G++     EL+ +   + K   ++  
Sbjct: 260 GDLTL------------SVGSAGKSFAA-TGWRIGWVVSRNAELLSY---VSKAHTRICF 303

Query: 373 ISLCPVVTGQAL-VDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIE 431
            S  P     A  +D+ +         +  Y +  R    E +E+  +L + F  L G+ 
Sbjct: 304 SSPSPFQEACAHSIDIGL---------HNGYFENMR---EEYKEKFAILTRVFDEL-GLP 350

Query: 432 CNMPQGALYL---FPKLHLPQKAIEAAQKLGIPADELYCSE-LLDETGICTVPGTGF 484
              P G  ++   F K+ +P +     ++L   A +   S  L++E G+  +P T F
Sbjct: 351 YTKPDGTYFVCVDFSKVQIPDE-YPFPRELNERAKDFKLSYWLVNELGVVAIPPTEF 406

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 130/330 (39%), Gaps = 63/330 (19%)

Query: 179 DNVYLTAGASSAV-SCLLSTFCKGPETGVLIP-----IPQYPLYTATITQ---NNAVALP 229
           +NV +T GA+  + +CL      G E  V  P     IP   L    +          L 
Sbjct: 130 ENVQVTTGANEGIFACLAGLVNPGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAELS 189

Query: 230 YYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAK 289
             + E   W  + D + + I      N   K +++ +P NP G V + +++  +  +  +
Sbjct: 190 KRVTEGTEWVIDYDMLRQTI------NEKTKAVIINSPHNPIGKVFTREELLKLGNICVE 243

Query: 290 YGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGE--- 346
            GI +I+DEVY+   F D +F            R  TL + +   S H+++ G +G+   
Sbjct: 244 KGIYIISDEVYEHLYFTD-EF-----------TRIATLSEEI---SQHTLTVGSAGKSFA 288

Query: 347 -CGQRGGYM-----ELIGF--REELRKVFVKLASI-SLCPVVTGQALVDLMVGPPSQGDP 397
             G R G++     EL+    +  +R  F   A +   C V    AL             
Sbjct: 289 ATGWRIGWVISRNKELLALASKAHVRICFSSPAPLQEACAVAIEHALKT----------- 337

Query: 398 SYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQKAIEA 454
               Y  +TR+ Y +  ER Q   K F  L G+     +G+ +L   F +L LP      
Sbjct: 338 ---TYYADTRAAYQKKYERFQ---KPFDDL-GLPYTRAEGSYFLLVDFSRLPLPADYHFP 390

Query: 455 AQKLGIPADELYCSELLDETGICTVPGTGF 484
            +      D      L++E G+  +P + F
Sbjct: 391 EELADKGRDFRVAYWLINELGLVAIPCSSF 420

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 79/370 (21%), Positives = 144/370 (38%), Gaps = 49/370 (13%)

Query: 131 ADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSA 190
           A VV  A++ L DA   V  YS ++G      ++ +            +N+ +T GA+  
Sbjct: 69  AFVVEEAQKALDDA--MVNQYSPTKGRMSLINSLIKQYSPLYNTQLQANNIQVTTGANEG 126

Query: 191 V-SCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYL--------NEADGWSTN 241
           + +CL+     G E  V  P     +    I       +P +          E   W+ +
Sbjct: 127 ILACLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWTVD 186

Query: 242 PDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
            DE+   I    K       L++  P NP G V + +++  I  +  +  +V+I+DEVY+
Sbjct: 187 YDELRAAITPKTK------ALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYE 240

Query: 302 DNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLS-GECGQRGGYMELIGFR 360
            +++   +F            R  TL   +   +L   S G S    G R G+  ++   
Sbjct: 241 -HLYFTPEF-----------TRVATLSPEIGQITLTIGSAGKSFAATGWRIGW--IVSLN 286

Query: 361 EELRKVFVKLASISLC---PVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERS 417
            EL + +  +A   +C   P    +A  + +   P   D  Y +  +E      E   + 
Sbjct: 287 PELLE-YASMAHTRICFASPSPLQEACANAL---PIALDNGYFKKMRE------EYIHKF 336

Query: 418 QLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQKAIEAAQKLGIPADELYCSELLDET 474
            +  + F  L G+    P+G  ++   F K+ +P+      +      D      L++E 
Sbjct: 337 NIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISYWLINEL 395

Query: 475 GICTVPGTGF 484
           G+  +P T F
Sbjct: 396 GVVAIPPTEF 405

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 78/188 (41%), Gaps = 22/188 (11%)

Query: 160 YRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTAT 219
           YR   + +    +  P   DN+ L  G+  ++  ++   C   +  +L+  P Y +Y+  
Sbjct: 69  YRNKTSSYANDPEVKPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVC 128

Query: 220 ITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKD 279
              N+   +   L  +DG      E    IL   K +   K + V +PGNPTG+ +    
Sbjct: 129 ANINDIEVVQCPLTVSDGSFQMDTEAVLTIL---KNDSLIKLMFVTSPGNPTGAKIKTSL 185

Query: 280 MEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSI 339
           +E +L      G+VV+ DE Y D   G                  P + K   L +L ++
Sbjct: 186 IEKVLQ-NWDNGLVVV-DEAYVDFCGGSTA---------------PLVTKYPNLVTLQTL 228

Query: 340 SK--GLSG 345
           SK  GL+G
Sbjct: 229 SKSFGLAG 236

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 13/146 (8%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V  TAG ++A    L  FC   +  +L+    +    A+      +  P  + +ADG  
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRGDV-ILVEAHSFSSSLASAEAQGVITFPVPI-DADG-- 189

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++ +V+ +       PK L  I  G NPTG+ ++    EAI  +A KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 299 VYQDNVFGDAKFHSMRKVLKNLQLRE 324
            Y         F  M   +K+L+ RE
Sbjct: 250 PYY--------FLQMNPYIKDLKERE 267

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 70/170 (41%), Gaps = 15/170 (8%)

Query: 148 VGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAV-SCLLSTFCKGPETGV 206
           V  YS ++G      ++ +      G     +N+ +T GA+  + SCL+     G E  V
Sbjct: 89  VNQYSPTRGRASLLNSLIKLYSPFYGKELKQENITITTGANEGILSCLMGLLNAGDEVIV 148

Query: 207 LIPIPQYPLYTATITQNNAVALPY--------YLNEADGWSTNPDEMERVILDSKKRNIA 258
             P     +    +     V +P          + E   W+ + ++    I    K    
Sbjct: 149 FEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTIDFEQFRNAITPKTK---- 204

Query: 259 PKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDA 308
              ++V +P NP G V + +++  +  +  +  +++I+DEVY+   F D+
Sbjct: 205 --AVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYEFLYFNDS 252

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 82/195 (42%), Gaps = 27/195 (13%)

Query: 110 SLMQNPQLLEMPAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIE 169
           ++M+NP+ L          F+ D+ +   R LQ        Y  S+G K     + +   
Sbjct: 82  TIMKNPEDL---------LFRDDIPLA--RALQ--------YGNSRGQKELVSFLKEHTS 122

Query: 170 RRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALP 229
               IP N  ++  T G++ A    L  FC   +T +L    +   Y++++   +A  L 
Sbjct: 123 IFHSIPYNDWDIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLN 178

Query: 230 YYLNEADGWSTNPDEMERVILDSKKRNIA---PKCLVVINPG-NPTGSVLSVKDMEAILT 285
                 D     P+++E ++ +   R      PK L  I  G NPTG  LS      I  
Sbjct: 179 CIPVPMDNQGIIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYR 238

Query: 286 LAAKYGIVVIADEVY 300
           LA KY I+++ D+ Y
Sbjct: 239 LAQKYDILIVEDDPY 253

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 73/164 (44%), Gaps = 19/164 (11%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           Y A +G K  R  +A       G+  + DNV +T GA  A   L  T   G    V+   
Sbjct: 56  YGAIKGSKDLRTLIAGLY----GVQFSADNVLVTNGAIGANFLLYYTLV-GKGDHVICVH 110

Query: 211 PQYP-LYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGN 269
           P Y  LY+        V L   L+E D +  N D +++ I    K N   K +++ NP N
Sbjct: 111 PTYSQLYSVPKMFGAEVTL-LELSEKDSFLPNLDTLKKAI----KSN--TKLIIINNPNN 163

Query: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSM 313
           P G V+S + + +I  L  +  + +  DEVY+        FHS+
Sbjct: 164 PLGCVISDELLTSICELCKEKNVYLHCDEVYR------PIFHSL 201

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 72/156 (46%), Gaps = 17/156 (10%)

Query: 178 PDNVYLTAGASSAV-SCLLSTFCKGPETGVLIPIPQYPLYTAT----ITQNNAVALPYYL 232
           P+N+ +T GA+  + +CL+S    G E  VL P     +Y       I ++  +  P  L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 233 ----NEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAA 288
                +   W+ + D+    I +  K       +++ +P NPTG V + +++  +  +  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISEKTK------AVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 289 KYGIVVIADEVYQDNVFGD--AKFHSMRKVLKNLQL 322
           +  + +I+DEVY++  F     K  S+   + N+ L
Sbjct: 213 EKNVYIISDEVYENLYFTPECVKLASLSPEISNITL 248

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 64/154 (41%), Gaps = 17/154 (11%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYP--LYTATITQNNAVALPYYLNEADG 237
           +V  TAG ++A    L  FC   +T +L     +   LY A     N   +P      D 
Sbjct: 135 DVLATAGNTNAWESTLRVFCNRGDT-ILAEAYSFSSSLYAAEAQGVNVFPVPL-----DE 188

Query: 238 WSTNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIA 296
           +   P+++E ++ +       PK L  I  G NPTGS LS      I  +A K+  ++I 
Sbjct: 189 FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIE 248

Query: 297 DEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKN 330
           DE Y         F  M   +K+   RE   Y +
Sbjct: 249 DEPYY--------FLQMEPYVKDASAREKKTYSS 274

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 67/147 (45%), Gaps = 8/147 (5%)

Query: 156 GVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
            +  YR   + F   +D  P   +N+ L  G+  ++  ++   C   +  ++   P Y +
Sbjct: 65  AMANYRNRTSSF---KDITPLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGM 121

Query: 216 YTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVL 275
           Y+   + N+   +   L  +D       E    +LD+ K++   K + + +PGNPTG+ +
Sbjct: 122 YSVCASVNDVEIVKCPLVTSDNSFQVDTE---AVLDTLKKDPLIKLVFITSPGNPTGAKI 178

Query: 276 SVKDMEAILTLAAKYGIVVIADEVYQD 302
               +E IL      GI+V+ DE Y D
Sbjct: 179 ETSRIEKILQ-NWDQGILVV-DEAYID 203

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 135/323 (41%), Gaps = 33/323 (10%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V  T G + A   +L  FC   +T   I   Q+  ++++I+   A  +  +    D   
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQFA-FSSSISAAEAQGVNVFPIPLDEHG 189

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P ++E ++ +  +    PK L  +  G NPTGS LS    E I  +A K+  ++I DE
Sbjct: 190 IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDE 249

Query: 299 VY---------QDNVFGDAK-FHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECG 348
            Y         +D      K +   ++ ++NL+    ++    ++  L S+SK L+   G
Sbjct: 250 PYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA--PG 307

Query: 349 QRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRS 408
            R G+  ++G ++ L ++          P    Q+++   +    Q     E Y      
Sbjct: 308 TRFGW--IVGAKDILARILSLQEMTIQAPAGFTQSIIAGTMNRWGQ-----EGYLDWLIG 360

Query: 409 IYHELEERSQL----LWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADE 464
           + HE  ++       L+K    ++ I+ N P   ++    +    K  E A K G   ++
Sbjct: 361 LRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNID-ASKHPEFATKYGSDPEK 419

Query: 465 LYCSELLDE---TGICTVPGTGF 484
           +  + + D    +G+  VPG  F
Sbjct: 420 VEKA-IFDRSIASGVLVVPGNWF 441

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 13/146 (8%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V+ TAG ++A    L  FC   +  +L     +    A+      +  P  + +ADG  
Sbjct: 134 DVFATAGNTNAWESTLRLFCNRGDV-ILAEAHSFSSSLASAEAQGVITFPVPI-DADG-- 189

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++ +++ +       PK L  I  G NPTG+ ++    EAI  +A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 299 VYQDNVFGDAKFHSMRKVLKNLQLRE 324
            Y         F  M   +K+L+ RE
Sbjct: 250 PYY--------FLQMNPYIKDLKERE 267

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 8/154 (5%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           Y  S+G +     + + I +   IP +  +V +TAG++ A    L  FC  P   VL+  
Sbjct: 100 YGNSRGQRELVSFLKEHIVKFHQIPYSDWDVLITAGSTQAWDASLRLFCN-PGDSVLL-- 156

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVIL---DSKKRNIAPKCLVVINP 267
            +   Y++++    A  +     E DG    P+++E ++    D       PK L VI  
Sbjct: 157 -ESWTYSSSVEAAEAQGMYCVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVIPT 215

Query: 268 G-NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           G NP G  L+ +    I  +  KY +V+I D+ Y
Sbjct: 216 GQNPMGVTLADERKPLIYNIIQKYDMVLIEDDPY 249

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 76/160 (47%), Gaps = 11/160 (6%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVY---LTAGASSAVSCLLSTFCKGPETGVL 207
           YS +QG+K     +  FI + +  P   + +Y   L  G+S ++  +  T C    T ++
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSDSMFKVFETLCDESTTVLM 196

Query: 208 IPIPQYPLYTATITQNNAVALPYYLN-EADGWSTNPDEMERVILD----SKKRNIA-PKC 261
                 P+  + +    A  +P  LN   +    + + +E ++ +    S  ++++ PK 
Sbjct: 197 EEFTFVPV-ISNVMATGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKPKI 255

Query: 262 LVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           L  I+ G NP G  LS++    I T+A ++ ++++ D+ Y
Sbjct: 256 LYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 10/150 (6%)

Query: 155 QGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYP 214
           + +  YR   + F    D +P   +N  L  G+  ++  ++   C   +  +L+  P Y 
Sbjct: 64  KAMASYRNKTSVF-RSYDLVPLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYS 122

Query: 215 LYT--ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTG 272
           +Y+  A I   + V  P  + E + +  +  E    IL+    +   K + + +PGNPTG
Sbjct: 123 MYSVCANINDVDVVTCPL-ITEDNSFQIDATE----ILNILANDPLIKLVFITSPGNPTG 177

Query: 273 SVLSVKDMEAILTLAAKYGIVVIADEVYQD 302
           + + +  +E +L      G+V++ DE Y D
Sbjct: 178 AKIEIDRIEYLLK-NWDQGLVIV-DEAYID 205

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 64/130 (49%), Gaps = 9/130 (6%)

Query: 175 PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT--ATITQNNAVALPYYL 232
           P   +N+ L  G+  ++  ++   C   +  +L+  P Y +Y+  A I     V  P   
Sbjct: 83  PLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLIT 142

Query: 233 NEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGI 292
           ++ + +  N DE    ++ + + + + K + + +PGNPTG+ +    +E IL    + G+
Sbjct: 143 SD-NSFQANTDE----VIKTAQNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR-GM 196

Query: 293 VVIADEVYQD 302
           VV+ DE Y D
Sbjct: 197 VVV-DEAYID 205

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 5/119 (4%)

Query: 183 LTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNP 242
           LT G ++     L  FC   +  +L     +    A+      +  P  ++ +DG    P
Sbjct: 135 LTTGNTNGWESTLRIFCNKGDV-ILAEAHSFSSSLASAEAQGVITFPVPID-SDG--IIP 190

Query: 243 DEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           +++E ++ +    +  PK L  I  G NPTGS LS +  EAI  +A K+  ++I DE Y
Sbjct: 191 EKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 73/353 (20%), Positives = 131/353 (37%), Gaps = 47/353 (13%)

Query: 148 VGAYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAV-SCLLSTFCKGPETGV 206
           V  YS ++G      ++ +F            N  +  GA+ A+ S L+     G E  V
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIFSILIGLLNPGDEVIV 135

Query: 207 LIPIPQYPLYTATITQNNAVALPYY--------LNEADGWSTNPDEMERVILDSKKRNIA 258
             P     +    ++    V +P          + + + W  + D ++  +      N  
Sbjct: 136 FEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQIDWDSLQAAM------NSK 189

Query: 259 PKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLK 318
            K +++  P NP G V +  ++  +  +  K  +V+I+DEVY+   F D+          
Sbjct: 190 TKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKDS---------- 239

Query: 319 NLQLREPTLYKNVQLASLHSISKGLS-GECGQRGGYMELIGFREELRKVFVKLASISLC- 376
               R  TL   +   +L   S G S    G R G+   +   +EL     K A   +C 
Sbjct: 240 --FTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWA--LSLNQELLSYAAK-AHTRICF 294

Query: 377 --PVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNM 434
             P    +A+ +         D    +Y +ETR  Y     R   ++    +  G+    
Sbjct: 295 ASPSPLQEAVANAF------NDAEKVEYFKETRLQYI----RKYEIFTNVLNELGLPYTE 344

Query: 435 PQGALYL---FPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGF 484
           P+G  ++   F K+ +P       + L    D      L++E G+  +P T F
Sbjct: 345 PEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYWLMNELGVVAIPPTEF 397

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 65/154 (42%), Gaps = 8/154 (5%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           Y  S+G K     + +       IP    ++  T G++      L  FC   +T +L   
Sbjct: 103 YGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLL--- 159

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVIL---DSKKRNIAPKCLVVINP 267
            +   Y++++   +A  L       DG    P+++E +++   D       PK L  I  
Sbjct: 160 -EEYTYSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPT 218

Query: 268 G-NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           G NPTG  LS      I  LA KY +++I DE Y
Sbjct: 219 GQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPY 252

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 66/146 (45%), Gaps = 13/146 (8%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V  TAG ++A    L  FC   +  +L     +    A       +A P  + +ADG  
Sbjct: 134 DVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSSLAAAEAQGIIAFPVPI-DADG-- 189

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++ +++ +       PK L  I  G NPTG+ ++    EAI  +A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDE 249

Query: 299 VYQDNVFGDAKFHSMRKVLKNLQLRE 324
            Y         F  M   +K+L+ RE
Sbjct: 250 PYY--------FLQMNAYIKDLKERE 267

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 22/188 (11%)

Query: 160 YRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTAT 219
           YR   + +       P   DN+ L  G+  ++  ++   C   +  +L+  P Y +Y+  
Sbjct: 69  YRNKTSSYSNDPTVKPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVC 128

Query: 220 ITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKD 279
              N+   +   L  +D       E    IL   K +   K + V +PGNPTG+ +    
Sbjct: 129 ANINDVEVVQCPLTVSDNSFQMDTEAALTIL---KNDPLIKLIFVTSPGNPTGAKIKTCL 185

Query: 280 MEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSI 339
           +E IL    + G+VV+ DE Y D   G                  P + K   L +L ++
Sbjct: 186 IEKILQ-NWENGLVVV-DEAYIDFCGGSTA---------------PLVTKYPNLVTLQTL 228

Query: 340 SK--GLSG 345
           SK  GL+G
Sbjct: 229 SKSFGLAG 236

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 78/192 (40%), Gaps = 22/192 (11%)

Query: 156 GVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
            +  YR   + ++      P + DN+ L  G+  ++  ++   C   +  +L+  P Y +
Sbjct: 65  AMTAYRNETSSYLNDPTVKPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSM 124

Query: 216 YTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVL 275
           Y+     N+   +   L  +D       E    IL++       K +   +PGNPTG+ +
Sbjct: 125 YSVCANINDVEVVQCPLTVSDNSFQMNTEAVLTILNNDP---LIKIMFATSPGNPTGAKI 181

Query: 276 SVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLAS 335
               +E +L      GIVV+ DE Y D   G                  P + K   L +
Sbjct: 182 KTCLIEEVLQ-KWDNGIVVV-DEAYVDFCGGSTA---------------PLVTKYPNLVT 224

Query: 336 LHSISK--GLSG 345
           L ++SK  GL+G
Sbjct: 225 LQTLSKSFGLAG 236

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 70/146 (47%), Gaps = 10/146 (6%)

Query: 159 GYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT- 217
            YR   + F + ++  P   +N+ L  G+  ++  L+   C   +  ++I  P Y +Y+ 
Sbjct: 69  NYRNKHSSF-KDQNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSI 127

Query: 218 -ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLS 276
            A I     V +P  + E + +  +  +    +L++  ++   K + + +PGNPT +++ 
Sbjct: 128 CADINDVGCVKVPL-VAEDNSFQMDTSK----VLETLAQDPTIKLIFITSPGNPTAALID 182

Query: 277 VKDMEAILTLAAKYGIVVIADEVYQD 302
             ++E +L      G +V+ DE Y D
Sbjct: 183 TAEIEKVLN--NWTGGLVVVDEAYID 206

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (43%), Gaps = 36/185 (19%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPAN------PDNVYLTAGASSAV-SCLLSTFCKGPE 203
           Y +  G    R  +A+F  R   +P +      P+++ LT+GAS  + + LL T    P 
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTL--PH 105

Query: 204 TG----VLIPIPQYPL---------YTATIT----QNNAVALPYYL-------NEADGWS 239
           TG      I  P Y L         +T  IT    + + + L +         N ++G S
Sbjct: 106 TGYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGES 165

Query: 240 -TNPDEMERVI--LDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIA 296
               +E  R+I   D KK+       +V    NPTG++ S      +L LA KY I++I+
Sbjct: 166 GQKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIIS 225

Query: 297 DEVYQ 301
           D+VY 
Sbjct: 226 DDVYD 230

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 96/222 (43%), Gaps = 29/222 (13%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY----PLYTATITQNNAVALPYYLNEA 235
           NV  T G + +    L  FC   +T   I   QY     +Y A     N   +P    +A
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPL---DA 188

Query: 236 DGWSTNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVV 294
           DG    P+ +E ++ +       PK L  I  G NPTGS LS      I  +A K+ +++
Sbjct: 189 DG--LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLI 246

Query: 295 IADE--------VYQDNVF--GDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLS 344
           I DE         YQ +V    +  F S    + +L     +L    ++  L S SK L 
Sbjct: 247 IEDEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVLG 306

Query: 345 GECGQRGGYMELIGFREELRKVFVKLASISL-CPVVTGQALV 385
              G R G+  ++G ++ L+K + +L  +++  P    QA+V
Sbjct: 307 --PGTRLGW--IVGSKKILQK-YTQLHEMTIQNPSGFSQAIV 343

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 68/130 (52%), Gaps = 9/130 (6%)

Query: 175 PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNA--VALPYYL 232
           P   +N+ L  G+   +  L+   C   +  +LI  P Y +Y+     N+   V +P  +
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 233 NEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGI 292
            E + +  + ++    ++++ + + + K + + +PGNPTG+++  +++E +L+   + G 
Sbjct: 144 -EDNSFQMDTEK----VIETLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGF 197

Query: 293 VVIADEVYQD 302
           VV+ DE Y D
Sbjct: 198 VVV-DEAYID 206

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 86/219 (39%), Gaps = 29/219 (13%)

Query: 234 EADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIV 293
           EA+ W  + + +     D  K       +++ NP NP G V +  ++  + TL    G  
Sbjct: 163 EANDWILDRETLRAAFTDKTK------LMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 294 VIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGY 353
           +IADEVY+   F       +        L E    K + + S   I +      G R G+
Sbjct: 217 IIADEVYEFLQFTPNPLSRIS------NLSEAIAQKTITIGSAGKIFRV----TGWRVGW 266

Query: 354 MELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHEL 413
           M +   RE + KV      +  C     Q    L  G     +  Y        S+ +E 
Sbjct: 267 M-ISKNRELVEKVTAVHVRMGFCSPSISQVASGL--GIQRALECGY------FLSMPNEF 317

Query: 414 EERSQLLWKTFCSLEGIECNMPQGALYL---FPKLHLPQ 449
           + +  +++K    L G+    PQGA ++   F K+ +P+
Sbjct: 318 DRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPE 355

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 92/220 (41%), Gaps = 24/220 (10%)

Query: 181 VYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWST 240
           V  + G ++A    L  FC   + G ++   +Y  +++ +    A  +       D +  
Sbjct: 132 VIASVGNTNAWESTLRIFC---DRGDVVLFEEYS-FSSCLAACEAQGVTTIPIPIDAFGI 187

Query: 241 NPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299
            P+++E ++ +       PK L  I  G NPTG+ L     EAI  +A K+  +++ DE 
Sbjct: 188 VPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEP 247

Query: 300 YQDNVFGD-------------AKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGE 346
           Y     GD             A   S  +  K+L     +L    ++  L S SK L   
Sbjct: 248 YYFLQVGDYIEDLKKREQVYSAPKQSHEEFKKSLVKSFLSLDTEGRVIRLDSFSKVLG-- 305

Query: 347 CGQRGGYMELIGFREELRKVFVKLASISL-CPVVTGQALV 385
            G R G+   I   ++L K +V L  +++ CP    Q LV
Sbjct: 306 PGTRLGW---ITGSKQLMKAYVSLHEMTIQCPSGFSQVLV 342

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V  T G ++A    L  FC   +  +L     +    A       +  P  ++E     
Sbjct: 132 DVVATTGNTNAWESTLRVFCDKGDV-ILAEAHSFSSCLAAAQAQGIITFPIPIDEH---G 187

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++E+++ +  +    PK L  I  G NPTGS LS    E I  +A K+  ++I DE
Sbjct: 188 IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDE 247

Query: 299 VY 300
            Y
Sbjct: 248 PY 249

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 78/184 (42%), Gaps = 34/184 (18%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPAN------PDNVYLTAGASSAVSCLLSTFCKGPET 204
           Y +  G    R  +A+F  +   +P +      PD++ LT+GAS  +  +L      P T
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNILVQ-TTLPHT 107

Query: 205 G----VLIPIPQYPL---------YTATIT----QNNAVALPY-------YLNEADGWST 240
           G      I  P Y L         +T  IT    + + + L +       + N A+G   
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 241 NPDEMERVILDSK---KRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIAD 297
              E    I++++   K+       +V    NPTG++ S      +L LA KY I++I+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 298 EVYQ 301
           +VY 
Sbjct: 228 DVYD 231

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 79/188 (42%), Gaps = 14/188 (7%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           Y  SQG     + + +  E    +  +   + +TAG +SA    L  FC   +T     +
Sbjct: 103 YGHSQGQPELLKFIREHTEIIHTMQYDDWELLVTAGNTSAWESTLRIFCNRGDT----IL 158

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPG-N 269
            +   ++++++   A  +  +    D     P+++  ++ +       PK L  I  G N
Sbjct: 159 AEAHSFSSSLSAAQAQGIITFPVPIDDKGIIPEKLAAIMDNWNPETPKPKLLYTIPTGQN 218

Query: 270 PTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLR-EPTLY 328
           PTGS L  +    +  +A K+  +++ DE Y         F  M   +K+  LR E  L 
Sbjct: 219 PTGSSLDAERKSQVYKIAQKHDFLIVEDEPYY--------FLQMEDYVKDPSLRKEVKLS 270

Query: 329 KNVQLASL 336
            +  LASL
Sbjct: 271 HDEFLASL 278

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 62/146 (42%), Gaps = 13/146 (8%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V  TAG ++     L  FC   +  +L     +    A+      +  P  +   D   
Sbjct: 134 DVLATAGNTNGWESTLRVFCNRGDV-ILAEAHSFSSSLASAEAQGVITFPIPI---DAGG 189

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++ +++ +       PK L  I  G NPTG+ ++    EAI  +A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 299 VYQDNVFGDAKFHSMRKVLKNLQLRE 324
            Y         F  M   +K+L+ RE
Sbjct: 250 PYY--------FLQMNPYIKDLKERE 267

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 10/139 (7%)

Query: 174 IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQN-NAVALPYYL 232
           I  N  ++  TAG++ A    L  FC   ET ++          A + Q  N VA+    
Sbjct: 122 ISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKM-- 179

Query: 233 NEADGWSTNP-DEMERVILDSKKRNIAPKCLVVI-NPGNPTGSVLSVKDMEAILTLAAKY 290
            + DG   +   EM R   D   +   PK L  I N  NPTG  L  +    ++ LA++Y
Sbjct: 180 -DKDGIKVDKLSEMLRD-WDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQY 237

Query: 291 GIVVIADEVY---QDNVFG 306
             ++I D+ Y   Q N FG
Sbjct: 238 DFIIIEDDPYYFLQMNEFG 256

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 77/188 (40%), Gaps = 17/188 (9%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           ++  TAG ++A    L  FC     G +I + +   +++ +    A  +  +    D   
Sbjct: 133 DIIATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFPIPIDDNG 188

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++E+++ +       PK L  I  G NPTG+ L    ME I  +A K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 299 VYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSG---ECGQRGGYME 355
            Y         F  M K +K++  R   L   V+  +     K L      C   G  + 
Sbjct: 249 PYY--------FLQMDKYVKDVNERT-ALRSQVKKQTHEEFLKALDKTFLSCDNDGRVIR 299

Query: 356 LIGFREEL 363
           L  F + L
Sbjct: 300 LDSFSKVL 307

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 69/182 (37%), Gaps = 31/182 (17%)

Query: 150 AYSASQGVKGYRRTVAQF-------IERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGP 202
            Y +++G    R T+ +F            G  + P+ + LT+GAS  V  +L   C  P
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNILLQ-CTLP 110

Query: 203 ETG----VLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVI--LDSKKRN 256
                    I  P Y L                +NE    S + D +E  +  LDS K +
Sbjct: 111 HNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKAD 170

Query: 257 IAPKCLV-----------------VINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299
           +  +C+                  V    NP+G   S+     +L LA KY I++I D+V
Sbjct: 171 VGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDV 230

Query: 300 YQ 301
           Y 
Sbjct: 231 YD 232

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 82/195 (42%), Gaps = 29/195 (14%)

Query: 156 GVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215
            +  YR   + + +  +  P   +N+ L  G+  ++  ++   C   +  +L+  P Y +
Sbjct: 67  AMASYRNKTSTY-KAENLTPLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSM 125

Query: 216 YT--ATITQNNAVALPYYLNEADGWSTNPDEME-RVILDSKKRNIAPKCLVVINPGNPTG 272
           Y+  A I     V  P        +  N  +M+   +L   + +   K L + +PGNPTG
Sbjct: 126 YSVCAEINDIEIVECPLL------YKNNSFQMDTESVLTVLQNDPLIKLLFITSPGNPTG 179

Query: 273 SVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQ 332
           + +  + +E +L      G+VV+ DE Y D   G                  P + K   
Sbjct: 180 ARIETERIETVLQNWTD-GLVVV-DEAYIDFCGGSTA---------------PLVTKYPN 222

Query: 333 LASLHSISK--GLSG 345
           L +L ++SK  GL+G
Sbjct: 223 LVTLQTLSKSFGLAG 237

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 72/174 (41%), Gaps = 24/174 (13%)

Query: 175 PANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNE 234
           P   DN+ L  G+  ++  ++   C   +  +L   P Y +Y+     N+   L   L  
Sbjct: 83  PLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIY 142

Query: 235 ADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKY-GIV 293
            D  S  PD  + + + S    I  K + + +PGNPTG+ +   D   I+ +   + G  
Sbjct: 143 EDN-SFQPDSQKVISILSSDPLI--KLVFLTSPGNPTGAKI---DSNIIIKILESWDGGF 196

Query: 294 VIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISK--GLSG 345
           V+ DE Y D   G                  P + K   L +L ++SK  GL+G
Sbjct: 197 VVVDEAYIDFCGGSTA---------------PLVTKYPNLITLQTLSKSFGLAG 235

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 55/126 (43%), Gaps = 13/126 (10%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY----PLYTATITQNNAVALPYYLNEA 235
           +V  T G + +    L  FC   +T   I   +Y     +Y A     N   +P    +A
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPL---DA 188

Query: 236 DGWSTNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVV 294
           DG    P+ +E ++ +       PK L  I  G NPTGS LS    + I  +A K+  ++
Sbjct: 189 DG--LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFII 246

Query: 295 IADEVY 300
           I DE Y
Sbjct: 247 IEDEPY 252

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V  T G ++A    L  FC     G +I + +   +++++    A  +  +    D   
Sbjct: 132 DVVATTGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++E ++ +  +    PK L  I  G NPTGS L+ +  + I  +A K+  ++I DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 299 VY 300
            Y
Sbjct: 248 PY 249

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 28/172 (16%)

Query: 179 DNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT--ATITQNNAVALPYYLNEAD 236
           DN+ L  G+  ++  ++   C   +  +L+  P Y +Y+  A I     V  P  +    
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVV---- 143

Query: 237 GWSTNPDEME-RVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVI 295
             S N  +M+   +L   + +   K + V +PGNPTG+ +    +E +L    + G+VV+
Sbjct: 144 --SDNSFQMDVEAVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV 200

Query: 296 ADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISK--GLSG 345
            DE Y D   G                  P + K   L +L ++SK  GL+G
Sbjct: 201 -DEAYIDFCGGSTA---------------PLVTKYPNLVTLQTLSKSFGLAG 236

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 99/242 (40%), Gaps = 36/242 (14%)

Query: 150 AYSASQGVKGYRRTVAQFIER--RDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETG-- 205
           +Y   +G    R  ++QF+ +  +  +P  P+ + LT GAS  +  +L   C  P TG  
Sbjct: 50  SYGPKEGSLWVRCVISQFVNKCFKPLMPTKPEYINLTGGASYGIMNILEQ-CTLPHTGYT 108

Query: 206 --VLIPIPQYPLYTATI--------------TQN--NAVALPYYLNEADGWST-NPDEME 246
               +  P Y L   T               TQN  +   L   L E +  +  NP   E
Sbjct: 109 RQAFLISPTYFLINETFIDAGFGGKLTAVNETQNGLDVEFLEAKLAEFEYDALLNPQHGE 168

Query: 247 RVILD-------SKKRNIAPKCLVVI-NPGNPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
              L+       S+ + +    + ++    NP+G   SV     ++ LA KY I++I+D+
Sbjct: 169 ERGLNLINMSGRSRTKKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDD 228

Query: 299 VYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGEC---GQRGGYME 355
           VY   V+ D    ++ K L  L   +   Y+  +    ++IS     +    G R GY E
Sbjct: 229 VYDLLVY-DQPCDALPKCLPRLTHLDRASYEYGENGYGNTISNATFSKVIAPGLRCGYQE 287

Query: 356 LI 357
            +
Sbjct: 288 SV 289

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 67/154 (43%), Gaps = 8/154 (5%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           Y  SQG       V +   R   +     +V  T G +SA    L  FC   +T   I  
Sbjct: 103 YGFSQGQPELMDFVREHTRRLHRMQYADWDVLATVGNTSAWESTLRVFCNRGDT---ILA 159

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIA---PKCLVVINP 267
            +Y  +++++    A  +  Y    D     P+ +  ++ + ++ +     PK L  +  
Sbjct: 160 EEY-TFSSSLVAAEAQGVRAYPVPLDENGMVPERLGELLDNWERWHDGVPRPKLLYTVPT 218

Query: 268 G-NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           G NPTG+ LS    +A+  LA ++ ++++ DE Y
Sbjct: 219 GQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPY 252

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           NV  T G ++A    L  FC   +  +L     +    ++      +  P  ++ ADG  
Sbjct: 131 NVVATTGNTNAWESTLRVFCNRGDV-ILAEAHSFSSSLSSAEAQGVIVFPIPID-ADG-- 186

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++E+++ +       PK L  I  G NPTG+ L+    + I  +A K+  ++I DE
Sbjct: 187 IIPEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDE 246

Query: 299 VY 300
            Y
Sbjct: 247 PY 248

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           ++ LT G ++     L  FC     G +I + +   +++++    A  +  +    D   
Sbjct: 132 DIILTTGNTNGWESTLRVFCN---KGDVI-LAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P+++E ++ +       PK L  I  G NPTG+ L+ +    I  +A K+  ++I DE
Sbjct: 188 IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDE 247

Query: 299 VY 300
            Y
Sbjct: 248 PY 249

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 70/174 (40%), Gaps = 8/174 (4%)

Query: 185 AGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDE 244
            GA +  S LLS F       V IP P +P +      N    + YY    DG       
Sbjct: 122 TGALAVASKLLSLFM---SRSVWIPNPSWPNHANVFQNNGFKEINYYSYYKDGSLDIEGW 178

Query: 245 MERVILDSKKRNIAPKCLVV-INPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDN 303
           ++ +   ++K    P+C+V+     NPTG   S +  + IL    +  ++ I D  YQ  
Sbjct: 179 IQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMAYQGL 238

Query: 304 VFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELI 357
             GD    +    L N+ L E        L    S +K + G  G+R G + ++
Sbjct: 239 DSGDLYKDAY---LLNMSLDENRYQWKNGLFLCQSFAKNM-GLYGERVGSLSVV 288

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 57/131 (43%), Gaps = 18/131 (13%)

Query: 185 AGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVA----LPYYLN---EADG 237
            GA +  S LLS F       V IP P +P + A + QNN         YY +   + D 
Sbjct: 122 TGALAVASKLLSLFM---SKAVWIPNPSWPNH-ANVFQNNGFKRINYYTYYRDGGLDVDS 177

Query: 238 WSTNPDEMERVILDSKKRNIAPKCLVV-INPGNPTGSVLSVKDMEAILTLAAKYGIVVIA 296
           W     ++E+ + D      +P+C+V+     NPTG   S++    IL    +  ++ I 
Sbjct: 178 WLQ---DLEQAVRDGDG---SPQCIVLHACCHNPTGVDPSLEQWRTILDKINELNLIPII 231

Query: 297 DEVYQDNVFGD 307
           D  YQ    GD
Sbjct: 232 DMAYQGLDTGD 242

>SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 423

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 80/197 (40%), Gaps = 22/197 (11%)

Query: 134 VVRARRMLQDAG--GSVGAYSASQGVKGYRRTVAQFIERRDGIPA-----NPDNVYLT-- 184
           V RA+++L++     +  +Y    G   Y+  V  F+  RD  P      + D +     
Sbjct: 59  VARAQQILENHKQLNTDLSYLPITGSAEYQSNVLNFL-FRDSCPQGEPYLSHDKISFVQT 117

Query: 185 ---AGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTN 241
               GA +  S LL  F       V IP P +  +T     N    + YY    +G + +
Sbjct: 118 LSGTGALAVASKLLYLFV---SKTVWIPAPSWANHTNVFQSNGFKDIRYYTYYNNG-TLD 173

Query: 242 PDEMERVILDSKKRNIAPKCLVV-INPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
            D   + +  + ++  AP+C+V+     NPTG   +++    IL       ++ I D  Y
Sbjct: 174 VDSWLQDLRSATRKYRAPQCIVLHACCHNPTGVDPTIEQWSKILDAIHDLNMIPILDMAY 233

Query: 301 Q----DNVFGDAKFHSM 313
           Q     N++ DA    M
Sbjct: 234 QGLESGNLYRDAYLLRM 250

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 63/148 (42%), Gaps = 13/148 (8%)

Query: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239
           +V  TAG ++A    L  FC     G +I + +   +++ +    A  +  +    D   
Sbjct: 133 DVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFPVPIDDKG 188

Query: 240 TNPDEMERVILDSKKRNIAPKCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADE 298
             P ++E ++ +       PK L  I  G NPTG+ L+ +    I  +A K+  ++I D 
Sbjct: 189 IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 299 VYQDNVFGDAKFHSMRKVLKNLQLREPT 326
            Y         F  M K  ++LQ R  T
Sbjct: 249 PYY--------FLQMDKYERDLQKRAVT 268

>CAGL0K08580g Chr11 complement(865470..866831) [1362 bp, 453 aa]
           {ON} similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106w Aspartate aminotransferase
          Length = 453

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 79/184 (42%), Gaps = 20/184 (10%)

Query: 134 VVRARRMLQ-DAGGSVG-AYSASQGVKGYRRTVAQFIER----RDGIPANPDNVYLT--- 184
           V +A++++  D G +   +Y    G + +++    F+ R    +DG PA   N  ++   
Sbjct: 82  VAQAQKIIDMDVGMNTDLSYLPISGCEDFKKHTINFLYRDSCPQDG-PALIKNDRISFIQ 140

Query: 185 ----AGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWST 240
                GA +  S LLS+F       + IP P +P +T   TQN      +Y     G  T
Sbjct: 141 TLSGTGALAVASRLLSSFI---SRKIWIPKPSWPNHTNIFTQNGFTNPRFYSYYDRGDLT 197

Query: 241 NPDEMERVILDSKK--RNIAPKCLVV-INPGNPTGSVLSVKDMEAILTLAAKYGIVVIAD 297
               ++ +  +  K      P C+V+     NPTG   + K  E I+    + G++ I D
Sbjct: 198 IGRWLQELRHEVGKDSNTKTPHCIVLHACCHNPTGLDPTKKQWEDIMDTIYELGMIPIID 257

Query: 298 EVYQ 301
             YQ
Sbjct: 258 MAYQ 261

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%)

Query: 241 NPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           NPD+ E++I D  K       + + + GNP     +V D E I+ +A K+G+ V+     
Sbjct: 136 NPDDFEKLIDDKTK------AVYLESIGNPK---YNVPDFEKIVEIAHKHGVPVVV---- 182

Query: 301 QDNVFGDAKF 310
            DN FG   F
Sbjct: 183 -DNTFGAGGF 191

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 69/166 (41%), Gaps = 19/166 (11%)

Query: 150 AYSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIP 209
           +Y A +G    R ++A       G     D++ LT GA  A      T   G    V+  
Sbjct: 54  SYGAIKGSDELRTSIASLY----GPDFTMDDILLTNGAIGANFLAFYTLV-GAGDHVICV 108

Query: 210 IPQYP-LYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPG 268
            P Y  LY+        V L   L + D +  N   ++ +I    K N   K +++ NP 
Sbjct: 109 EPTYSQLYSVPEMFGAEVDL-LTLKKEDDFLPNLQTLKSMI----KNN--TKLIIINNPN 161

Query: 269 NPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMR 314
           NP GSV+    ++ I  L  +  I + +DEVY+        FHS+ 
Sbjct: 162 NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR------PIFHSLE 201

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 66/162 (40%), Gaps = 17/162 (10%)

Query: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210
           YS +QG+      +   +   +  P    ++ L  G+S ++  L  T      T VL+  
Sbjct: 112 YSQTQGLAPILDFLKLIVANCNNPPYQNWDLLLANGSSDSMFKLFDTLT-DETTTVLVEE 170

Query: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDE-----------MERVILDSKKRNIAP 259
             +    + IT   A  +P  LN    +++NP             +E       K    P
Sbjct: 171 FTFSPVLSNITATGASCVPLQLN----FTSNPSNQGINVTYLQHLLENWQSGPYKHLNRP 226

Query: 260 KCLVVINPG-NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
             L  I+ G NPTG  +S+++   I  LA KY  +++ D+ Y
Sbjct: 227 SILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 75/189 (39%), Gaps = 39/189 (20%)

Query: 150 AYSASQGVKGYRRTVAQFIERR-----DGIP--ANPDNVYLTAGASSAV-SCLLSTFCKG 201
            Y + +G    R T+ QF   +     +G P  + P+ + L +GAS  V S LL T    
Sbjct: 52  TYGSDEGAFWVRDTICQFNNGKAFKFPNGSPYRSKPEYLNLNSGASYGVLSILLQTTL-- 109

Query: 202 PETG----VLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVI--LDSKKR 255
           P TG      I  P Y L                ++E    S + D +E  +   +S+ R
Sbjct: 110 PHTGYTRQAFIISPTYFLINDCFIDAGFGGKLTAVSEEGEDSIDFDFLEERLAHFESEAR 169

Query: 256 ----NIAPKCLVVINP-------------------GNPTGSVLSVKDMEAILTLAAKYGI 292
               ++      V NP                    NP+G   S++  + +L LA KY +
Sbjct: 170 RNDGDVGNDTSCVTNPTKNPNKKVYRYVLYCVPTYANPSGMSFSLETKKKLLDLARKYDM 229

Query: 293 VVIADEVYQ 301
           ++IAD+VY 
Sbjct: 230 LIIADDVYD 238

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 8/83 (9%)

Query: 251 DSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKF 310
           D KK+       +V    NP+G+  S +    +L LA +Y I++I+D+VY  ++ G   F
Sbjct: 182 DDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVY--DLLG---F 236

Query: 311 HSMRKVLKNLQLREPTLYKNVQL 333
           H  R    +  +R+P+ ++  QL
Sbjct: 237 HGQR---TDSGIRKPSHFRFPQL 256

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON}
           Anc_2.420 YLR027C
          Length = 408

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 269 NPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLY 328
           NPTG   + ++ E +L   AKY  + + D  YQ    GD     + +  K ++L    L 
Sbjct: 186 NPTGMDPTPEEWEQVLDAMAKYHHIALFDSAYQGFASGD-----LDRDAKAIRLGHAKLS 240

Query: 329 KNVQLASLHSISKGLSGECGQRGGYMELIG 358
           K   +    S SK L G  G+R G + ++ 
Sbjct: 241 KQSPIIICQSFSKNL-GLYGERIGCLHIVN 269

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 263 VVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSM 313
            VI   +P    + V+D+ A++++A K+GI  I D  +   +F DA  H +
Sbjct: 149 TVIFLESPGSGTMEVQDIPALVSVAKKHGIKTILDNTWATPLFFDAHAHGI 199

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 269 NPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
           NPTG+  S +    ++ +A KY +++IAD+VY 
Sbjct: 202 NPTGTTYSTETKLKLIEIARKYDMLIIADDVYD 234

>KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]
           {ON} similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 418

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 65/163 (39%), Gaps = 15/163 (9%)

Query: 150 AYSASQGVKGYRRTVAQFIERR--DGIPANPDN------VYLTAGASSAVSCLLSTFCKG 201
           +Y    G + Y+  V  F+ R   DG     +N           GA +  S LL+TF   
Sbjct: 77  SYLPITGSQDYQNNVLNFLYRESSDGSELLENNRITFVQTLSGTGALAVASKLLATFV-- 134

Query: 202 PETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDS---KKRNIA 258
               V IP P +  ++     N    + YY    DG   + D+  + + +S   +  +  
Sbjct: 135 -SKTVWIPNPSWANHSNVFQWNGFNQIKYYTYYEDG-KLSIDKWLKELKESCSSRDPDWP 192

Query: 259 PKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
           P  ++     NPTG   +++  + IL +    GI  I D  YQ
Sbjct: 193 PSIVLHACCHNPTGVDPTLEQWQQILPVIHDLGITPIIDMAYQ 235

>Skud_15.501 Chr15 (890201..894298) [4098 bp, 1365 aa] {ON} YOR336W
           (REAL)
          Length = 1365

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 6/54 (11%)

Query: 387 LMVGPPSQGDPSYEQYTQETRSIYHEL---EERSQLLWKTFCSLEGIECNMPQG 437
           ++ G P+  DP++E++    R+++ E    E + + +W+  CSL+G     P G
Sbjct: 169 ILYGCPTDDDPNFEEFN---RNLFMEAMSEEGKIRFIWRPTCSLDGENLEYPLG 219

>NDAI0C05010 Chr3 (1164977..1166590) [1614 bp, 537 aa] {ON}
           Anc_8.453 YDR232W
          Length = 537

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 21/121 (17%)

Query: 243 DEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQD 302
           DE+ER++    K    PK +   +  +  GSV    D+E I  LA KYG +   DEV+  
Sbjct: 227 DELERMLQMYPKS--TPKLIAFESVYSMAGSV---ADIEKICDLAEKYGCLTFLDEVHAV 281

Query: 303 NVFG--------DAKFHSMRKV-LKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGY 353
            ++G           F S R+V +K+      T +K+V +  +  I+  L    G  GGY
Sbjct: 282 GLYGPHGAGVAEHVDFESHRQVGIKS------TEFKSV-MDRVDMITGTLGKSFGTVGGY 334

Query: 354 M 354
           +
Sbjct: 335 V 335

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%)

Query: 241 NPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
           NP++ E+ + D K      K + + + GNP     +V D E I+ +A K+GI V+     
Sbjct: 136 NPEDFEK-LFDEKT-----KAVYIESIGNPK---YNVPDFEKIVAVAHKHGIPVVV---- 182

Query: 301 QDNVFGDAKF 310
            DN FG   F
Sbjct: 183 -DNTFGAGGF 191

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
            NP+G   S+K    ++ LA  Y I++I D+VY+
Sbjct: 225 ANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 269 NPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
           NP+G+  S+K    ++ LA +Y +++I+D+VY 
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVYD 231

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
            NP+G+  S++    ++ +A KY ++VI+D+VY 
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLVISDDVYD 228

>NDAI0K02720 Chr11 complement(610291..611514) [1224 bp, 407 aa] {ON}
           
          Length = 407

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 87/221 (39%), Gaps = 19/221 (8%)

Query: 150 AYSASQGVKGYRRTVAQF-----IERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPET 204
           +Y    G K +   V  F     I +   I  N  +   T   + A+S   +   K    
Sbjct: 100 SYLPITGCKDFETNVTNFLFNDSINKPTLIEDNRISFIQTLSGTGAISIASTFITKFLSN 159

Query: 205 GVLIPIPQYPLYTATITQN----NAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPK 260
            ++IP   +  ++  + +N    N    PYY       S N  +       S K  +   
Sbjct: 160 EIIIPNYSWANHSNILQKNGFKNNINHYPYYDPITGKLSINKWKQYLRSTHSSKSTMPRS 219

Query: 261 CLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ----DNVFGDAKFHSMRKV 316
            L+  +  NPTG   ++K  E I+ +  +  ++ I D  YQ     N+F D +   ++  
Sbjct: 220 ILLHASCHNPTGVDPTLKQWEEIIDIIHELKMIPIIDMAYQGLETGNLFQDCQL--LKLC 277

Query: 317 LKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELI 357
           L   + R P  +KN  L    S +K + G  G+R G + ++
Sbjct: 278 LD--ESRYPKGWKN-GLFLCQSFAKNM-GLYGERVGSLSIV 314

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 97/240 (40%), Gaps = 33/240 (13%)

Query: 134 VVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFI------ERRDGIPANPDNVYLT--- 184
           V RA+ M++   G   AY    G   Y   V+ F+      + R+ + +   +   T   
Sbjct: 85  VARAQLMVEGQRGGRLAYLPIAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLSG 144

Query: 185 AGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPD- 243
            GA S  S  LS F       + +P P +  +      N    +  Y    DG + + D 
Sbjct: 145 TGALSLASLFLSNFIS---KTIWVPQPSWANHMNIFKLNGFEEVRRYRYYEDG-AVDVDS 200

Query: 244 ---EMERVILDSKKRNIAPKCLVV-INPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299
              ++ER   D       P+C+++     NPTG   + +    IL++    G+V I D  
Sbjct: 201 WLAQLERAAADRPY----PQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVPIVDMA 256

Query: 300 YQDNVFGD--AKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELI 357
           YQ    GD  A  + +R  L++        + N  L   HS +K + G  G+R G + ++
Sbjct: 257 YQGLESGDLRADAYLLRMCLEH-------RWDN-GLYVCHSFAKNM-GLYGERVGSLSVV 307

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 67/172 (38%), Gaps = 22/172 (12%)

Query: 151 YSASQGVKGYRRTVAQFIER--RDGIPANPDNVYLTAGASSAVSCLL--STFCK-GPETG 205
           Y + QG    R  +A  I    R       ++V LT GAS  +  +L  +T    G    
Sbjct: 51  YGSEQGSLWVRSAIATLINDCYRPEKATRAEHVNLTGGASYGIMNILMQTTLAHAGYTRR 110

Query: 206 VLIPIPQYPLYTATI--------------TQNNAVALPYY---LNEADGWSTNPDEMERV 248
             +  P Y L                   TQ+  + L Y    L+E D    + + +   
Sbjct: 111 AFLVSPTYFLINQIFLDAGFGGRMTAVRETQDGQLDLEYLAEKLSEFDAEHPSTEALTEP 170

Query: 249 ILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
                KR       ++    NP+GS  S++    ++ LA +Y +++I+D++Y
Sbjct: 171 RRTPPKRTYRYVMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIY 222

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
            NP+G+  S++    ++ +A KY ++VI D+VY 
Sbjct: 202 ANPSGNTYSLETRRRLIEIARKYDMLVITDDVYD 235

>NCAS0A04170 Chr1 (847181..848446) [1266 bp, 421 aa] {ON} Anc_2.420
          Length = 421

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 86/221 (38%), Gaps = 35/221 (15%)

Query: 186 GASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVA--LPYYLNEADGWSTNPD 243
           GA    +  LS F   PE  + +  P +  + A       V    PY+ NE      N  
Sbjct: 110 GALHIAAKFLSKFF--PERKIYLSDPTWANHQAIFQAQGLVTNTYPYWDNETKSLDLNG- 166

Query: 244 EMERVILDSKKRNIAPKCLVVINPG---NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300
             ER I       +AP+  V +      NPTG   + +  E IL   A  G + + D  Y
Sbjct: 167 -FERSI------EVAPEGSVFVLHACAHNPTGLDPTKEQWETILERIAYKGHLALFDSAY 219

Query: 301 QDNVFGD--AKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELI- 357
           Q    GD     +S+R  ++ L+   P L          S +K + G  G+R G   ++ 
Sbjct: 220 QGFASGDLNKDAYSIRLGVEKLKRVAPILV-------CQSFAKNV-GMYGERVGCFHIVL 271

Query: 358 ---GFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQG 395
                +EEL  V   L+S  L  ++  +     +  PP+ G
Sbjct: 272 PEQDTKEELTTVKKALSS-QLSKIIRSE-----VSNPPAYG 306

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 22/34 (64%)

Query: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
            NP+G+  S++    ++ +A KY +++I D+VY 
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVYD 228

>TPHA0G03160 Chr7 (672920..674251) [1332 bp, 443 aa] {ON} Anc_2.475
           YKL106W
          Length = 443

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 77/178 (43%), Gaps = 13/178 (7%)

Query: 134 VVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQF-----IERRDGIPANPDNVYLT---A 185
           ++ A+++++ +     +Y    G +GYR+ V +F     + + + I     ++  T    
Sbjct: 82  ILEAQKIVEKSNNHDLSYLPIAGHEGYRKAVKRFLFDECVSKGEIIEQERISLIQTLSGT 141

Query: 186 GASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEM 245
           GA +  S  LSTF       V I  P +  +     +N    + +Y    +G  T  + +
Sbjct: 142 GALAITSRFLSTFVSDT---VWISDPSWVNHDNIFEKNGFKNINHYSYVKNGILTVDEWL 198

Query: 246 ERVILD-SKKRNIAPKCLVV-INPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQ 301
           + +  D  K ++  P+ +V+     NPTG   + ++ E IL       ++ I D  YQ
Sbjct: 199 DDLKRDPGKDKSTKPQAVVLHACCHNPTGIDPTKEEWERILDEIYNLNMIPIVDMAYQ 256

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,023,256
Number of extensions: 2202822
Number of successful extensions: 5170
Number of sequences better than 10.0: 133
Number of HSP's gapped: 5189
Number of HSP's successfully gapped: 133
Length of query: 521
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 407
Effective length of database: 40,409,475
Effective search space: 16446656325
Effective search space used: 16446656325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)