Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR084C8.264ON42742721790.0
Ecym_43068.264ON43443513910.0
SAKL0H16984g8.264ON43543911281e-152
KLLA0F19184g8.264ON51242511301e-151
KLTH0G13640g8.264ON4144129651e-127
ZYRO0C01606g8.264ON4324399331e-122
Kwal_56.237828.264ON4144329281e-122
NCAS0B050308.264ON4334428881e-115
TDEL0F039108.264ON4294008751e-114
NDAI0B020008.264ON4334438721e-113
Kpol_543.408.264ON4144327871e-101
Suva_10.1748.264ON4564527571e-95
Smik_12.1498.264ON4604577571e-95
YLR090W (XDJ1)8.264ON4594217362e-92
Skud_12.1588.264ON4554517171e-89
TPHA0A017908.264ON4394547125e-89
CAGL0L12276g8.264ON4524686403e-78
KNAG0G020508.264ON4324076341e-77
ADL257C2.243ON4103914682e-53
KLLA0F03333g2.243ON4093764604e-52
CAGL0J09966g2.243ON4073724473e-50
NDAI0D010302.243ON4113864455e-50
KAFR0J009402.243ON4113764449e-50
KNAG0I019002.243ON4093724431e-49
TBLA0E038102.243ON4103974431e-49
ZYRO0A01496g2.243ON4123914395e-49
TDEL0C046002.243ON4113844361e-48
YNL064C (YDJ1)2.243ON4093674361e-48
Smik_14.2632.243ON4093674342e-48
Skud_14.2682.243ON4103684325e-48
Kpol_1003.122.243ON4083694316e-48
Suva_14.2772.243ON4093674308e-48
SAKL0E08734g2.243ON4114364282e-47
Ecym_32812.243ON4093734255e-47
KLTH0G09394g2.243ON4113854246e-47
Kwal_23.48302.243ON4113914221e-46
TPHA0C031102.243ON4073664175e-46
NCAS0G030002.243ON4103904124e-45
KLTH0G08756g2.218ON4623753901e-41
Kwal_23.30612.218ON4584173795e-40
TDEL0C043502.218ON4623853611e-37
Kpol_1002.1222.218ON5034143622e-37
CAGL0F03729g8.730ON3613523516e-37
KNAG0M020202.218ON4603783559e-37
SAKL0E09306g2.218ON4613933481e-35
KLLA0C07260g8.730ON3683543431e-35
SAKL0H05258g8.730ON3683553421e-35
KNAG0G028808.730ON3783663422e-35
Smik_13.4228.730ON3783573387e-35
AER427W2.218ON4703963411e-34
TPHA0G006308.730ON3933683371e-34
TDEL0B037908.730ON3733593324e-34
Kwal_26.90248.730ON3753793272e-33
NCAS0B005308.730ON3753563255e-33
YMR214W (SCJ1)8.730ON3773573237e-33
Suva_13.3978.730ON3753563229e-33
KLTH0D12496g8.730ON3753603212e-32
Ecym_62368.730ON3743583193e-32
Skud_13.3838.730ON3753553141e-31
NDAI0E008708.730ON3763573123e-31
ZYRO0A06226g8.730ON3773713052e-30
CAGL0J10296g2.218ON4794433004e-29
AER346W8.730ON3673482771e-26
TBLA0B034908.730ON3843752745e-26
TBLA0E036602.218ON4484092695e-25
NCAS0G028502.218ON4944542681e-24
KLLA0E07899g2.218ON4952912652e-24
Skud_14.2532.218ON5322652653e-24
Smik_14.2492.218ON5332532467e-22
YNL077W (APJ1)2.218ON5282862423e-21
Suva_14.2622.218ON5362552414e-21
ZYRO0C15048g2.218ON4912472352e-20
TPHA0D005508.61ON4864152342e-20
Ecym_53842.218ON5033222317e-20
KAFR0C031608.61ON4983302291e-19
CAGL0H03707g1.398ON349681975e-16
TBLA0C014801.398ON353681922e-15
NDAI0G042501.398ON363681913e-15
YNL007C (SIS1)1.398ON352681895e-15
KAFR0H031501.398ON359681896e-15
TPHA0C029802.218ON5542291909e-15
ZYRO0E04598g1.398ON357681871e-14
Smik_14.3211.398ON366681871e-14
KNAG0H016801.398ON363681871e-14
Suva_14.3411.398ON359681871e-14
TDEL0B059601.398ON369681871e-14
Skud_14.3201.398ON368681861e-14
TPHA0B037601.398ON355681862e-14
NDAI0C026101.398ON340681852e-14
KLLA0D04818g1.398ON354741843e-14
Kpol_457.151.398ON357681833e-14
Kwal_0.2071.398ON353741816e-14
NCAS0C048901.398ON367681826e-14
CAGL0J04224g8.61ON5222411838e-14
KLTH0H12100g1.398ON350741809e-14
Kpol_1064.408.730ON3872291801e-13
NCAS0G036101.398ON327681772e-13
SAKL0D08778g1.398ON348741772e-13
KAFR0A041608.730ON3782311764e-13
AAL008W1.398ON349681745e-13
NDAI0F024502.218ON5302941731e-12
KNAG0J018408.698ON650721731e-12
AFR507W8.61ON474691712e-12
TDEL0C008708.61ON4702531703e-12
KLTH0F09944g2.350ON233681634e-12
Suva_14.1162.15ON600641685e-12
KNAG0G011308.61ON5002611677e-12
KAFR0H023108.698ON655721678e-12
TBLA0B037308.698ON693721661e-11
TBLA0E024907.217ON366741641e-11
KLLA0E04423g7.217ON428671641e-11
Skud_14.1102.15ON596641651e-11
TDEL0H022907.217ON387741631e-11
KAFR0A016201.297ON665711652e-11
Ecym_12921.398ON347681622e-11
Smik_14.1062.15ON593641632e-11
TDEL0G028002.350ON225681563e-11
KLLA0E01629g2.350ON231691563e-11
KLLA0C09823g8.698ON669721623e-11
YNL227C (JJJ1)2.15ON590641623e-11
NDAI0H031802.350ON229681563e-11
Suva_12.1851.113ON168651524e-11
NDAI0F038002.15ON6381601615e-11
Suva_8.3038.698ON664721606e-11
TBLA0D042407.217ON389741586e-11
NCAS0E029307.217ON387741586e-11
NCAS0C012208.698ON669721597e-11
KLLA0D06402g1.297ON631701597e-11
ZYRO0F15400g2.15ON525641598e-11
TPHA0G014808.698ON660741598e-11
SAKL0E06050g2.350ON232691538e-11
Skud_13.3232.350ON224691529e-11
CAGL0J02750g7.217ON382741579e-11
Ecym_56262.350ON243681539e-11
TBLA0J018707.157ON470671589e-11
YMR161W (HLJ1)2.350ON224701511e-10
KLTH0A03740g7.217ON395741551e-10
YFL016C (MDJ1)8.61ON5112561561e-10
Ecym_43727.217ON579741561e-10
SAKL0E14234g2.15ON678641572e-10
Smik_15.4378.698ON663721572e-10
KNAG0I008602.350ON219751502e-10
Kpol_1072.48.698ON661721562e-10
ADR124C1.297ON611721562e-10
CAGL0G07469g8.698ON668721562e-10
YOR254C (SEC63)8.698ON663721552e-10
ZYRO0D16390g7.217ON398741532e-10
SAKL0D06226g1.297ON615691543e-10
TBLA0G001702.15ON659641543e-10
Smik_13.3612.350ON224701483e-10
KAFR0L007407.217ON364741523e-10
Kwal_23.3578singletonOFF85611393e-10
NCAS0D009602.350ON224681483e-10
TDEL0D016401.297ON604701534e-10
YJL073W (JEM1)1.297ON645691534e-10
Skud_15.4208.698ON665721534e-10
TPHA0L007907.157ON446671525e-10
Smik_10.3851.113ON172661445e-10
Suva_13.3402.350ON225701465e-10
Suva_6.448.61ON5072491516e-10
TPHA0C012607.217ON380741506e-10
KLLA0D19602g2.15ON620641516e-10
KAFR0A079502.15ON551641517e-10
Smik_10.1681.297ON649691517e-10
Skud_9.1817.157ON421671507e-10
Ecym_14508.61ON4922731507e-10
Kpol_1027.131.297ON641701517e-10
Kpol_526.62.350ON228701458e-10
KNAG0F008602.15ON626641518e-10
Kwal_23.44202.15ON592641518e-10
Kpol_529.212.15ON622641518e-10
CAGL0H04499g2.350ON232681458e-10
Suva_5.1507.217ON391671499e-10
YER048C (CAJ1)7.217ON391671491e-09
Ecym_23748.698ON661721501e-09
ZYRO0F03652g8.61ON4624231491e-09
KNAG0I007407.157ON425671481e-09
ZYRO0A07502g2.350ON238681441e-09
KLTH0B08338g2.15ON590641491e-09
Kwal_47.181337.217ON393741471e-09
AFL190C2.350ON235681441e-09
Smik_6.638.61ON5102501481e-09
TBLA0B093802.350ON227681431e-09
TDEL0A064308.698ON666721491e-09
NDAI0A028207.157ON482671482e-09
NCAS0C039508.61ON5192361482e-09
TPHA0C045902.350ON233681432e-09
Smik_5.1737.217ON391671462e-09
KLTH0A02882g8.61ON4732621472e-09
SAKL0H05984g8.698ON658721482e-09
Skud_5.1587.217ON391671462e-09
Skud_10.1691.297ON644691472e-09
ZYRO0D10934g8.698ON663721472e-09
Skud_6.568.61ON5172571462e-09
CAGL0J07370g2.15ON623641472e-09
Suva_6.1481.297ON642691472e-09
KLLA0D07656g8.61ON4712661463e-09
TPHA0I011101.297ON666701473e-09
NCAS0G013602.15ON616641473e-09
NDAI0G032808.61ON5522241463e-09
NDAI0E045607.217ON394741453e-09
Kpol_1070.227.217ON380671453e-09
TDEL0C036801.185ON556651463e-09
KNAG0B052401.297ON668691463e-09
KNAG0L013307.217ON396691444e-09
Skud_10.3191.113ON168661364e-09
ABL194C2.15ON552641445e-09
TDEL0H032107.157ON411671435e-09
TBLA0C027201.297ON715711445e-09
CAGL0L00957g7.217ON373741426e-09
CAGL0J01936g7.157ON425671427e-09
Smik_9.2037.157ON432671427e-09
YIR004W (DJP1)7.157ON432671428e-09
NCAS0A093201.297ON635701438e-09
YJR097W (JJJ3)1.113ON172661358e-09
TDEL0E005002.15ON581641428e-09
TBLA0A011007.157ON434671419e-09
NDAI0D005001.113ON190711359e-09
KLLA0D13464g7.157ON433671419e-09
NCAS0A132107.157ON414671411e-08
KNAG0A056502.350ON175671331e-08
Kwal_26.88798.698ON656721401e-08
SAKL0F08052g7.217ON393671392e-08
KLLA0C02981g1.113ON162731322e-08
KLTH0D11770g8.698ON652721392e-08
Suva_9.2137.157ON431671382e-08
SAKL0B01276gna 1ON292711353e-08
Ecym_63181.297ON624701383e-08
CAGL0H02827g1.297ON656701383e-08
TDEL0C058801.113ON159701293e-08
Kpol_1011.98.61ON4952181373e-08
Kwal_47.179578.61ON4782331364e-08
ZYRO0G21230g1.297ON584691364e-08
SAKL0F04444g7.157ON429671355e-08
AAL103W8.698ON669721365e-08
KNAG0B018901.92ON370731345e-08
Kwal_14.24521.297ON607691356e-08
ADR015W7.157ON436671346e-08
NDAI0C002001.92ON276701327e-08
Kpol_499.307.157ON408671347e-08
ZYRO0G03850g7.157ON418671331e-07
KLTH0G18546gna 1ON283711301e-07
SAKL0C03476g1.113ON165711251e-07
CAGL0I06226g1.185ON455691311e-07
KAFR0B047807.157ON423671312e-07
TBLA0D026008.61ON510711312e-07
KAFR0B048902.350ON220681272e-07
TPHA0O019402.15ON598641312e-07
ZYRO0F15972g1.113ON162651242e-07
TBLA0A055601.92ON312711292e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR084C
         (427 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   843   0.0  
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   540   0.0  
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   439   e-152
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   439   e-151
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   376   e-127
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   363   e-122
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   362   e-122
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    346   e-115
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   341   e-114
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    340   e-113
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   307   e-101
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   296   1e-95
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   296   1e-95
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   288   2e-92
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   280   1e-89
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   278   5e-89
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   251   3e-78
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   248   1e-77
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   184   2e-53
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   181   4e-52
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   176   3e-50
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   176   5e-50
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   175   9e-50
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   175   1e-49
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   175   1e-49
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   173   5e-49
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   172   1e-48
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   172   1e-48
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   171   2e-48
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   171   5e-48
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   170   6e-48
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   170   8e-48
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   169   2e-47
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   168   5e-47
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   167   6e-47
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   167   1e-46
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   165   5e-46
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   163   4e-45
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   154   1e-41
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   150   5e-40
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   143   1e-37
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   144   2e-37
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   139   6e-37
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   141   9e-37
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   138   1e-35
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   136   1e-35
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   136   1e-35
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   136   2e-35
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   134   7e-35
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   135   1e-34
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   134   1e-34
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   132   4e-34
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   130   2e-33
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      129   5e-33
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   129   7e-33
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   128   9e-33
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   128   2e-32
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   127   3e-32
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   125   1e-31
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   124   3e-31
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   122   2e-30
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   120   4e-29
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   111   1e-26
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   110   5e-26
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   108   5e-25
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    107   1e-24
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   106   2e-24
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   106   3e-24
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    99   7e-22
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    98   3e-21
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    97   4e-21
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    95   2e-20
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    95   2e-20
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    94   7e-20
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    93   1e-19
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    80   5e-16
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    79   2e-15
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    78   3e-15
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    77   5e-15
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    77   6e-15
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    78   9e-15
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    77   1e-14
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    77   1e-14
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    77   1e-14
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    77   1e-14
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    77   1e-14
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    76   1e-14
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    76   2e-14
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               76   2e-14
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    75   3e-14
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    75   3e-14
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    74   6e-14
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     75   6e-14
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    75   8e-14
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    74   9e-14
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    74   1e-13
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      73   2e-13
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    73   2e-13
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    72   4e-13
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    72   5e-13
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    71   1e-12
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    71   1e-12
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    70   2e-12
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    70   3e-12
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    67   4e-12
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    69   5e-12
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    69   7e-12
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    69   8e-12
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    69   1e-11
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    68   1e-11
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    68   1e-11
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    68   1e-11
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    67   1e-11
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    68   2e-11
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    67   2e-11
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    67   2e-11
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    65   3e-11
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    65   3e-11
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    67   3e-11
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    67   3e-11
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      65   3e-11
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    63   4e-11
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      67   5e-11
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    66   6e-11
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    65   6e-11
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     65   6e-11
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     66   7e-11
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    66   7e-11
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    66   8e-11
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    66   8e-11
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    64   8e-11
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    63   9e-11
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    65   9e-11
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    64   9e-11
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    65   9e-11
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    63   1e-10
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    64   1e-10
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    65   1e-10
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    65   1e-10
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    65   2e-10
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    65   2e-10
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    62   2e-10
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    65   2e-10
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    65   2e-10
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    65   2e-10
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    64   2e-10
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    64   2e-10
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    64   3e-10
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    64   3e-10
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    62   3e-10
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    63   3e-10
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    58   3e-10
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    62   3e-10
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    64   4e-10
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    64   4e-10
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    64   4e-10
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    63   5e-10
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    60   5e-10
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    61   5e-10
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    63   6e-10
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    62   6e-10
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    63   6e-10
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    63   7e-10
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    63   7e-10
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    62   7e-10
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    62   7e-10
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    63   7e-10
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    60   8e-10
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    63   8e-10
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    63   8e-10
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    63   8e-10
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    60   8e-10
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    62   9e-10
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    62   1e-09
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    62   1e-09
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    62   1e-09
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    62   1e-09
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    60   1e-09
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    62   1e-09
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    61   1e-09
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    60   1e-09
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    62   1e-09
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    60   1e-09
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    62   1e-09
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    62   2e-09
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    62   2e-09
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    60   2e-09
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    61   2e-09
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    61   2e-09
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    62   2e-09
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    61   2e-09
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    61   2e-09
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    61   2e-09
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    61   2e-09
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    61   2e-09
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    61   2e-09
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    61   3e-09
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    61   3e-09
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    61   3e-09
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    61   3e-09
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             60   3e-09
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    60   3e-09
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    61   3e-09
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    61   3e-09
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    60   4e-09
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    57   4e-09
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    60   5e-09
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    60   5e-09
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    60   5e-09
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    59   6e-09
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    59   7e-09
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    59   7e-09
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    59   8e-09
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    60   8e-09
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    57   8e-09
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    59   8e-09
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    59   9e-09
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    57   9e-09
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    59   9e-09
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    59   1e-08
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    56   1e-08
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    59   1e-08
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    58   2e-08
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    55   2e-08
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    58   2e-08
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    58   2e-08
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    57   3e-08
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    58   3e-08
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    58   3e-08
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    54   3e-08
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    57   3e-08
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    57   4e-08
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    57   4e-08
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    57   5e-08
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    57   5e-08
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    56   5e-08
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    57   6e-08
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    56   6e-08
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         55   7e-08
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    56   7e-08
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    56   1e-07
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    55   1e-07
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    53   1e-07
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    55   1e-07
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               55   2e-07
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    55   2e-07
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    54   2e-07
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    55   2e-07
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    52   2e-07
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    54   2e-07
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    55   2e-07
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    52   3e-07
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    54   3e-07
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    54   3e-07
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    54   3e-07
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    54   3e-07
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    54   5e-07
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    51   5e-07
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    54   7e-07
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    53   9e-07
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    53   1e-06
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    52   2e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    52   2e-06
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    52   2e-06
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    52   2e-06
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    52   2e-06
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    52   2e-06
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    51   4e-06
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    49   4e-06
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    51   4e-06
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    51   4e-06
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    50   4e-06
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    50   4e-06
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    51   5e-06
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    50   5e-06
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    48   5e-06
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    50   7e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    50   7e-06
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    48   1e-05
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    49   1e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    49   1e-05
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    49   1e-05
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    47   1e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    49   1e-05
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    47   1e-05
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    49   1e-05
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    49   1e-05
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    49   2e-05
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    49   2e-05
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    49   2e-05
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    49   2e-05
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    49   2e-05
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    48   2e-05
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    48   2e-05
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    48   2e-05
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    48   3e-05
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    46   3e-05
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    48   3e-05
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    47   3e-05
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    47   4e-05
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    47   6e-05
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    47   7e-05
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    45   7e-05
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    47   8e-05
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    47   9e-05
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    45   9e-05
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    46   1e-04
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    46   1e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    46   1e-04
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       46   1e-04
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    45   2e-04
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    44   3e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    45   3e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    44   3e-04
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    44   3e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    43   7e-04
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    43   9e-04
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    43   0.001
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    43   0.001
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    43   0.001
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    42   0.001
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    42   0.002
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    42   0.002
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    42   0.002
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    40   0.003
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    41   0.003
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    40   0.006
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    39   0.012
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    39   0.018
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    39   0.020
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    37   0.071
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    37   0.081
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    37   0.089
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    37   0.091
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    36   0.11 
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    35   0.23 
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    35   0.25 
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    35   0.29 
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    35   0.34 
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    35   0.36 
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    34   0.39 
NCAS0A11080 Chr1 complement(2203317..2204174) [858 bp, 285 aa] {...    35   0.40 
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    33   0.78 
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    33   0.84 
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...    33   1.4  
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    33   1.5  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    33   1.6  
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    33   1.7  
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    32   2.1  
Kpol_1025.42 s1025 (112594..113172) [579 bp, 192 aa] {ON} (11259...    32   2.2  
CAGL0A00297g Chr1 complement(30179..30775) [597 bp, 198 aa] {ON}...    32   2.2  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    32   2.6  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    31   3.2  
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    32   3.5  
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    32   3.5  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    31   3.7  
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    32   3.7  
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    31   4.3  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    31   4.4  
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    31   6.1  
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    31   6.8  
TPHA0D02750 Chr4 complement(570624..572186) [1563 bp, 520 aa] {O...    31   7.9  
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    30   8.7  
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    30   9.9  

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/427 (96%), Positives = 411/427 (96%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS
Sbjct: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADST 120
           DEQKRAEYDQFGTV                MNFFRYGAGRHGYQHEEDDFEEVGRTADST
Sbjct: 61  DEQKRAEYDQFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVGRTADST 120

Query: 121 VPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISR 180
           VPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISR
Sbjct: 121 VPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISR 180

Query: 181 IGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRL 240
           IGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRL
Sbjct: 181 IGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRL 240

Query: 241 RYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRT 300
           RYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRT
Sbjct: 241 RYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRT 300

Query: 301 FDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAEL 360
           FDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAEL
Sbjct: 301 FDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAEL 360

Query: 361 DAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSRQQHESTAG 420
           DAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSRQQHESTAG
Sbjct: 361 DAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSRQQHESTAG 420

Query: 421 TPECPMQ 427
           TPECPMQ
Sbjct: 421 TPECPMQ 427

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/435 (60%), Positives = 328/435 (75%), Gaps = 9/435 (2%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           M +DLY VLGI S+A+EQEVKRAYR LAL YHPDKISDES+R  SEAKFKEISAAY +LS
Sbjct: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60

Query: 61  DEQKRAEYDQFG-----TVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGR 115
           DEQKR+EYD +G     +                 MNFFRYGAGR+G Q+E+ + +   +
Sbjct: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYG-QYEDAEQKTSQK 119

Query: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYK 175
           T D  VPLKL+TKQLYLGKTFQFK +R VLC +C G GLRKRAA    ++C  C+G+G+K
Sbjct: 120 TKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFK 179

Query: 176 ERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
           ER+SRI PG ISRERV C +C GKG  +    +DNCKKC GKCV+ E SI+++YVPRG +
Sbjct: 180 ERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHR 239

Query: 236 HGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTR 295
           H D +R  GQ+DME GKETGDLVF IDE TD  + LERKGTDL+C++ ISLAEALTGFTR
Sbjct: 240 HADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTR 299

Query: 296 IVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFN 355
           +V RTFD+R+LRI IP GKVLRPGNYLKFTNEGWPI +G+RFGD+YV+V IEFPKDNW N
Sbjct: 300 LVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLN 359

Query: 356 EKAELDAIRNILPGLADAPSTKT---EDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSR 412
           EK+EL+AI++ILPGL ++ ++     +DP+NTE++ +Y +I + + LPDYL +E Q  S 
Sbjct: 360 EKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQQRSN 419

Query: 413 QQHESTAGTPECPMQ 427
           QQ+       ECP+Q
Sbjct: 420 QQYGERNTASECPVQ 434

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  439 bits (1128), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 219/439 (49%), Positives = 299/439 (68%), Gaps = 16/439 (3%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           MT+ LYEVLG+A  AS+ E+K+AYR+LAL++HPDK++DE  RE SE KFKEI+AAY +LS
Sbjct: 1   MTK-LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILS 59

Query: 61  DEQKRAEYDQFGT-VXXXXXXXXXXXXXXXXMNFFRYGAG-------RHGYQHEEDDFEE 112
           DE  R +YD +G                   MNFFR  AG       R  Y  EE+    
Sbjct: 60  DEDSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEEN---R 116

Query: 113 VGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM--IRCEGCE 170
             RT+D+ +PLKL+ K+LY GKTF+F+++R VLC RC GSGLRK+    P   + C+ CE
Sbjct: 117 SVRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCE 176

Query: 171 GQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYV 230
           G G+KERI R+  G + RE V C  C GKG+  PT   D+CKKC GKCV+ EE  ++VY+
Sbjct: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYI 236

Query: 231 PRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEAL 290
           PRGS++GD ++  G++D EP K TGDL+FVI+E  + S++LER+G DL+  +KISL+EA+
Sbjct: 237 PRGSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAI 296

Query: 291 TGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFP 349
           TGF ++VT T D+R+L++ IP+GKV+RPGNY++  NEGWP++D G +FGDMYVQV IEFP
Sbjct: 297 TGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356

Query: 350 KDNWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQG 409
            DNWF+EK++++ +R +LP + +A    T D +NTE V  YS++ +   LPDYL  E   
Sbjct: 357 PDNWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLSYEKGE 416

Query: 410 YSRQQHESTA-GTPECPMQ 427
           Y  Q+ E  A   P+C  Q
Sbjct: 417 YQGQEQEYGAFEEPQCAQQ 435

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  439 bits (1130), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 285/425 (67%), Gaps = 11/425 (2%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           M +  Y+VLG+   A+E E+++AYR+LAL+YHPDKI DE+ERE SEA FKE++AAY +LS
Sbjct: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128

Query: 61  DEQKRAEYDQFGTVXXXXXXX---XXXXXXXXXMNFFR-YGAGRHGYQHEEDDFEEVG-- 114
           D + ++ YD +G                     MNFF+ Y   +HG      +  + G  
Sbjct: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188

Query: 115 ---RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEG 171
              RT DS +  K+TT+QLY+GKT  F+ +RK LCP C G+GLRK+   +P I C  C G
Sbjct: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248

Query: 172 QGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVP 231
           QG+KERI+R+  G + ++   C  C GKG+    +A+D CK C+GK ++ EE   +VY+P
Sbjct: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308

Query: 232 RGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT 291
           RGS+HGD  R P  +DME GKETGD++ VIDE +   S LERK  DL+ T+ ISL +ALT
Sbjct: 309 RGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSS-KSHLERKSNDLHTTLNISLVDALT 367

Query: 292 GFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKD 351
           GF+ IV  T+D R LR+N+P GKV+RPGNY KF  EGWP+ +G  FGDMYVQ+ IEFPKD
Sbjct: 368 GFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKD 427

Query: 352 NWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYS 411
           NWFNEK+E+ A+RNILPGL  +  TK  DP NTE+V +YS++ +H  LPDYL  E + Y+
Sbjct: 428 NWFNEKSEITALRNILPGLK-SKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKYN 486

Query: 412 RQQHE 416
           R+Q E
Sbjct: 487 RKQQE 491

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  376 bits (965), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 191/412 (46%), Positives = 274/412 (66%), Gaps = 14/412 (3%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
           D YE LG+A  A++ E+K+AYR+LAL++HPDK+SDES R+ SE KFKE++AAY +LS+E+
Sbjct: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61

Query: 64  KRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHE-EDDFEEVGRTADSTVP 122
           KR  YD +G                    F  + + R  YQ E E       RT D+ VP
Sbjct: 62  KRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNR--YQDEYEAQSPPSPRTDDAHVP 119

Query: 123 LKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIG 182
           ++LT ++LY GKT +F+A+R V+C RC G+G+R+R  AR    C  CEG G K+R+ R+G
Sbjct: 120 IRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRR--ARHASACSQCEGHGVKQRLRRLG 177

Query: 183 PGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRY 242
           PG ++RE V C  C G GK +   + D CKKC GK V  E   ++VY+PRGS+HGDR+  
Sbjct: 178 PGFVTREIVQCDKCKGLGKNL--RSEDMCKKCHGKRVTPESKNLNVYIPRGSRHGDRVVL 235

Query: 243 PGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFD 302
            G++D EPGK  GDLVF I E +  SSSLER+G+DLY  + ISL++ALTGF + V  T D
Sbjct: 236 KGEADEEPGKIPGDLVFDIAENS-ASSSLERRGSDLYAKITISLSDALTGFEKEVCTTLD 294

Query: 303 ERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFPKDNWFNEKAELD 361
            R+L++ +P G+V+RPGN+++  NEGWP++D G++FGDMYVQ+ IEFP D+WF+E++++ 
Sbjct: 295 GRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSERSDVK 354

Query: 362 AIRNILPGLADAPST-----KTEDPSNTEEVRAYSIIANHTGLPDYLDRENQ 408
           +++N+LP    + +T        DP+NTE    +SI+ +   LP YL  E++
Sbjct: 355 SLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE 406

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  363 bits (933), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 191/439 (43%), Positives = 279/439 (63%), Gaps = 25/439 (5%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           LY+ LG++  A++ E+K+AYR+LAL++HPDK++D+S RE SE +FKEI+AAY VLSDE+K
Sbjct: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXMNFF-RYGAGRHGYQHEEDDFEEV----GRTADS 119
           R++YD +G                  MNFF ++ +G          F        R+ D 
Sbjct: 63  RSKYDTYGDT-----ADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSDDV 117

Query: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAA-RPMIRCEGCEGQGYKERI 178
            VPLK++    Y GK F+F+++RK++C +C GSG R+R+    P   C+ C+G+GYKE++
Sbjct: 118 QVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQTNCKSCQGRGYKEQL 177

Query: 179 SRIGPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVPRGSQH 236
            R+ PG+++++ VSC  C GKGK +  PT+  + CKKC G+ +++E   ++V +PRGS+H
Sbjct: 178 RRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRH 237

Query: 237 GDRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSSS--LERKGTDLYCTMKISLAEALTGF 293
           GDR+ + G++D E GK +TGDL+F++DE T+      LER+G DL   + ISLAEA+TG 
Sbjct: 238 GDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGL 297

Query: 294 TRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA-RFGDMYVQVLIEFPKDN 352
            R +T+T D RVL+++ P GKV+ PG  +K   EGWP+   A +FGD+YV V I FP+DN
Sbjct: 298 DRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDN 357

Query: 353 WFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSR 412
           WF EK++L  IRNILP  A     K  DP NTE+V    ++     LPDY+      Y+ 
Sbjct: 358 WFAEKSDLLKIRNILPSEAANNDVKA-DPGNTEQVSDMKLVDQ---LPDYMGSNGDQYAH 413

Query: 413 QQHESTA----GTPECPMQ 427
           + H S A    GTP+C  Q
Sbjct: 414 EGHASGAFPDDGTPQCAQQ 432

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  362 bits (928), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 193/432 (44%), Positives = 275/432 (63%), Gaps = 27/432 (6%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
           D Y+ LG+A  A++ E+K+AYR+LAL++HPDK+SDES RE SE KFKE++AAY +LS+E+
Sbjct: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61

Query: 64  KRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVG--RTADSTV 121
           KR  YD +G                    F  + +GR+    +E+DF      RT D+ V
Sbjct: 62  KRRNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRY---EDEEDFRAHARPRTDDAHV 118

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRI 181
            L+LT + LY GKT +F++ R V+C RC G+G+RKR  AR    C  CEG G K+R+ R+
Sbjct: 119 SLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKR--ARHASACTHCEGHGVKQRLRRL 176

Query: 182 GPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLR 241
           GPG ++RE V C  C G GK +   + D CKKC GK V  E   ++VY+PRGS+H DR+ 
Sbjct: 177 GPGFVTRETVQCTKCRGLGKNL--RSEDLCKKCHGKRVTPETKNLNVYIPRGSRHNDRIV 234

Query: 242 YPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTF 301
             G++D EPGK TGDLVF I E +  +S+LER+G+DL+  + ISL++ALTGF + V  T 
Sbjct: 235 LEGEADEEPGKLTGDLVFDISEDS-TTSNLERRGSDLHTKIIISLSDALTGFEKEVCTTL 293

Query: 302 DERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFPKDNWFNEKAEL 360
           D R LR+ IP G+V+RPGNY+   NEGWP++D G +FG+MYVQ+ IEFP D+W++E+ E+
Sbjct: 294 DGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSERGEI 353

Query: 361 DAIRNILPGLADAPSTKTE-----DPSNTEEVRAYSIIANHTGLPDYLDRENQGYSRQQH 415
           +A+RNI+P    + +  +      DP NT E+  + I+ +   LP+YL            
Sbjct: 354 EALRNIIPQSTSSSAASSSASAEPDPVNT-EMPTFDILKSAEELPNYL----------PD 402

Query: 416 ESTAGTPECPMQ 427
           ++  G P+C  Q
Sbjct: 403 DAEQGGPQCSQQ 414

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  346 bits (888), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/442 (42%), Positives = 270/442 (61%), Gaps = 29/442 (6%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREASEAKFKEISAAYAVLSD 61
           DLY VLG+AS+A++ ++K+AYR+LAL++HPDK+  S+  +REASE KFKEISAAY +LSD
Sbjct: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62

Query: 62  EQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADSTV 121
           E KRA YD +G+                  +FF +       +H    +E+  R+ D  +
Sbjct: 63  EDKRAHYDLYGSEEEQQRQQRQYDPFE---SFFNFEQDEEPSRH----YEDPKRSPDVKI 115

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAAR----PMIRCEGCEGQGYKER 177
           PLK+T ++LY GKTF+FK +R V+C  C G G R+R   +    P + C+ C+GQG+ E+
Sbjct: 116 PLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEK 175

Query: 178 ISRIGPGLISRERVSCADCGGKGKRIP--TTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
           +  + PG  +RE+  C  C GKGK      +  + CKKC G+ +  E  +++V VPRG +
Sbjct: 176 VRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLR 235

Query: 236 HGDRLRYPGQSDMEPGK-ETGDLVFVI--DEQTDVSSSLERKGTDLYCTMKISLAEALTG 292
            GD ++   ++D E GK +TGDL+F I  D++      LERKG++    + ISLAEALTG
Sbjct: 236 DGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAEALTG 295

Query: 293 FT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIE-DGARFGDMYVQVLIEFPK 350
           F  + VT+TFD R+L ++IP GKV+RPGN +K   EGWP+  +  +FGD+Y+ V IEFP 
Sbjct: 296 FKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPP 355

Query: 351 DNWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGY 410
           DNWF EK++L  I+NILP      +  ++DP NTE +  + ++     LPD L +E Q  
Sbjct: 356 DNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLET---LPDTL-KEGQDQ 411

Query: 411 SRQQHESTA-----GTPECPMQ 427
                ES       G+P+C  Q
Sbjct: 412 GENNAESHGEYRGEGSPQCAQQ 433

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  341 bits (875), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 174/400 (43%), Positives = 256/400 (64%), Gaps = 14/400 (3%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           LYE+LG+   A++ E+K+AYR+ AL++HPDK++DES RE SE +FKEI+AAY VL DE+K
Sbjct: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63

Query: 65  RAEYDQFGTVX-XXXXXXXXXXXXXXXMNFFR-YGAG-RHGYQHEEDDFEEVGRTADSTV 121
           RA YD++G                   MNFF  +G+  ++ Y H  +  ++V R+AD  V
Sbjct: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGE--QKVDRSADVQV 121

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKR---AAARPMIRCEGCEGQGYKERI 178
           PL ++    Y GK+F+F+++R ++C RC GSG R+R       P + C+ C GQG+K+RI
Sbjct: 122 PLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQRI 181

Query: 179 SRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQH 236
            R+ PG  + E ++C  C GKGK    P    + CKKC G  V  E   ++V +PRGS+ 
Sbjct: 182 RRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGSRQ 241

Query: 237 GDRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSS--SLERKGTDLYCTMKISLAEALTGF 293
            D++   G++D E GK +TG+LVF I E T+      L+R G DL   + +SLAEA+TGF
Sbjct: 242 DDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAITGF 301

Query: 294 TRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNW 353
           ++ +T+T D R+L++ IP GKV+RPGN ++  +EGWPI D    GD+YV V IEFP DNW
Sbjct: 302 SKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI-DTTTSGDLYVVVHIEFPPDNW 360

Query: 354 FNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSII 393
           F+E+++L  ++N+LPG  +  +   +DP NTE V   +I+
Sbjct: 361 FSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIV 400

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  340 bits (872), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/443 (39%), Positives = 266/443 (60%), Gaps = 31/443 (6%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
           DLY +LG+ SSA++ E+K+AYR+LAL+YHPDK+ D ++RE +E KFKEI++AY +LSDE+
Sbjct: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62

Query: 64  KRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADSTVPL 123
           KRA YD +G                   +FF +   +  Y     D +   ++ D  +PL
Sbjct: 63  KRAHYDLYGDANENEYNNQNAN------DFFNFETDQPDYDSYAFDND---KSKDVKIPL 113

Query: 124 KLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM----IRCEGCEGQGYKERIS 179
           KL+ ++LY GKTF+F+++R ++C +C G G R+R          I C+ C G GYKER  
Sbjct: 114 KLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTR 173

Query: 180 RIGPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVPRGSQHG 237
            + PG ++ +++ C DC GKG+    P +  + CK C GK ++ E   + V VPRG Q+ 
Sbjct: 174 MLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNK 233

Query: 238 DRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSSSLE--RKGTDLYCTMKISLAEALTGFT 294
           D +R   ++D E GK +TGD++ VI+E T + S +   RKGTD    + +SLAEALTGF 
Sbjct: 234 DTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEALTGFK 293

Query: 295 -RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIE-DGARFGDMYVQVLIEFPKDN 352
            + ++++ D R+L +++P GKV+RPGN +K   EGWP+    ++FGD+YV + IEFP DN
Sbjct: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353

Query: 353 WFNEKAELDAIRNILPGLADA--PSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQ-- 408
           WF+EK+++  +RN+LP   +    S K +DP NTE V  + I+     LPD L+  N   
Sbjct: 354 WFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILEE---LPDTLNESNNRS 410

Query: 409 ----GYSRQQHESTAGTPECPMQ 427
               G     +    G P+C  Q
Sbjct: 411 AYDTGDQSDANYDREGPPQCSQQ 433

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  307 bits (787), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/432 (39%), Positives = 243/432 (56%), Gaps = 41/432 (9%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           RD YE+LG+A  A+ +E+K+ YR+LAL+YHPDK  DE ++  +E KFK+I+AAY  LSDE
Sbjct: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70

Query: 63  QKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEED-DFEEVGRTADSTV 121
            KR EYD                      NF  Y        H+ + +     R+ D  V
Sbjct: 71  DKRNEYDN-------------------KKNFEPYFESDFANNHDGNYNSRYRSRSKDIKV 111

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM----IRCEGCEGQGYKER 177
            L L T +LY GKT +F   R  +C  C G G R +   +P     I C+ C GQGYK  
Sbjct: 112 ELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNM 171

Query: 178 ISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
             ++ PG  + + V C+ C G GK  + P +  + CK C GKC+++ +  I V +PRGS 
Sbjct: 172 KVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSS 231

Query: 236 HGDRLRYPGQSDMEPGKET-GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGF- 293
           +GD +   G++D E GK+  GDL+F I+E  D ++ LER G  L     ISLAEA+TGF 
Sbjct: 232 NGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAITGFE 291

Query: 294 TRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED-GARFGDMYVQVLIEFPKDN 352
            + + +TFD+R L ++ P+GKV+RPG+ L+  NEGWP++  GA FG++YV + IEFP DN
Sbjct: 292 NKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDN 351

Query: 353 WFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSR 412
           W NEK ++  IRNILP           DP N+E +  + I+     LP     + +G  +
Sbjct: 352 WINEKNDIIKIRNILPN-EKTKRNNIVDPINSEYISTFEIVK---SLP-----QEEGEEQ 402

Query: 413 QQHESTAGTPEC 424
            +H++    P C
Sbjct: 403 TEHDT---NPSC 411

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  296 bits (757), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 174/452 (38%), Positives = 248/452 (54%), Gaps = 34/452 (7%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           LY+VLG+   AS QE+K AYR+LAL++HPDK  D+  +E +E KFKEI+AAY +LSD +K
Sbjct: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRH-----GYQHEEDDFEEVGRTADS 119
           ++ YD +G                       +  G H       +HE  +  E   + D 
Sbjct: 70  KSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDI 129

Query: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGL--RKRAAARPMIRCEGCEGQGYKER 177
            + L  T K LY+GK  +F+ +R+++C +C GSG   +K+      + CE C G+G KER
Sbjct: 130 DIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKER 189

Query: 178 ISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
           + R GPGL++ + V C  C GKGK  + P    + C  C    +  ++ +I+V VP G  
Sbjct: 190 LKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHH 249

Query: 236 HGDRLRYPGQSDMEPGKET-GDLVFVIDEQTDVSSSLERKGT-----------DLYCTMK 283
             D +   G +D E  K   GDL+F + E+ +    L++K             DLY ++ 
Sbjct: 250 FNDVVTVKGMADEEIDKAVCGDLIFHLVEKPE---DLQQKQVLMKKFGGGNLQDLYVSIT 306

Query: 284 ISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGAR--FGDMY 341
           +SL+EALTGF + +TRTFD+R+L ++I  GKV+RPG+ +K TNEGWPI D  R   GD+Y
Sbjct: 307 VSLSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLY 366

Query: 342 VQVLIEFPKDNWFNEKAELDAIRNILPGLADAPSTKT------EDPSNTEEVRAYSIIAN 395
           V V IEFP DNWFNEK+EL AI+  LP     PS  T        P N+E V  + II +
Sbjct: 367 VFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHS 426

Query: 396 HTGLPDYLDRENQGYSRQQHESTAGTPECPMQ 427
              LP+ +   N       H+  A +  CPMQ
Sbjct: 427 -DDLPEGMKTFNPKPQTSAHQK-ASSSYCPMQ 456

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  296 bits (757), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 176/457 (38%), Positives = 252/457 (55%), Gaps = 40/457 (8%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           LY+VLG+ S AS QE+K AYR+LAL++HPDK  D++ +E +E KFKEI+AAY +LSD +K
Sbjct: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDF---------EEVGR 115
           ++ YD +G                     F       G  HE +DF         ++   
Sbjct: 70  KSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSG-DHEGNDFPREYDTYEEDKCKS 128

Query: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSG--LRKRAAARPMIRCEGCEGQG 173
           + D  + + LT K LY+GK  +F+ +R+++C  C GSG  L+K+      + CE C G+G
Sbjct: 129 SKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188

Query: 174 YKERISRIGPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVP 231
            KER+ R GPGL++ + V+C  C GKGK +  P    + C  C G  +  ++ II+V V 
Sbjct: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248

Query: 232 RGSQHGDRLRYPGQSDMEPGKET-GDLVFVIDEQTDVSSSLERK-----------GTDLY 279
            G    D +   G +D E  K   GDL F + E+ +   +LE+K             DLY
Sbjct: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE---NLEQKQIFLKNFDEGSAEDLY 305

Query: 280 CTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARF-- 337
            +  ISL+EALTGF + +TRTFD+R+L ++I  G+V+RPG+ +K TNEGWPI D  R   
Sbjct: 306 TSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365

Query: 338 GDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADAPSTKT-------EDPSNTEEVRAY 390
           GD+YV + IEFP DNWFNEK+EL AI+ +LP  +      T        +P N E +  +
Sbjct: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNF 425

Query: 391 SIIANHTGLPDYLDRENQGYSRQQHESTAGTPECPMQ 427
            II N   LP+ +   N       H+  A +  CPMQ
Sbjct: 426 QII-NMEELPEGMKIFNSESQNSAHQK-AKSSYCPMQ 460

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  288 bits (736), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 167/421 (39%), Positives = 239/421 (56%), Gaps = 35/421 (8%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           LY+VLG+   A+ QE+K AYR+LAL++HPDK  D+  +E +E KFKEI+AAY +LSD +K
Sbjct: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69

Query: 65  RAEYDQFGT---VXXXXXXXXXXXXXXXXMNFFRYGAGRH---GYQHEEDDFEEVGRTA- 117
           ++ YD +G                          +  G H    +  E D +EE   T+ 
Sbjct: 70  KSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSS 129

Query: 118 -DSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGL--RKRAAARPMIRCEGCEGQGY 174
            D  + + LT K LY+GK  +F  +R+V+C +C GSG   +++      + CE C G+G 
Sbjct: 130 KDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGS 189

Query: 175 KERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYVPR 232
           KER+ R GPGL++ + V C  C GKGK  + P    + C  C G  ++ ++ II+V V  
Sbjct: 190 KERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAP 249

Query: 233 GSQHGDRLRYPGQSDMEPGKET-GDLVFVIDEQTDVSSSLERK-----------GTDLYC 280
           G    D +   G +D E  K T GDL F + E+ +   +LE+K           G DLY 
Sbjct: 250 GHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE---NLEQKQIFLKNFDDGAGEDLYT 306

Query: 281 TMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDG--ARFG 338
           ++ ISL+EALTGF + +T+TFD+R+L +++  G+V+RPG+ +K  NEGWPI D    R G
Sbjct: 307 SITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCG 366

Query: 339 DMYVQVLIEFPKDNWFNEKAELDAIRNILP---GLADAPSTKTEDPS---NTEEVRAYSI 392
           D+YV V IEFP DNWFNEK+EL AI+  LP     A   +  TED S   N E +  + I
Sbjct: 367 DLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRI 426

Query: 393 I 393
           I
Sbjct: 427 I 427

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  280 bits (717), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/451 (38%), Positives = 245/451 (54%), Gaps = 33/451 (7%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           LY VLG+   A  QE+K AYR+LAL++HPDK  D+  ++ +E KFKEI+AAY +LSD +K
Sbjct: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69

Query: 65  RAEYDQF----GTVXXXXXXXXXXXXXXXXMNFFRYGAGRHG------YQHEEDDFEEVG 114
           ++ YD +    GT                  N F    G  G      Y+  ED+  +  
Sbjct: 70  KSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDN--DSA 127

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGL--RKRAAARPMIRCEGCEGQ 172
            + D  + + LT K LY+GK  +F  +R+V+C +C GSG   +KR      + CE C G+
Sbjct: 128 SSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGK 187

Query: 173 GYKERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYV 230
           G KER+ R GPGL++ + V C  C GKGK  + P    + C  C G  +  ++ +I+V V
Sbjct: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247

Query: 231 PRGSQHGDRLRYPGQSDMEPGKET-GDLVFVIDE--------QTDVSSSLERKGTDLYCT 281
             G    D +   G +D E GK   GDL F ++E        Q  + +  +    D Y +
Sbjct: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307

Query: 282 MKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA--RFGD 339
           + ISL+EALTGF + +T+TFD+R+L ++I  G+V+RPG+ LK TNEGWPI D A  R GD
Sbjct: 308 VTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367

Query: 340 MYVQVLIEFPKDNWFNEKAELDAIRNILP--GLADAPSTKTEDPSNTEEVRAYSIIANHT 397
           +YV + IEFP DNWFNEK+EL  I+  LP    +   S    D  N E V  + II  HT
Sbjct: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNFQII--HT 425

Query: 398 -GLPDYLDRENQGYSRQQHESTAGTPECPMQ 427
             LP+ +           H+  A +  CPMQ
Sbjct: 426 DDLPEGVKTFKPKPQNPAHKK-ARSAYCPMQ 455

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  278 bits (712), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 160/454 (35%), Positives = 250/454 (55%), Gaps = 51/454 (11%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREAS---EAKFKEISAAY 56
           T+DLY +L +  + ++ E+K+ YR+LAL+YHPDK+  +D  E +     E KFKEI +AY
Sbjct: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68

Query: 57  AVLSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRT 116
            +LSDE+KR +YD                          YG G +     +        +
Sbjct: 69  EILSDEEKRKQYDLQKNFRDANQGSD-------------YGDGINTAFGNQ-------TS 108

Query: 117 ADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAAR----PMIRCEGCEGQ 172
            D ++PLK+T K LY GK  ++  +R V+C +C G G R R   +    P+  C+ C+G 
Sbjct: 109 KDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGA 168

Query: 173 GYKERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYV 230
           GYK+   +I PG  +++ + C +C GKG+  + P ++ + C KC GK +++    I+V +
Sbjct: 169 GYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNI 228

Query: 231 PRGSQHGDRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSSSLERKG-TDLYCTMKISLAE 288
           PRGS   D +    ++D E GK +TGDL+FV++E  D  ++L+R G  DL   + ISLA+
Sbjct: 229 PRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLAD 288

Query: 289 ALTGFT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA-RFGDMYVQVLI 346
           A+TGF  + + +T D R+LR++IP GKV+R G+ LK   EGWP+   A R GD+Y++  I
Sbjct: 289 AITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348

Query: 347 EFPKDNWFNEKAELDAIRNILPGLADAPSTKTED---------PSNTEEVRAYSIIANHT 397
           EFP DNW +E  ++  IRN+LP ++DA +    D           N+E++  Y  + +  
Sbjct: 349 EFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKD-- 406

Query: 398 GLPDYLDRENQGYSRQQHESTAGT----PECPMQ 427
            LPD +D  +   +   H   +      PEC  Q
Sbjct: 407 -LPDIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  251 bits (640), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 160/468 (34%), Positives = 236/468 (50%), Gaps = 61/468 (13%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKI-----SDESEREASEAKFKEISAAYAV 58
           D Y +LG+   AS+ E+KRAYR+LALR+HPDK       ++S  +  +  FKE++AAY V
Sbjct: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFR-------------YGAGRHGYQH 105
           LSD   RAEYDQ                    MNFF              + +GR   ++
Sbjct: 62  LSDASLRAEYDQ------KLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGARRY 115

Query: 106 EEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSG-------LRKRA 158
           + DD E         + LK+ T +LY GK   F  +RK  C RC G+G       ++K+ 
Sbjct: 116 KSDDIE---------IDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKT 166

Query: 159 AARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTG 216
           A      CEGCEGQG ++R+ ++ PG ++ E + C  CGGKGK   +P +  + C  C  
Sbjct: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCIT 226

Query: 217 K---CVVQEESIISVYVPRGSQHGDRLRYPGQSDME-PGKETGDLVFVIDEQTDVSSSLE 272
                +V+E  ++++ + +G+  GD++   G++D +    E GDLV  I E  +    + 
Sbjct: 227 SGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIV 286

Query: 273 RKGTDLYCTMKISLAEALTGFT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI 331
           R G DL    +I LA+A+ GF  + +  T+D RVL+ +  RGKV+RP + ++  NEGWP 
Sbjct: 287 RNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPR 346

Query: 332 EDGA-------RFGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADA--PSTKTEDPS 382
            + A       + GD+YV V I FP DNW  E  +  A+RNI+P   +    ST  E   
Sbjct: 347 REDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESIL 406

Query: 383 NTEEVRAYSI---IANHTGLPDYLDRENQGYSRQQHESTAGTPECPMQ 427
           N E +    I   I N   LP + D  +   +  + ES   TP C  Q
Sbjct: 407 NVENINVSEIVKEIPNCDELPKFQDTYDN--TNDKGESPFWTPNCSQQ 452

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  248 bits (634), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 234/407 (57%), Gaps = 29/407 (7%)

Query: 6   YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
           Y++LG+   +++ E+++AYR+LAL++HPDK+ D  E+ ++E KFKEI+ AY +LS+ +  
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNGEYV 66

Query: 66  AEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRH---GYQHEEDDFEEVGRTADST-V 121
            E                       MNFF  G   H   G+   ED+      T ++T +
Sbjct: 67  EE-----MEEEYEGQGYGFNFGDDFMNFFNEGRNAHPMGGHPQREDE-----STNEATQI 116

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAA----ARPMIRCEGCEGQGYKER 177
            +++T K LY GK  +F+  R V+C  C G+  R+R      + P++ C  C+G GY ER
Sbjct: 117 EIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVER 176

Query: 178 ISRIGPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
           +    P     +R+SC  C GKG+    PT+  + CK C G+ +++E+  + V +PRGS+
Sbjct: 177 LVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSE 236

Query: 236 HGDRLRYPGQSDMEP-GKETGDLVFVI---DEQT--DVSSSLERKGTDLYCTMKISLAEA 289
           + + + +  + D +   +  GD+VF +   DE    D    + ++GTDL+  ++I L EA
Sbjct: 237 NSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEA 296

Query: 290 LTGFT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWP-IEDGARFGDMYVQVLIE 347
           ++G   R +T+TFD+RVL++ +P+GKVLRPG+ +    EGWP   +G  FGDM+V V +E
Sbjct: 297 ISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVE 356

Query: 348 FPKDNWFNEKAELDAIRNILP-GLADAPSTKTEDPSNTEEVRAYSII 393
           FP DNW +E+ ++  + N+LP G +D    +T D +N E V+ Y I+
Sbjct: 357 FPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEIL 403

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  184 bits (468), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 197/391 (50%), Gaps = 30/391 (7%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY++LG++  A++ ++K+AYR+ AL+YHPDK   E   EA++ KFK+I+ AY +
Sbjct: 1   MVKDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSE---EAAD-KFKQITGAYEI 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXM----NFFRYGAGRHGYQHEEDDFEEVG 114
           LSD QKR  YDQFG                       + F    G  G         + G
Sbjct: 57  LSDSQKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRG--PQKG 114

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGY 174
           R  D    +  T + LY G+  +    + VLC RC G G      A  + +C  C GQG 
Sbjct: 115 R--DIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRG----GKAGSVKKCTSCNGQGV 168

Query: 175 KERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGS 234
           K     +GP +I R + +C  C G+G  IP  AAD CK C GK +  E  I+ V +  G 
Sbjct: 169 KFVTRHMGP-MIQRFQTTCEVCNGEGDVIP--AADRCKDCDGKKIASERKILEVNIQPGM 225

Query: 235 QHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFT 294
           +HG ++ + G++D +PG+  GD+VFV++EQ        R G +L+   +I L  A+ G  
Sbjct: 226 KHGQKIVFQGEADQQPGQIPGDVVFVVNEQE--HPRFVRNGDNLHYEAEIDLLTAIAG-G 282

Query: 295 RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWF 354
           +          L+I+I  G+V+ PG       +G PI+    +GD+ ++  ++FPK ++ 
Sbjct: 283 QFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGDLLIKFNVKFPKSHFA 342

Query: 355 NEKAELDAIRNILPGLADAPSTKTEDPSNTE 385
           +E+A L  +  ILP     P T    P N E
Sbjct: 343 DEEA-LKKLEAILP-----PKTLPRIPPNAE 367

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  181 bits (460), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 122/376 (32%), Positives = 190/376 (50%), Gaps = 33/376 (8%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY++LG++  A + ++K+AYR+ AL++HPDK   E   EA+E KFKEI++AY +
Sbjct: 1   MVKDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSE---EAAE-KFKEITSAYEI 56

Query: 59  LSDEQKRAEYDQFG-----TVXXXXXXXXXXXXXXXXMNFFRYGAGR-HGYQHEEDDFEE 112
           LSD QKR  YDQFG                         FF  G+ R  G Q        
Sbjct: 57  LSDSQKREVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQK------- 109

Query: 113 VGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQ 172
            GR     +P   T +QL+ G+T +    ++++C  C G G ++ +      +C  C GQ
Sbjct: 110 -GRDIRHEIP--ATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVK----KCTACSGQ 162

Query: 173 GYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPR 232
           G+K    ++GP +I R +V C  C G G+ I       CK C+GK VV E  ++ V +  
Sbjct: 163 GFKFVTRQMGP-MIQRFQVECESCHGAGEIIDPKG--RCKVCSGKKVVNERKVLEVNIEP 219

Query: 233 GSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTG 292
           G + G R+ + G++D  PG   GD+VFV+ EQ       +R G DL+   +I L  A+ G
Sbjct: 220 GMKDGQRIVFQGEADQSPGIIPGDVVFVVSEQP--HPVFKRDGNDLHYDAEIDLLSAIAG 277

Query: 293 FTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDN 352
             +   +      L++ I  G+V+ PG+      +G PI     +G++ ++  I+FP  +
Sbjct: 278 -GQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGGYGNLLIKFNIKFPPAH 336

Query: 353 WFNEKAELDAIRNILP 368
            F +   L  +  ILP
Sbjct: 337 -FTDDETLKKLEEILP 351

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  176 bits (447), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 123/372 (33%), Positives = 184/372 (49%), Gaps = 24/372 (6%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY+ LG++  AS+ E+K+AYR+ AL+YHPDK   E   EA+E KFKE+S+AY +
Sbjct: 1   MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSE---EAAE-KFKEVSSAYEI 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMN--FFRYGAGRHGYQHEEDDFEEVGRT 116
           LSD QKR  YDQFG                      F ++  G  G +          R 
Sbjct: 57  LSDSQKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQ-----RG 111

Query: 117 ADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKE 176
            D    +  + ++LY G+T +    +++LC  C G G ++ A  +    C  C GQG K 
Sbjct: 112 RDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKK----CSSCNGQGIKF 167

Query: 177 RISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQH 236
              ++GP +I R +  C  C G G  I   A D CK C GK V  E  I+ V +  G + 
Sbjct: 168 VTRQMGP-MIQRFQTECDVCHGTGDII--DAKDRCKSCNGKKVDNERKILEVRIEPGMKD 224

Query: 237 GDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRI 296
           G ++ + G++D  P    GD+VFVI E+       +R G DL    +I L  AL G  + 
Sbjct: 225 GQKIVFKGEADQAPDVIPGDVVFVISEKP--HKHFQRAGDDLIYEAEIDLLTALAG-GQF 281

Query: 297 VTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNE 356
                    L+++I  G+V+ PG       +G PI+    +G++ ++  I+FP +N F  
Sbjct: 282 ALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKFP-ENHFTS 340

Query: 357 KAELDAIRNILP 368
           +  L  +  ILP
Sbjct: 341 EENLKKLEEILP 352

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  176 bits (445), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 189/386 (48%), Gaps = 27/386 (6%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D   Y++LG++ SAS  E+K+AYR+ AL+YHPDK   E   EA+E KFKE SAAY V
Sbjct: 1   MVKDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSE---EAAE-KFKEASAAYEV 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXM---NFFRYGAGRHGYQHEEDDFEEVGR 115
           LSD++KR  YDQFG                      + F    G  G         + GR
Sbjct: 57  LSDDEKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGR 116

Query: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYK 175
             D    L  T ++LY G+T +    +++LC  C G G +K A  +    C  C GQG K
Sbjct: 117 --DIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK----CSSCNGQGVK 170

Query: 176 ERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
               ++GP ++ R +  C  C G G  I     D CK C  K V  E  I+ V++  G +
Sbjct: 171 FVTRQMGP-MLQRFQAECEVCHGTGDII--DPKDRCKTCNAKKVTNERKILEVHIEPGMK 227

Query: 236 HGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTR 295
            G ++ + G++D  P    GD++FV+ ++       +R G DL    +I L  A+ G   
Sbjct: 228 DGQKVVFKGEADQAPDIIPGDVIFVVSQKP--HEHFQRAGDDLVYEAEIDLLTAIAGGEF 285

Query: 296 IVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFN 355
            +     E  L++ I  G+V+ PG     +++G PI     +G++ V+  I+FP  N F 
Sbjct: 286 AIKHVSGEW-LKVAIVPGEVISPGARKIISDKGMPIPKYGGYGNLIVKFNIKFPP-NHFT 343

Query: 356 EKAELDAIRNILPGLADAPSTKTEDP 381
           ++  L  +  ILP     P TKT  P
Sbjct: 344 DEESLKKLEEILP-----PRTKTNIP 364

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  175 bits (444), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 188/376 (50%), Gaps = 27/376 (7%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           LY++LG++ +AS+ E+K+AYR+ AL+YHPDK   E   EA+E KFKE S+AY VLSD +K
Sbjct: 7   LYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSE---EAAE-KFKEASSAYEVLSDSEK 62

Query: 65  RAEYDQFG-----TVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADS 119
           R  YDQFG                        + F  GAG    +  +       R  D 
Sbjct: 63  RDIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQ-------RGRDI 115

Query: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERIS 179
              + ++ ++LY GKT +    +++LC  C G G +K A  +    C  C GQG K    
Sbjct: 116 KHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGAVKK----CSSCNGQGIKFVTR 171

Query: 180 RIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDR 239
           ++GP +I R +  C  C G G  I   A D CK C GK +  E  I+ V V  G ++G +
Sbjct: 172 QMGP-MIQRFQTECDVCHGTGDII--DAKDRCKDCHGKKIANERKILQVNVDPGMKNGQK 228

Query: 240 LRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTR 299
           + + G++D  P    GD++FVI E+       +R G DL    +I L  A+ G    +  
Sbjct: 229 VVFKGEADQAPDIIPGDVIFVISEKP--HKHFQRVGDDLIYEAEIDLLTAVAGGEFALEH 286

Query: 300 TFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAE 359
              E  L+++I  G+V+ P        +G PI+    +G++ ++  I+FP +N F ++  
Sbjct: 287 VSGEW-LKVSIVPGEVIAPNMRKVVEGKGMPIQKYGGYGNLIIKFSIKFP-ENHFADEDT 344

Query: 360 LDAIRNILPGLADAPS 375
           L  +  ILP     P+
Sbjct: 345 LKKLEEILPARKPLPT 360

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  175 bits (443), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/372 (31%), Positives = 188/372 (50%), Gaps = 23/372 (6%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY+VLG++ +A++ E+K+AYR++AL++HPDK   E   EA+E KFKE S+AY V
Sbjct: 1   MVKDTKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSE---EAAE-KFKEASSAYEV 56

Query: 59  LSDEQKRAEYDQFGT--VXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRT 116
           LSD  KR  YDQFG   +                 + F    G  G Q          R 
Sbjct: 57  LSDADKRDTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRPRGP----QRG 112

Query: 117 ADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKE 176
            D    + +T ++LY GKT +    +++LC  C G G +K A      +C  C GQG K 
Sbjct: 113 RDIKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVK----KCSSCNGQGIKF 168

Query: 177 RISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQH 236
              ++GP +I R +  C  C G G  +     D CK C GK V  E  I+ V+V  G ++
Sbjct: 169 VTRQMGP-MIQRFQTECDVCHGAGDIV--DPKDRCKSCNGKKVASERKILEVHVDPGMKN 225

Query: 237 GDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRI 296
           G ++ + G++D  P    GD+VFVI+E+       +R G +L    ++ L  A+ G    
Sbjct: 226 GQKVVFKGEADQAPDVIPGDVVFVINEKP--HKHFQRSGDNLVYEAEVDLLTAIAGGEFA 283

Query: 297 VTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNE 356
           +     +  L++ I  G+V+ PG       +G P+     +G++ ++  ++FP+ ++  E
Sbjct: 284 IEHVSGDW-LKVAIVPGEVIAPGARKVIDGKGMPVAKYGGYGNLIIKFTVKFPEPHFTTE 342

Query: 357 KAELDAIRNILP 368
           +  L  +  ILP
Sbjct: 343 E-NLKKLEEILP 353

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  175 bits (443), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 187/397 (47%), Gaps = 42/397 (10%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D   Y++LG++ +ASE E+K+ YR+ AL+YHPDK       EA+E KFKE SAAY V
Sbjct: 1   MVKDTKFYDILGVSPTASESEIKKGYRKAALKYHPDK---NPTAEAAE-KFKECSAAYEV 56

Query: 59  LSDEQKRAEYDQFG--------TVXXXXXXXXXXXXXXXXMNFFRYGAGRH--GYQHEED 108
           LSD +KR  YDQ+G                            FF  GA +   G Q   D
Sbjct: 57  LSDPEKRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRD 116

Query: 109 DFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEG 168
              E+  T +          +LY G+T +    +++LC  C G G +  A  +    C  
Sbjct: 117 IKHEIAATLE----------ELYKGRTAKLALNKQILCKSCEGRGGKADAVKK----CSS 162

Query: 169 CEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISV 228
           C GQG K    ++GP +I R +  C  C G G  I       CK C GK +  E  I+ V
Sbjct: 163 CGGQGIKFVTKQMGP-MIQRFQTECDVCHGTGDIIDPKG--RCKSCHGKKIANERKILEV 219

Query: 229 YVPRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAE 288
            +  G + G R+ + G+SD  P    GD+VFV++E+       +R G DL    +I L  
Sbjct: 220 KIEPGMKDGQRIVFKGESDQAPDIIPGDVVFVVNEKP--HKHFQRSGNDLVYLAEIDLLT 277

Query: 289 ALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEF 348
           A+ G    +     E  L+I I  G+V+ PG       +G PI     +G++ +Q  I+F
Sbjct: 278 AIAGGEFALEHVSGEW-LKIAIVAGEVIAPGAKKVIEGKGMPILKYGGYGNLIIQFNIKF 336

Query: 349 PKDNWFNEKAELDAIRNILPGLADAPSTKTEDPSNTE 385
           P +N F +++ L  +  ILP     P  K   P+  E
Sbjct: 337 P-ENHFTDESNLKKLEEILP-----PRNKVTIPAKAE 367

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  173 bits (439), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 184/391 (47%), Gaps = 41/391 (10%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG++++ASE E+K+AYR+ AL+YHPDK   E   EA+E KFKE S+AY VL D +K
Sbjct: 7   FYDLLGVSATASETEIKKAYRKTALKYHPDKNPSE---EAAE-KFKEASSAYEVLMDAEK 62

Query: 65  RAEYDQFG----------TVXXXXXXXXXXXXXXXXMNFFRYGAGR-HGYQHEEDDFEEV 113
           R  YDQFG                              FF  GA R  G Q         
Sbjct: 63  REAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQ--------- 113

Query: 114 GRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQG 173
            R  D    + +T ++LY G+T +    +++LC  C G G ++ A  +    C  C GQG
Sbjct: 114 -RGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKK----CTSCNGQG 168

Query: 174 YKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRG 233
            K    ++GP +I R +  C  C G G  I     D CK C+GK V  E  I+ V+V  G
Sbjct: 169 VKFITRQMGP-MIQRFQTECDACDGTGDII--NPKDRCKACSGKKVANERKILEVHVDPG 225

Query: 234 SQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGF 293
            + G ++ + G++D  P    GD++FV+ E+        R   DL     I L  A+ G 
Sbjct: 226 MKDGQKIVFKGEADQAPDIIPGDVIFVVSERP--HKHFRRDSDDLVYEADIDLLTAIAGG 283

Query: 294 TRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNW 353
              +     +  L++ I  G+V+ PG       +G P+     FG++ V+  I FPKD+ 
Sbjct: 284 EFAIEHVSGDW-LKVEIVPGEVISPGMRKVIEGKGMPVLKYGGFGNLLVKFNIVFPKDH- 341

Query: 354 FNEKAELDAIRNILPGLADAPSTKTEDPSNT 384
           F     +  +  ILP     P  KT  PS  
Sbjct: 342 FTSLENMKKLEEILP-----PRKKTSIPSKA 367

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  172 bits (436), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 181/384 (47%), Gaps = 22/384 (5%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D   Y++LG++ SA+E E+K+AYR+ AL+YHPDK       EA+E KFKE+S+AY V
Sbjct: 1   MVKDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDK---NPSAEAAE-KFKEVSSAYEV 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTAD 118
           LSD +KR  YDQFG                         +   G            R  D
Sbjct: 57  LSDSEKRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRGPQRGRD 116

Query: 119 STVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERI 178
               + +T ++LY G+T +    +++LC  C G G ++ A  +    C  C GQGYK   
Sbjct: 117 IKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVKK----CSSCNGQGYKFVT 172

Query: 179 SRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGD 238
            ++GP +I R +  C  C G G  I     D CK C GK V  E  I+ V+V  G + G 
Sbjct: 173 RQMGP-MIQRFQTECEACAGTGDII--DPKDRCKSCNGKKVANERKILEVHVDPGMKDGQ 229

Query: 239 RLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVT 298
           ++ + G++D  P    GD++FV+ E+     + +R G DL    +I L  A+ G      
Sbjct: 230 KIVFKGEADQAPDVIPGDVIFVVSEKP--HKNFQRVGDDLVYEAEIDLLTAVAG-GEFSL 286

Query: 299 RTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKA 358
                  L++ I  G+V+ PG       +G PI     +G++ V   I FP  N F    
Sbjct: 287 EHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGGYGNLLVTFKINFPP-NHFTSDE 345

Query: 359 ELDAIRNILPGLADAPSTKTEDPS 382
            L  +  ILP     P  KT  PS
Sbjct: 346 NLKKLEEILP-----PRAKTTIPS 364

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  172 bits (436), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/367 (32%), Positives = 177/367 (48%), Gaps = 22/367 (5%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG+  +A++ E+K+AYR+ AL+YHPDK   E   EA+E KFKE SAAY +LSD +K
Sbjct: 7   FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSE---EAAE-KFKEASAAYEILSDPEK 62

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXM---NFFRYGAGRHGYQHEEDDFEEVGRTADSTV 121
           R  YDQFG                      + F    G  G Q          R  D   
Sbjct: 63  RDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGP----QRGKDIKH 118

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRI 181
            +  + ++LY G+T +    +++LC  C G G +K A  +    C  C GQG K    ++
Sbjct: 119 EISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK----CTSCNGQGIKFVTRQM 174

Query: 182 GPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLR 241
           GP +I R +  C  C G G  I     D CK C GK V  E  I+ V+V  G + G R+ 
Sbjct: 175 GP-MIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 231

Query: 242 YPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTF 301
           + G++D  P    GD+VF++ E+     S +R G DL    +I L  A+ G         
Sbjct: 232 FKGEADQAPDVIPGDVVFIVSERP--HKSFKRDGDDLVYEAEIDLLTAIAG-GEFALEHV 288

Query: 302 DERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELD 361
               L++ I  G+V+ PG       +G PI     +G++ ++  I+FP +N F  +  L 
Sbjct: 289 SGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFP-ENHFTSEENLK 347

Query: 362 AIRNILP 368
            +  ILP
Sbjct: 348 KLEEILP 354

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  171 bits (434), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 178/367 (48%), Gaps = 22/367 (5%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG++ +A++ E+K+AYR+ AL+YHPDK   E   EA+E KFKE S+AY +LSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE---EAAE-KFKEASSAYEILSDSEK 62

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXM---NFFRYGAGRHGYQHEEDDFEEVGRTADSTV 121
           R  YDQFG                      + F    G  G Q          R  D   
Sbjct: 63  REVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGP----QRGKDIKH 118

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRI 181
            +  + ++LY G+T +    +++LC  C G G +K A  +    C  C GQG K    ++
Sbjct: 119 EISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK----CSSCNGQGIKFVTRQM 174

Query: 182 GPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLR 241
           GP +I R +  C  C G G  I     D CK C GK V  E  I+ V+V  G + G R+ 
Sbjct: 175 GP-MIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 231

Query: 242 YPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTF 301
           + G++D  P    GD+VF++ E+     + +R G DL    +I L  A+ G         
Sbjct: 232 FKGEADQAPDVIPGDVVFIVSERP--HKNFKRDGDDLVYEAEIDLLTAIAG-GEFALEHV 288

Query: 302 DERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELD 361
               L++ I  G+V+ PG       +G PI     +G++ ++  I+FP +N F  +  L 
Sbjct: 289 SGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGGYGNLVIKFTIKFP-ENHFTTEENLK 347

Query: 362 AIRNILP 368
            +  ILP
Sbjct: 348 KLEEILP 354

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  171 bits (432), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 116/368 (31%), Positives = 180/368 (48%), Gaps = 23/368 (6%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG++ +A++ E+K+AYR+ AL+YHPDK   E   EA+E KFKE S+AY +LSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE---EAAE-KFKEASSAYEILSDSEK 62

Query: 65  RAEYDQFG----TVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADST 120
           R  YDQFG    +                   F ++  G  G Q          R  D  
Sbjct: 63  RDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRGP----QRGKDIK 118

Query: 121 VPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISR 180
             +  + ++LY G+T +    +++LC  C G G +K A  +    C  C GQG K    +
Sbjct: 119 HEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK----CSSCNGQGIKFVTRQ 174

Query: 181 IGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRL 240
           +GP +I R +  C  C G G  +     D CK C GK V  E  I+ V+V  G + G R+
Sbjct: 175 MGP-MIQRFQTECDVCHGTGDIV--DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRI 231

Query: 241 RYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRT 300
            + G++D  P    GD+VF++ E+     S +R G DL    +I L  A+ G        
Sbjct: 232 VFKGEADQAPDVIPGDVVFLVSERP--HKSFKRDGDDLVYEAEIDLLTAIAG-GEFALEH 288

Query: 301 FDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAEL 360
                L++ I  G+V+ PG       +G P+     +G++ ++  ++FP +N F  +  L
Sbjct: 289 VSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIIKFTVKFP-ENHFTAEENL 347

Query: 361 DAIRNILP 368
             +  ILP
Sbjct: 348 KKLEEILP 355

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  170 bits (431), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 185/369 (50%), Gaps = 27/369 (7%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG++ +ASE E+K+ YR+ AL+YHPDK   +   EA+E KFKE S AY VLSD QK
Sbjct: 7   FYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTD---EAAE-KFKECSGAYEVLSDSQK 62

Query: 65  RAEYDQFG-----TVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADS 119
           R  YDQ+G                        + F  GAG    +  +       R  D 
Sbjct: 63  REIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQ-------RGKDI 115

Query: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERIS 179
              ++ T ++LY G+T +    +++LC  C G G ++ A      +C  C GQG K    
Sbjct: 116 RHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVK----KCSSCGGQGVKFVTR 171

Query: 180 RIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDR 239
           ++GP +I R +  C  C G G  I     D CK+C G  V  E  ++ V+V  G + G +
Sbjct: 172 QMGP-MIQRFQTECDVCHGSGDII--DPKDRCKECKGNKVANERKVLEVHVEPGMREGQK 228

Query: 240 LRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTR 299
           + + G++D  P    GD++FV+ E+       +R G DL    ++ L  A+ G    +  
Sbjct: 229 VTFKGEADQAPDIIPGDVIFVVTEKP--HKHFKRSGDDLLYEAEVDLLTAIAGGDFAIEH 286

Query: 300 TFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAE 359
              +  L++ I  G+V+ PG       +G P++    +G++ +   I+FP +N F ++A+
Sbjct: 287 VSGDW-LKVTIVPGEVISPGVRKVIDGKGMPVQKYGGYGNLIITFKIKFP-ENHFADEAK 344

Query: 360 LDAIRNILP 368
           L A+ +ILP
Sbjct: 345 LKALEDILP 353

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 179/367 (48%), Gaps = 22/367 (5%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG++ +A++ E+K+AYR+ AL++HPDK   E   EA+E KFKE S+AY VLSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSE---EAAE-KFKEASSAYEVLSDSEK 62

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXM---NFFRYGAGRHGYQHEEDDFEEVGRTADSTV 121
           R  YDQFG                      + F    G  G Q  +       R  D   
Sbjct: 63  REVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGP----QRGRDIKH 118

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRI 181
            +  + ++LY G+T +    +++LC  C G G +K A  +    C GC GQG K    ++
Sbjct: 119 EISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK----CTGCNGQGIKFVTRQM 174

Query: 182 GPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLR 241
           GP +I R +  C  C G G  +     D CK C GK +  E  I+ V+V  G + G ++ 
Sbjct: 175 GP-MIQRFQTECDACHGTGDIV--DPKDRCKSCNGKKIENERKILEVHVEPGMKDGQKIV 231

Query: 242 YPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTF 301
           + G++D  P    GD+VF++ E+       +R G DL    +I L  A+ G         
Sbjct: 232 FKGEADQAPDVIPGDVVFLVSERP--HKHFKRDGDDLVYEAEIDLLTAIAG-GEFALEHV 288

Query: 302 DERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELD 361
               L++ I  G+V+ PG       +G P+     +G++ V+  I+FP +N F  +  L 
Sbjct: 289 SGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIVKFTIKFP-ENHFTTEENLK 347

Query: 362 AIRNILP 368
            +  ILP
Sbjct: 348 KLEEILP 354

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  169 bits (428), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 137/436 (31%), Positives = 210/436 (48%), Gaps = 34/436 (7%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY+++G++  A + ++K+AYR+ AL+YHPDK   E   EA+E KFKEIS+AY +
Sbjct: 1   MVKDTKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTE---EAAE-KFKEISSAYEI 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMN----FFRYGAGRHGYQHEEDDFEEVG 114
           LSD QKR  YDQFG                        F ++  G  G         + G
Sbjct: 57  LSDSQKREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRG--PQKG 114

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGY 174
           R  D    +  T ++LY G+T +    +++LC  C G G      A  + +C  C GQG+
Sbjct: 115 R--DIRHEISATLEELYKGRTAKLALNKQILCKSCEGRG----GKAGAVKKCSSCNGQGF 168

Query: 175 KERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGS 234
           K    ++GP +I R +  C  C G G  I   A D CK C GK +  E  I+ V++  G 
Sbjct: 169 KFITRQMGP-MIQRFQAECDACNGTGDII--DAKDRCKACNGKKIANERKILEVHIEPGM 225

Query: 235 QHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFT 294
           + G ++ + G++D  P    GD+VFV+ E+        RKG DLY   ++ L  A+ G  
Sbjct: 226 KDGQKIVFQGEADQAPDVVPGDVVFVVSERP--HERFNRKGDDLYYEAEVDLLTAIAGGE 283

Query: 295 RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWF 354
             V     +  L++ I  G+V+ PG       +G P++    FG++ V+  I+FP  N F
Sbjct: 284 FAVQHVSGD-WLKVEIVPGEVIAPGATKIIEGKGMPVQKYGGFGNLIVKFKIKFPP-NHF 341

Query: 355 NEKAELDAIRNILPGLADAPSTKTEDPSNTEE---VRAYSIIANHTGLPDYLDRENQGYS 411
            ++A L  + NILP     P  K   P   +    V A   ++ H+G       +N    
Sbjct: 342 ADEASLKQLENILP-----PRVKPTIPKGAQIEDCVLADFDLSKHSGKSSQSKGQNYDSD 396

Query: 412 RQQHESTAGTPECPMQ 427
            ++H+   G  +C  Q
Sbjct: 397 DEEHQGAEGV-QCASQ 411

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  168 bits (425), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 115/373 (30%), Positives = 190/373 (50%), Gaps = 24/373 (6%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY++LG+++ A++ ++K+AYR+ AL+YHPDK       EA++ KFK+++AAY +
Sbjct: 1   MVKDTKLYDLLGVSADANDAQIKKAYRKAALKYHPDK---NPSSEAAD-KFKQMTAAYEI 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXM---NFFRYGAGRHGYQHEEDDFEEVGR 115
           LSD QKR  YDQFG                      + F    G  G         + GR
Sbjct: 57  LSDSQKREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRG--PQKGR 114

Query: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYK 175
             D    +  T + LY G+T +    + VLC  C G G +  +  +    C  C G G K
Sbjct: 115 --DIKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSVKK----CSSCGGHGVK 168

Query: 176 ERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
               ++GP +I R + +C  C G+G  I     D C++C+GK +  E  I+ V +  G +
Sbjct: 169 FVTRQMGP-MIQRFQTTCEACNGEGDVI--DPKDRCRECSGKKISNERKILEVNIEPGMK 225

Query: 236 HGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTR 295
           +G ++ + G++D +PG+  GD+VFV++EQ        R G +L+   +I L  A+ G  +
Sbjct: 226 NGQKVVFQGEADQQPGQIPGDVVFVVNEQE--HPKFVRNGDNLHYEAQIDLLTAVAG-GQ 282

Query: 296 IVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFN 355
                     L+++I  G+V+ PG       +G PI+    +G++ ++  ++FPK + F 
Sbjct: 283 FALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGNLLIKFNVKFPKSH-FA 341

Query: 356 EKAELDAIRNILP 368
             A+L  +  ILP
Sbjct: 342 SDADLKKLEEILP 354

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  167 bits (424), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 119/385 (30%), Positives = 182/385 (47%), Gaps = 34/385 (8%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG+   A++ ++K+ YR+ AL++HPDK       EA++ KFKE++ AY VLSD QK
Sbjct: 7   FYDLLGVPVDANDAQIKKGYRKQALKFHPDK---NPSAEAAD-KFKELTVAYEVLSDSQK 62

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXM--------NFFRYGAGR-HGYQHEEDDFEEVGR 115
           R  YDQ G                            FF  GA R  G Q   D   E   
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPRGPQKGRDIKHE--- 119

Query: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYK 175
                  +  + ++LY G+T +    ++VLC  C G G ++ A  +    C  C GQG K
Sbjct: 120 -------MSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVKK----CASCNGQGVK 168

Query: 176 ERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
               ++GP +I R +  C  C G G  +     D CK C GK +  E  I+ V++  G +
Sbjct: 169 FITRQMGP-MIQRFQAECDACNGTGDIV--DPKDRCKTCNGKKIDNERKILEVHIEPGMK 225

Query: 236 HGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTR 295
            G ++ + G++D  PG   GD++FVI ++       ERKG +LY   ++ L  A+ G   
Sbjct: 226 DGQKIVFQGEADQAPGVIPGDVIFVISQRP--HKHFERKGDNLYYQAEVDLLSAIAGGEF 283

Query: 296 IVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFN 355
            +     E  L++ I  G+V+ PG       +G P++    FGD+ V   + FP  N F 
Sbjct: 284 AIEHVSGEW-LKVGIVPGEVISPGMTKVIEGKGMPVQKYGGFGDLIVTFKVNFPT-NHFA 341

Query: 356 EKAELDAIRNILPGLADAPSTKTED 380
           ++  L  +  ILP  A     K+ D
Sbjct: 342 DEESLKKLEEILPPRAKPSFPKSAD 366

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  167 bits (422), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/391 (31%), Positives = 189/391 (48%), Gaps = 30/391 (7%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D   Y++LG++  A++ ++K+AYR+ AL++HPDK   E   EA++ KFKE++ AY +
Sbjct: 1   MVKDTKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSE---EAAD-KFKELTVAYEI 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXM----NFFRYGAGRHGYQHEEDDFEEVG 114
           LSD QKR  YDQ G                       + F    G  G Q       + G
Sbjct: 57  LSDSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRG--PQKG 114

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGY 174
           R  D    +  + ++LY G+T +    +++LC  C G G +  A  +    C  C GQG 
Sbjct: 115 R--DIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKK----CSSCNGQGI 168

Query: 175 KERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGS 234
           K    ++GP +I R +  C  C G G  I     D CK C GK +  E  I+ V++  G 
Sbjct: 169 KFITRQMGP-MIQRFQAECDVCSGTGDII--DPKDRCKSCNGKKIDNERKILEVHIEPGM 225

Query: 235 QHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFT 294
           + G ++ + G++D  PG   GD+VFVI ++       ERKG DL    ++ L  A+ G  
Sbjct: 226 KDGQKIVFQGEADQAPGIIPGDVVFVISQRP--HKHFERKGDDLLYQAEVDLLSAIAGGE 283

Query: 295 RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWF 354
             +     E  L+++I  G+V+ PG       +G PI+    +G++ V   I FP  N F
Sbjct: 284 FAIEHVSGEW-LKVSIVPGEVISPGMTKVIEGKGMPIQKYGGYGNLIVTFKINFPT-NHF 341

Query: 355 NEKAELDAIRNILPGLADAPSTKTEDPSNTE 385
            ++  L  +  ILP     P +K   P + E
Sbjct: 342 ADEESLKKLEEILP-----PRSKPSIPKSAE 367

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  165 bits (417), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 178/366 (48%), Gaps = 21/366 (5%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
            Y++LG++ +ASE E+K+ YR+ AL+YHPDK   E   EA+E KFKE SAAY VLSD QK
Sbjct: 7   FYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSE---EAAE-KFKECSAAYEVLSDSQK 62

Query: 65  RAEYDQFGTVXXXXXXXXXXXXXXXXM--NFFRYGAGRHGYQHEEDDFEEVGRTADSTVP 122
           R  YDQ+G                     + F    G  G Q          R  D    
Sbjct: 63  REVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGP----QRGRDIKHE 118

Query: 123 LKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIG 182
           ++ T ++LY G+T +    +++LC  C G G +  A      +C  C GQG K    ++G
Sbjct: 119 IQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVK----KCTSCNGQGIKFVTRQMG 174

Query: 183 PGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRY 242
           P +I R +  C  C G G  I     D CK C GK +  E  ++ V+V  G + G ++ +
Sbjct: 175 P-MIQRFQTECDVCHGSGDII--DPKDRCKDCKGKKIANERKVLEVHVEPGMREGQKIVF 231

Query: 243 PGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFD 302
            G++D  P    GD++FV+ E+       +R G DL    +I L  A+ G      +   
Sbjct: 232 KGEADQAPDVIPGDVIFVVVEKP--HKHFKRAGDDLLYEAEIDLLTAIAG-GEFAIQHVS 288

Query: 303 ERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDA 362
              L+++   G+V+  G       +G P+     +G++ V   I+FP++N+  E  +L  
Sbjct: 289 GDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGGYGNLIVTFKIKFPENNFATED-KLKE 347

Query: 363 IRNILP 368
           + NILP
Sbjct: 348 LENILP 353

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  163 bits (412), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 184/390 (47%), Gaps = 28/390 (7%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY+VLG++ +A + E+K+AYR+ AL+YHPDK   E   E    KFKE+SAAY +
Sbjct: 1   MVKDTKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAE----KFKEVSAAYEI 56

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXM----NFFRYGAGRHGYQHEEDDFEEVG 114
           LSD +KR  YDQFG                       + F    G  G         + G
Sbjct: 57  LSDSEKREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRG 116

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGY 174
           R  D    +  T ++LY G+T +    +++LC  C G G +K A      +C  C GQG 
Sbjct: 117 R--DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVK----KCSSCNGQGV 170

Query: 175 KERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGS 234
           K    ++GP +I R +  C  C G G  I     D CK C  K V  E  I+ V++  G 
Sbjct: 171 KFVTRQMGP-MIQRFQAECDVCSGTGDII--DPKDRCKTCNAKKVTNERKILEVHIEPGM 227

Query: 235 QHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFT 294
           + G  + + G++D  P    GD++FV+ ++       +R G DL    +I L  A+ G  
Sbjct: 228 KDGQNIVFKGEADQAPDVIPGDVIFVVAQKP--HKHFQRSGDDLVYEAEIDLLTAIAG-G 284

Query: 295 RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWF 354
                      L+++I  G+V+ PG+      +G PI      G++ V   ++FP+ ++ 
Sbjct: 285 EFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGGHGNLIVHFTVKFPQKHFA 344

Query: 355 NEKAELDAIRNILPGLADAPSTKTEDPSNT 384
           +E + L  +  ILP     P  K   P+N 
Sbjct: 345 DEDS-LKKLEEILP-----PRKKISIPANA 368

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  154 bits (390), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 178/375 (47%), Gaps = 41/375 (10%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
           +LY++LG+++SAS Q++K+AYR  AL++HPDK       E S+ KF++I  AY +L DE+
Sbjct: 8   ELYDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDER 64

Query: 64  KRAEYDQFGTVXXXXXXXXXXXXXXXX--------MNFFRYGA-------------GRHG 102
           KR  YD+FGT                           FF  G+             G+  
Sbjct: 65  KREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKRQ 124

Query: 103 YQHEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARP 162
             H      E+ R  D    LK T +++Y GK  +   +R  LC +C G G  K +    
Sbjct: 125 GAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKAS---- 180

Query: 163 MIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQE 222
             +C  C G+G +    R GP ++     +C+DC G+G  +     D C+ C G+  ++E
Sbjct: 181 --QCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMKQK--DICRDCNGQGCIRE 235

Query: 223 ESIISVYVPRGSQHGDRLRYPGQSDMEPGKET-------GDLVFVIDEQTDVSSSLERKG 275
             I  + V +G ++G  +  PG++D   G E        GD++ ++++    +    R  
Sbjct: 236 RRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLPHKAFWRHRDA 295

Query: 276 TDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA 335
           + +    K+ L  +L G    V      ++L+I++  G++L+PG        G P + G 
Sbjct: 296 SLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP-KSGG 354

Query: 336 RFGDMYVQVLIEFPK 350
           RFG++Y++  + FP+
Sbjct: 355 RFGNLYIRFDVAFPE 369

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  150 bits (379), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 116/417 (27%), Positives = 190/417 (45%), Gaps = 54/417 (12%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           M  DLY+ LG+A++AS QE+K+AYR  AL++HPDK       E S+ KF++I  AY +L 
Sbjct: 5   MNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYEILG 61

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXX-------------------------XXXXXMNFFR 95
           D++KR  YD+FGT                                          M+FF 
Sbjct: 62  DDKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFF- 120

Query: 96  YGAGRHGYQHEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLR 155
            G+ R G++ +        R  D    LK T +++Y GK  +   +R  LC  C G G +
Sbjct: 121 -GSSR-GFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSK 178

Query: 156 KRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCT 215
           K  +      C  C G+G + +  R GP ++     +C  CGG G  +    +D C  C 
Sbjct: 179 KATS------CYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTIV--KPSDICNGCH 229

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSD----MEPGKE---TGDLVFVIDEQTDVS 268
           G+  V+E  I  + V +G ++G  +  P ++D     + G E    GD++ ++++    S
Sbjct: 230 GQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQLPHRS 289

Query: 269 SSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEG 328
                  + L    ++ L  +L G T  V      +VL+I++  G++L+PG      + G
Sbjct: 290 LKRGHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQSMG 349

Query: 329 WPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADAPSTKTEDPSNTE 385
            P   G  +GD++++  + FP DN      + D I+ +   L   PS +T   +  E
Sbjct: 350 MPKSKGG-YGDLFIKFKVIFP-DN-----LKPDTIQTMQAALDKEPSMQTSATTQPE 399

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  143 bits (361), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 110/385 (28%), Positives = 178/385 (46%), Gaps = 47/385 (12%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY+VL ++  AS  E+++AYR LAL++HPDK    +  E S++KF E++ AY +
Sbjct: 1   MVKDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEI 57

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEE--DDF------ 110
           L DE+KR+ YDQ+GT+                 +FF  G+           D F      
Sbjct: 58  LIDEKKRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDK 117

Query: 111 ------------EEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRA 158
                       + +    D    LK T   LY GK  +    R+ +C  C G G  K  
Sbjct: 118 MSSPSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVR 177

Query: 159 AARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKC 218
                  C+ C G+G + R  ++GP ++     +C+DC G G    T  +D C+ C G+ 
Sbjct: 178 T------CKACRGRGQQSRSRQMGP-MMQTWTQTCSDCNGMGTF--TKDSDVCRDCEGEG 228

Query: 219 VVQEESIISVYVPRGSQHGDRLRYPGQSD----MEPGKET---GDLVFVIDEQTDVS-SS 270
            ++E  I  V V  G   G ++  PG++D       G ET   GD++  I +  D     
Sbjct: 229 CIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQR 288

Query: 271 LERKGTDLYC-TMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGW 329
           + R G DL     KI L  +L G    +    + +++ + I  G++++P ++    N G 
Sbjct: 289 VNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGM 348

Query: 330 PIEDGAR----FGDMYVQVLIEFPK 350
           P  +  R    +G++Y+Q  +EFP+
Sbjct: 349 PRYEEKRAPEGYGNLYIQFQVEFPE 373

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  144 bits (362), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/414 (27%), Positives = 179/414 (43%), Gaps = 77/414 (18%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           M+ +LY++L I+S+A  +++K+AYR LAL+YHPDK    +  E S+  F++IS AY VL 
Sbjct: 3   MSSELYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLI 59

Query: 61  DEQKRAEYDQ---------------------------------FGTVXXXXXXXXXXXXX 87
           D +KR  YDQ                                 FG V             
Sbjct: 60  DVEKRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAG 119

Query: 88  XXXMNFF-----------RYGAGRHGYQHEEDDFE-----EVGRTADSTVPLKLTTKQLY 131
                FF            +G  +  + +  + FE     E+ R  D    L+ + K LY
Sbjct: 120 DLFAQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLY 179

Query: 132 LGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERV 191
            GK  + +  R  LC  C G G  K++      +C  C G G   +  R+GP +I     
Sbjct: 180 YGKKTKLRLDRTRLCVLCMGQGSMKKS------KCFTCNGLGSLTQTRRMGP-MIQTFSQ 232

Query: 192 SCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRYPGQSD---- 247
           SC DC G G  +    +D C+ C+G   V+E  I  V +  G  +G  +  PG++D    
Sbjct: 233 SCPDCQGSGMFV--KRSDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEADEVVN 290

Query: 248 MEPGKE---TGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDER 304
              GK+    GD+V  I++  D +  +      L     ++L++AL G T  ++      
Sbjct: 291 TSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFISNHPSGN 350

Query: 305 VLRINIPRGKVLRPGNYLKFTNEGWPIED---------GARFGDMYVQVLIEFP 349
           +++I+I  G++L PG      N G P E+             G++YV+  I+FP
Sbjct: 351 LIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFDIKFP 404

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  139 bits (351), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 95/352 (26%), Positives = 163/352 (46%), Gaps = 19/352 (5%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           +++D Y +LG++  AS++E+K AYRQL+ +YHPDK   + E   +  KF E+  AY +L 
Sbjct: 17  LSQDYYAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEE---AHHKFIEVGEAYDILG 73

Query: 61  DEQKRAEYDQFGT-VXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADS 119
           D +KR  YD  G                    + F    GR G       F +  R+ + 
Sbjct: 74  DPEKRKTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFGRQG-----GGFRQTQRSQNY 128

Query: 120 TVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERIS 179
            V  +++ K+ Y G   +F+     +C  C GSG    +A   +  C  C+G+G   ++ 
Sbjct: 129 QVRNQVSLKEFYSGGEVEFEIPLNDICDSCHGSG----SADGKVKVCPACQGRGVVVQVI 184

Query: 180 RIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDR 239
           R+GP     ++               T  + CK C G  VV++        P G      
Sbjct: 185 RMGPITQQIQQQCGQC-----GGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNHI 239

Query: 240 LRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT-GFTRIVT 298
            +  G+SD  P  E+GD++   +E    +    R+G +LY T  I+  EA+  G+TR + 
Sbjct: 240 DKKSGESDKSPDMESGDIIIEYNESEKENLGYRRRGNNLYRTEIITANEAINGGWTREIE 299

Query: 299 RTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPK 350
              +++ ++++ P+G ++  G+  +    G PI     FGD+Y+  ++  PK
Sbjct: 300 FLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKNFGDLYIDYVVLVPK 351

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  141 bits (355), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 169/378 (44%), Gaps = 40/378 (10%)

Query: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKIS-DESEREASEAKFKEISAAYAVLSDEQ 63
           LY+VLG+AS AS+ E+K+AYR+LALRYHPDK + DE   EA    F++IS AY VL D  
Sbjct: 4   LYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEA----FQKISHAYGVLGDVA 59

Query: 64  KRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADSTV-- 121
           +R  YDQ G                   + F  G G +            G +    +  
Sbjct: 60  QRQRYDQSGD--ENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGPNIIH 117

Query: 122 PLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRI 181
            LK T + LY GK  +   RR   C RC         AA     C  C G G   RI R+
Sbjct: 118 ELKCTLQDLYRGKVIKLALRRTAPCERC------SLGAANV---CSSCNGSGNITRIERV 168

Query: 182 GPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLR 241
           GP L      +C  C G+G+      + +C +C G   + E  +  V+V  G   G  + 
Sbjct: 169 GP-LTQTWSSTCNACQGQGR-----MSVDCSQCGGAQYLNERVVFKVHVKPGMHDGQTIV 222

Query: 242 YPGQSDM--------EPGKETGDLVFVIDEQTDVS---SSLERKGTDLYCTMKISLAEAL 290
             G++D             E+GD+V VI E  D     S+L ++       +K+ L  AL
Sbjct: 223 LDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQVKVDLTTAL 282

Query: 291 TGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNE-GWPIEDGARFGDMYVQVLIEFP 349
           TG   ++       +++INI  G+ L P N +K     G PI+D  + GD+Y++     P
Sbjct: 283 TGGNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDTGQRGDLYIRFCTHSP 341

Query: 350 KDNWFNEKAELDAIRNIL 367
                 E   +D +R +L
Sbjct: 342 LQ---LEPETIDKLREVL 356

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  138 bits (348), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/393 (27%), Positives = 171/393 (43%), Gaps = 51/393 (12%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
           +LY+ L I+  A+ QE+K+AYR  AL+ HPDK    +  E S+ KF+EI  AY +L D +
Sbjct: 8   ELYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDAK 64

Query: 64  KRAEYDQFGTVXXXXXXXXXX----------XXXXXXMNFFRYGAGRHGYQHEEDDF--- 110
           K+  YD++GTV                            FF  G+         DD    
Sbjct: 65  KKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFF 124

Query: 111 -------EEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM 163
                    V R  D    L+ + ++LY GK  + +  R  LC  C G+G    +A    
Sbjct: 125 TGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGGTSSSA---- 180

Query: 164 IRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEE 223
             C  C GQG+  +  R GP ++     +C DCGG G  +     D C +C G+  ++E 
Sbjct: 181 --CRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFV--RRKDVCSECKGQGCIKER 235

Query: 224 SIISVYVPRGSQHGDRLRYPGQSD----MEPGKET---GDLVFVIDEQTDVSSSLERKGT 276
            I  + V  G  HG  +  P ++D       GKE    GD++ ++ +   V   L +   
Sbjct: 236 KIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQ---VKHPLFQIHN 292

Query: 277 DLYCTMK---ISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED 333
           D    M    + L  +L G   ++        L+I +  G++L+PG      + G P   
Sbjct: 293 DTDLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKCVESMGMPHPQ 352

Query: 334 GARFGDMYVQVLIEFPKDNWFNEKAELDAIRNI 366
              FG++Y++  ++FP      +K +L+ I  +
Sbjct: 353 SQGFGNLYIRFQVDFP------DKLQLETINKV 379

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  136 bits (343), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 108/354 (30%), Positives = 150/354 (42%), Gaps = 21/354 (5%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           + +D Y +LG+   ASE+E+K AYRQL+ +YHPDK     E   +   F E+  AY VLS
Sbjct: 17  IAQDYYAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDE---AHHHFIEVGEAYDVLS 73

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXX---MNFFRYGAGRHGYQHEEDDFEEVGRTA 117
           D +KR  YD+ G                      + F    G + Y           R  
Sbjct: 74  DPEKRQIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGK----PRGQ 129

Query: 118 DSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKER 177
           +  V   ++ K  YLG  F+F      +C  C GSG            C  C G G   +
Sbjct: 130 NLQVNHDISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKTET----CPDCGGSGQIMK 185

Query: 178 ISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHG 237
           + R GP +  R R  C+ C G+G+ I       CKKC G  VVQ+  + +  V  G +  
Sbjct: 186 VFRAGP-IEQRVRQPCSRCQGRGQLIKHV----CKKCKGVKVVQKSKVFTAKVEPGMERN 240

Query: 238 DRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIV 297
                 GQS+  P  E GDL     E    S    R+G  LY T  +S  EAL G     
Sbjct: 241 HIHVMQGQSEKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEILSFKEALQGGWERN 300

Query: 298 TRTFD-ERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA-RFGDMYVQVLIEFP 349
              FD E+ L ++ P G  ++ G      + G PI     +FGD+ +  +I  P
Sbjct: 301 IEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVILLP 354

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  136 bits (342), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 103/355 (29%), Positives = 159/355 (44%), Gaps = 17/355 (4%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           + +D Y +LG++  A ++++K AYRQL+ +YHPDK  D+   +++  KF E+  AY VLS
Sbjct: 17  LAQDYYSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDD---DSAHNKFIEVGEAYEVLS 73

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNF---FRYGAGRHGYQHEEDDFEEVGRTA 117
           D +KR  YDQ+G                    F   F       G            R  
Sbjct: 74  DPEKRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGH 133

Query: 118 DSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKER 177
           +     +LT K+ Y G +  F       C  C GSG    +    + +C  C+G G   +
Sbjct: 134 NLETREELTLKEYYRGTSIDFNLNLNDFCEHCEGSG----SQDGKVTKCPDCKGHGVVVQ 189

Query: 178 ISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHG 237
           I R+GP +  + +  C  C G+G    +T  + CK C G+ VV++     V VP G+   
Sbjct: 190 IVRMGP-VTQQIQQMCGKCQGRG----STIKNKCKHCHGEKVVRKPKSFHVDVPPGAPRN 244

Query: 238 DRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT-GFTRI 296
                 G+SD  P  + GDL     E +  +    R+G DL+ T  +SL EAL  G+ R 
Sbjct: 245 FVEVKQGESDKGPDFDAGDLFIKFSETSRDNLGYRRRGDDLFRTEALSLREALKGGWERE 304

Query: 297 VTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKD 351
           +     +R ++I      V   G   +    G P E   +FGD+Y+  ++  P D
Sbjct: 305 IEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMPKEHN-KFGDLYIDYVVIVPDD 358

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  136 bits (342), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 106/366 (28%), Positives = 165/366 (45%), Gaps = 35/366 (9%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
            +D Y +LG+A  ASE+++K AYRQ++ ++HPDK + + E   +  KF EI  AY VLSD
Sbjct: 17  AQDYYAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDE---AHHKFIEIGEAYEVLSD 73

Query: 62  EQKRAEYDQFGT--------VXXXXXXXXXXXXXXXXMNFFR--YGAGRHGYQHEEDDFE 111
            +KRA YD+FG                           + F   +G    G Q+      
Sbjct: 74  SEKRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQN------ 127

Query: 112 EVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEG 171
            V + ++  V   +T    Y G            C  C GSG    A       CE C+G
Sbjct: 128 -VRKGSNLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSG----AEDNQFATCETCQG 182

Query: 172 QGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVP 231
           +G   ++ ++G      ++V C  C GKGK I       CK C G  VV+      + VP
Sbjct: 183 RGVIIQVIQMGFMTQQIQQV-CGACQGKGKTIKHV----CKICRGARVVKTPKTFEISVP 237

Query: 232 RGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT 291
            G+Q    +   GQ++  P  ++GDLVFV +E +  +    R+G  LY T  +   EAL 
Sbjct: 238 AGAQRNYNVVKSGQAEKVPDMQSGDLVFVFEENSHENLGYRRRGDHLYRTEVLHWKEALL 297

Query: 292 -GFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA-----RFGDMYVQVL 345
            G+ R +    D++ + +   +  V  PG   +  N G P  +        +GD++++ +
Sbjct: 298 GGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEYV 357

Query: 346 IEFPKD 351
           I  PK+
Sbjct: 358 IVSPKE 363

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  134 bits (338), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 159/357 (44%), Gaps = 22/357 (6%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
            +D Y +L +   ASE+E+K AYRQL+ +YHPDK    S  E +  KF E+  AY VLSD
Sbjct: 21  AQDYYAILEVDKDASEKEIKSAYRQLSKKYHPDK---NSGSEEAHHKFIEVGEAYDVLSD 77

Query: 62  EQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFR--YGAGRHGYQHEEDDFEEVG----- 114
            +K+  YDQFG                     F   +    H +Q               
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGFGQRQR 137

Query: 115 -RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQG 173
            R     V  KL+ KQ Y G + +F       C  C GSG    +A   + +C  C+G+G
Sbjct: 138 QRGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG----SADGKLAQCPDCQGRG 193

Query: 174 YKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRG 233
              ++ R+G  +  + +  C  CGG G+ I     + CK C GK V+++     V VP G
Sbjct: 194 VIIQVLRMGI-MTQQIQQMCGRCGGTGQII----KNQCKTCHGKKVIKKNKFFHVDVPPG 248

Query: 234 SQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGF 293
           +         G+++  P  + GDLV    E+   +    R+G +LY T  +S  EAL G 
Sbjct: 249 APRNYLDTRAGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAEEALYGG 308

Query: 294 TRIVTRTFDE-RVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFP 349
            +     FDE + ++++ P   V+  G        G P + G   GD+Y+  ++  P
Sbjct: 309 WQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMP-KSGKGHGDLYIDYVVIMP 364

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  135 bits (341), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 176/396 (44%), Gaps = 42/396 (10%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY+VLG+    S  E+K++Y+  ALRYHPDK       EAS+ +F++I+ AY V
Sbjct: 1   MVKDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRV 57

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXX---------MNFFRYGAGRHGYQ----- 104
           L DE+ R  YD++GTV                          +FF  G G   +      
Sbjct: 58  LGDERLRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGES 117

Query: 105 -HEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM 163
                    V R  D    L+ T ++LY GK  +    R  LC  C G G  + +     
Sbjct: 118 GASSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAST---- 173

Query: 164 IRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEE 223
             C  C GQG   +  R G  L+     +C  C G G  +     D C  C G   ++E 
Sbjct: 174 --CTACSGQGICSQTKRQG-SLVQTWSSTCRVCSGSGTIVKD--CDTCTSCGGAGYLRER 228

Query: 224 SIISVYVPRGSQHGDRLRYPGQSD----MEPGKET---GDLVFVIDEQTDVSSSLERKGT 276
            +  V +  G + G  + +PG++D       GKE    GDL   I+E T  +    R   
Sbjct: 229 KVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCRGDA 288

Query: 277 DLYCT-MKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI-EDG 334
           +L  T + + L  +L G T  +      +++++ I  G++L PG      + G P  +D 
Sbjct: 289 NLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPDDP 348

Query: 335 ARFGDMYVQVLIEFPK---DNWFNEKAE-LDAIRNI 366
           +++G ++++  ++FPK   D+     A+ LDA  N+
Sbjct: 349 SQYGHLFIKFHVDFPKTLADSTITAIAQALDADTNV 384

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  134 bits (337), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 107/368 (29%), Positives = 162/368 (44%), Gaps = 33/368 (8%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y++LGI   ASE+ +K AYRQL+ +YHPDK  ++ E   +   F EI  AY VLSD 
Sbjct: 28  KDYYKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEE---AHNHFIEIGEAYEVLSDP 84

Query: 63  QKRAEYDQFGT--------VXXXXXXXXXXXXXXXXMNFFR----------YGAGRHGYQ 104
           +KR  YDQFG+                          + F            G G  G  
Sbjct: 85  EKRRTYDQFGSDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGGFGGG 144

Query: 105 HEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMI 164
              DD     ++   T PL L  ++ + G    F+   K  C  C GSG    +    + 
Sbjct: 145 GFADDRRRKAQSIQVTYPLSL--REYFTGANVNFQMDFKDTCDHCKGSG----SEDGKVD 198

Query: 165 RCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEES 224
           +C+ C G G+  ++ R+GP +  +    C  C G G    +T  ++CKKC G+ +V +  
Sbjct: 199 KCKECGGNGFVVQVIRMGP-VTQQMHTQCPKCHGAG----STIKNHCKKCHGQKLVTKSK 253

Query: 225 IISVYVPRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKI 284
            I+V VP G+            D E   E GDL+    E    +    R+G DL+ T  +
Sbjct: 254 EINVKVPAGAPRDFLKIVENGGDKELNAEAGDLLVQFQEIAQNNLGYRRRGNDLFRTEAL 313

Query: 285 SLAEALTGFTRIVTRTFD-ERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQ 343
              +A+ G        FD +R ++I+   G  +      K    G PI+   RFGD+Y+ 
Sbjct: 314 VFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGSDRFGDLYID 373

Query: 344 VLIEFPKD 351
            +I  P++
Sbjct: 374 YVIIVPQN 381

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  132 bits (332), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 166/359 (46%), Gaps = 21/359 (5%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           + +D Y +LG+   AS++E+K +YRQL+ ++HPDK   + E   +  KF EI  AY VLS
Sbjct: 18  LAQDYYAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDEE---AHHKFIEIGEAYEVLS 74

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMN----FFRYGAGRHGYQHEEDDFE-EVGR 115
           D +KR  +DQ+G                   N     F     R G          +  R
Sbjct: 75  DPEKRKIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQRPR 134

Query: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYK 175
             +  V  +L+ K+ Y G T +F      +C  C G+G    +A   + +C  C+G+G  
Sbjct: 135 GHNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG----SADGKVAKCSDCQGRGVV 190

Query: 176 ERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
            ++ R+G  +  + +  C  CGGKG  I     ++CK C G  VV+++    V VP G+ 
Sbjct: 191 IQVIRMGM-MTQQIQQMCGRCGGKGSVI----KNHCKTCHGSKVVKKQKPFHVEVPPGAA 245

Query: 236 HGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTR 295
                   G+SD     + GD+    +E+T  +    R+G  LY T  +S  EAL G  +
Sbjct: 246 RHYTETRSGESDKGADFDAGDVFIEFNEKTTNNLGYRRRGPHLYRTEVLSAREALKGDWQ 305

Query: 296 IVTRTFDERVLRINIPRGK--VLRPGNYLKFTNEGWPIEDGAR-FGDMYVQVLIEFPKD 351
                 DE+  ++ I R K  V+  G   +    G P  +G   FGD++++ ++  P +
Sbjct: 306 REVEFLDEKK-KVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYVVVMPHE 363

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 107/379 (28%), Positives = 161/379 (42%), Gaps = 39/379 (10%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
            +D Y +LG++  AS++E+K AYRQL+ ++HPDK   +   E +  KF E+  AY VLSD
Sbjct: 23  AQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGD---EDAHHKFIEVGEAYEVLSD 79

Query: 62  EQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADSTV 121
           +QKR  YDQ G                       +           D FE++        
Sbjct: 80  DQKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDP--------MDIFEQMFGGHRGGG 131

Query: 122 PL------------KLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGC 169
                         +LT KQ Y G +  F       C  C GSG +          C  C
Sbjct: 132 GRGRPRGHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKTTH----CSEC 187

Query: 170 EGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVY 229
            GQG   ++ R+GP L  + +  C  C GKG+ I     + CK+C G  V ++     V 
Sbjct: 188 RGQGVVIQVVRMGP-LTQKIQQMCGACQGKGQVI----KNKCKRCHGAKVERKAKHFHVD 242

Query: 230 VPRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEA 289
           VP G+         G++D  P  ++GD+     E +  +    R+G  LY T  +SL EA
Sbjct: 243 VPAGAPRDFVDVKAGEADKGPDFDSGDVFIKFSESSRDNMGYRRRGPHLYRTEVLSLKEA 302

Query: 290 LTGFTRIVTRTFD-ERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEF 348
           L G  +     FD  + L++   +G  +R G   +    G P     + GD++V  ++  
Sbjct: 303 LLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHGKHGDLFVDYVVVI 362

Query: 349 PKDNWFNEKAELDAIRNIL 367
           PK      K   D +R+ L
Sbjct: 363 PK------KVSPDLVRDEL 375

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  129 bits (325), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 163/356 (45%), Gaps = 19/356 (5%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
            +D Y++LGIA  A+++E+K AYRQL+ ++HPDK       E +  KF E+  AY VLSD
Sbjct: 19  AQDYYQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSD 75

Query: 62  EQKRAEYDQFGTVXXXXXXXXXXXXXXXXMN----FFRYGAGRHGYQHEEDDFEEVGRTA 117
            QKR  +DQFG                   +    F +   G+ G  +      +  R  
Sbjct: 76  PQKRQTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQKPRGP 135

Query: 118 DSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKER 177
           +     +++ K  Y G    F      LC  C G+G    +    +  C  C+G+G   +
Sbjct: 136 NIMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG----SDDGKLTPCPDCQGRGVIIQ 191

Query: 178 ISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHG 237
           + R+G  +  + +  C  CGGKG+         C+KC G  V+ ++    V +P+G++  
Sbjct: 192 LIRMGM-MTQQIQQMCGRCGGKGQLF----KKQCRKCHGNKVMPQKKEFQVKLPKGAKRH 246

Query: 238 DRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT-GFTRI 296
                 G++D  P  E GDL+   +E    +    R+G +LY T  +++ EAL  G+ R 
Sbjct: 247 YMDVKHGEADKNPDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEVLNVTEALYGGWQRE 306

Query: 297 VTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGAR--FGDMYVQVLIEFPK 350
           +     ++ L++      V+  G   +    G P   G +  FGD+++  ++  PK
Sbjct: 307 IPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFIDYVVIMPK 362

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  129 bits (323), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 161/357 (45%), Gaps = 21/357 (5%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
            +D Y +L I   A+E+E+K AYRQL+ +YHPDK    +  E +  KF E+  AY VLSD
Sbjct: 21  AQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDK---NAGSEEAHQKFIEVGEAYDVLSD 77

Query: 62  EQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFF-------RYGAGRHGYQHEEDDFEEVG 114
            +K+  YDQFG                    F        R   G HG         +  
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQ 137

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGY 174
           R     V  KL+ KQ Y G + +F       C  C GSG    +A   + +C  C+G+G 
Sbjct: 138 RGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG----SADGKLAQCPDCQGRGV 193

Query: 175 KERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGS 234
             ++ R+G  +  + +  C  CGG G+ I     + CK C GK V ++     V VP G+
Sbjct: 194 IIQVLRMGI-MTQQIQQMCGRCGGTGQII----KNECKTCHGKKVTKKNKFFHVDVPPGA 248

Query: 235 QHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT-GF 293
                    G+++  P  + GDLV    E+   +    R+G +LY T  +S AEAL  G+
Sbjct: 249 PRNYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGW 308

Query: 294 TRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPK 350
            R +    + + ++++ P   V+  G        G P +    +GD+Y+  ++  PK
Sbjct: 309 QRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMP-KGSKGYGDLYIDYVVVMPK 364

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  128 bits (322), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 106/356 (29%), Positives = 159/356 (44%), Gaps = 21/356 (5%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
            +D Y +L I   ASE+E+K AYRQL+ +YHPDK +   E   +  KF EI  AY VLSD
Sbjct: 21  AQDYYAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDE---AHHKFIEIGEAYEVLSD 77

Query: 62  EQKRAEYDQFGTVXXXXXXXXXXXXXXXXMN-----FFRYGAGRHGYQHEEDDFEEVGRT 116
            +K+  YDQFG                   +     F R   G  G         +  R 
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQRG 137

Query: 117 ADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKE 176
               V   L+ KQ Y G + +F       C  C GSG    +A   + +C  C+G+G   
Sbjct: 138 PTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG----SADGKLAQCPDCQGRGIIV 193

Query: 177 RISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQH 236
           ++ R+G  +  + +  C  C G G+ I     + CK C GK V ++     V VP G+  
Sbjct: 194 QVVRMGI-MTQQIQQICGRCAGTGQVI----KNQCKTCHGKKVTKKNKFFHVDVPPGAPR 248

Query: 237 GDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT-GFTR 295
                  G+++  P  + GDLV    E    +    R+G +LY T  +S AEAL  G+ R
Sbjct: 249 NYMDTRAGEAEKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRTEVLSAAEALYGGWER 308

Query: 296 IVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGAR-FGDMYVQVLIEFPK 350
            +    + + ++++ P   V+  G        G P   G+R  GD+Y+  ++  PK
Sbjct: 309 TIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMP--KGSRDHGDLYIDYVVVMPK 362

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  128 bits (321), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 159/360 (44%), Gaps = 28/360 (7%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           + +D Y +LG++  ASE+E+K AYRQL+ +YHPDK   +   E +  KF E+  AY VLS
Sbjct: 21  VAQDYYAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGD---ETAHHKFIEVGEAYEVLS 77

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXX----------MNFFRYGAGRHGYQHEEDDF 110
           D+QKR  Y+Q+G                            M+ F    G           
Sbjct: 78  DDQKRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRGRP 137

Query: 111 EEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCE 170
                 A      ++T K+ Y G +  F       C  C G+G +     R    C  C+
Sbjct: 138 RGHNLEARE----EITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGKTTR----CSDCQ 189

Query: 171 GQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYV 230
           GQG   +I R+GP +  + +  C  C GKG+ I     + CK+C G  V ++     V V
Sbjct: 190 GQGVVIQIIRMGP-ITQQIQQMCGACQGKGQII----KNKCKQCHGAKVERKTKHFHVDV 244

Query: 231 PRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEAL 290
           P G+         G++D  P  + GD+     E +  +    R+G  L+ T  ++L EAL
Sbjct: 245 PAGAPRDFVDVKNGEADKGPDFDAGDVYIKFSESSRDNMGYRRRGVHLHRTEVLTLKEAL 304

Query: 291 T-GFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFP 349
             G+ R +      + ++++   G  +R G   +    G P +DG  FGD++V  ++  P
Sbjct: 305 QGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP-KDGRHFGDLFVDYVVLTP 363

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  127 bits (319), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/358 (27%), Positives = 159/358 (44%), Gaps = 22/358 (6%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
             +D Y +LG+   AS++++K AYRQL+ +YHPDK   +   E +  +F E+  AY  LS
Sbjct: 18  FAQDYYAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGD---EDAHNRFIEVGEAYEALS 74

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXX-----MNFF--RYGAGRHGYQHEEDDFEEV 113
           D +KR  YDQFG                        + F   +G G     H        
Sbjct: 75  DPEKRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRK 134

Query: 114 GRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQG 173
            R     V  +L  K+ Y G + +F       C  C GSG +     +    C  C G+G
Sbjct: 135 QRGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGKVEK----CGQCGGRG 190

Query: 174 YKERISRIGPGLISRE-RVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPR 232
              ++ R   G I+++ +  C  C G+G+ I     + CK C G  VV++     V VP 
Sbjct: 191 MVVQVIR--QGFITQQIQQMCQKCEGRGEVI----KNKCKTCHGSKVVKKNKSFHVDVPA 244

Query: 233 GSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT- 291
           G+         G+++  P  E GD+   + E    +    R+G DL+ T  +SL EAL  
Sbjct: 245 GAPRDFVAVIRGEAEKSPDTEPGDIYVKVVESPVQNMGYRRRGPDLFRTEVLSLTEALKG 304

Query: 292 GFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFP 349
           G+ R +     ++ + ++  +G  ++ G        G P+E G ++GD+YV  +I  P
Sbjct: 305 GWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLESGTKYGDLYVDYVIVMP 362

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  125 bits (314), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 103/355 (29%), Positives = 160/355 (45%), Gaps = 19/355 (5%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
            +D Y +L I   ASE+E+K AYRQL+ ++HPDK    +  E +  KF E+  AY VLSD
Sbjct: 21  AQDYYAILEIDKGASEKEIKSAYRQLSKKFHPDK---NAGSEEAHQKFIEVGEAYDVLSD 77

Query: 62  EQKRAEYDQFGTVXXXXXXXXXXXXXXXXMN-----FFRYGAGRHGYQHEEDDFEEVGRT 116
            +K+  YDQFG                   +     F R   G HG         +  R 
Sbjct: 78  PEKKKIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRG 137

Query: 117 ADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKE 176
               V  KL+ KQ Y G + +F       C  C GSG    +A   + +C  C+G+G   
Sbjct: 138 PMIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG----SADGKLAQCPDCQGRGVII 193

Query: 177 RISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQH 236
           ++ R+G  +  + +  C  CGG G+ I     + CK C G  V +      V VP G+  
Sbjct: 194 QVLRMGI-MTQQIQQMCGRCGGTGQVI----KNECKTCHGNKVTKRNKFFHVDVPPGAPR 248

Query: 237 GDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT-GFTR 295
                  G+++  P  + GDLV    E+   +    R+G +LY T  +S+ EAL  G+ R
Sbjct: 249 NYMDTRAGEAEKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWER 308

Query: 296 IVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPK 350
            +    + + ++++ P    +  G        G P + G  +GD+Y+  ++  PK
Sbjct: 309 TIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMP-KGGKGYGDLYIDYVVIMPK 362

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  124 bits (312), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 166/357 (46%), Gaps = 19/357 (5%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
             +D Y++L +   A++++++ AYRQL+ +YHPDK  ++   E +  KF E+  AY +LS
Sbjct: 19  FAQDYYKILELDKDATDKDIRSAYRQLSKKYHPDKNPND---EDAHHKFIEVGQAYEILS 75

Query: 61  DEQKRAEYDQFG--TVXXXXXXXXXXXXXXXXMNFFR--YGAGRHGYQHEEDDFEEVGRT 116
           D +KR  YDQFG   V                 + F   +G G     H  + F++  + 
Sbjct: 76  DPEKRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQR 135

Query: 117 ADSTVPLKLTT-KQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYK 175
             + V  + T+ K  Y G   +F      +C  C GSG     +     +C  C+G+G  
Sbjct: 136 GQNVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSGSNDGKST----KCPDCQGRGVT 191

Query: 176 ERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235
            ++ R+G      ++V C  CGGKG+ I     + CK C G  VVQ+     + +P G+ 
Sbjct: 192 VQVIRMGMMTQQIQQV-CGKCGGKGQII----KNPCKTCHGSKVVQKPKDFEIELPAGAP 246

Query: 236 HGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT-GFT 294
                   G +D  P  ++GD+     E    +    R+G  LY T  ++  EAL  G+ 
Sbjct: 247 RKFVHAEHGAADKHPDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNATEALYGGWE 306

Query: 295 RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGAR-FGDMYVQVLIEFPK 350
           R +      +++ I     K+++ G   +    G P+ +G + FGD+++  ++  P+
Sbjct: 307 RQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVVMPE 363

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 100/371 (26%), Positives = 159/371 (42%), Gaps = 45/371 (12%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
           + +D Y +LG+   AS+++VK AYRQL+ +YHPDK   +   E++  +F E+  AY VLS
Sbjct: 16  LAQDYYSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGD---ESAHQRFIEVGEAYEVLS 72

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEE-DDFEEV------ 113
           D +KR  +DQ+G                    F           H+  D FE++      
Sbjct: 73  DPEKRGIFDQYGADGLKNGAGGGGGPGGGFGGF-----------HDPFDIFEQMFNRGGG 121

Query: 114 -------------GRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAA 160
                        G+     V  +L+ K  Y G   +F+     +C  C GSG    +  
Sbjct: 122 GGGFGGGFGGMHRGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG----SED 177

Query: 161 RPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVV 220
             +  C  C GQG   +I R+G  +  R +  C  C G+G  I     + CK C G  VV
Sbjct: 178 GKVETCPDCGGQGILIQIIRMGI-MTQRIQQPCGRCSGRGHII----KNQCKACGGHKVV 232

Query: 221 QEESIISVYVPRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYC 280
           ++     V VP G+          ++D     E GD+     E    +    R+G  L+ 
Sbjct: 233 KKPKSFQVEVPAGAPRDHVEVRHQEADQSTDMEAGDIFVEFTESDKNNMGYRRRGDHLFR 292

Query: 281 TMKISLAEALT-GFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI-EDGARFG 338
           T  +S  EAL  G++R +    D + +++  P+G ++  G   +    G P    G  FG
Sbjct: 293 TEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFG 352

Query: 339 DMYVQVLIEFP 349
           D++V+  +  P
Sbjct: 353 DLFVEYAVVMP 363

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  120 bits (300), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 113/443 (25%), Positives = 180/443 (40%), Gaps = 76/443 (17%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY++L +   AS+  +K+A+   ALR HPDK    +  E S+ +F+EIS AY V
Sbjct: 1   MVKDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEV 57

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDD--------- 109
           LSD + R  YD++GT                 M+F+  G   H +     D         
Sbjct: 58  LSDPKSREMYDRYGTTDESAIASQEPFGEG--MSFYSGGNPMHMFGTSAGDLFAQFFNSS 115

Query: 110 ------------FEEVGRTADS---------TVP-----LKLTTKQLYLGKTFQFKARRK 143
                       F+  G +A +         T P     LK     LY GK  +    R 
Sbjct: 116 GDAGPSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRM 175

Query: 144 VLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRI 203
            +C  C G G  + A+      C  C+GQG   +  R+GP ++     +C  C G G  I
Sbjct: 176 RVCSSCDGKGGMRVAS------CRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGTFI 228

Query: 204 PTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRYPGQSD--MEPGK-----ETGD 256
             +  D C  C G  V +E  I  V V  G  H   +  PG++D  +E        + GD
Sbjct: 229 KDS--DLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGD 286

Query: 257 LVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVL 316
           +V VID   +    +      +    ++ L   L G   ++      ++++++I   ++L
Sbjct: 287 VVIVIDLVKNTQFQVVNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELL 346

Query: 317 RPGNYLKFTNEGWPI------------EDGARFGDMYVQVLIEFPKDNWFNEKAELDAIR 364
           +P  +      G P              D   +G++YVQ  ++FP      E+ E   I 
Sbjct: 347 KPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFP------ERLEDTTIT 400

Query: 365 NILPGLADAPSTKTEDPSNTEEV 387
            +   L   P+ K ED S+ + +
Sbjct: 401 KLQEILEQDPNVKKEDESDQKRI 423

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  111 bits (277), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 148/348 (42%), Gaps = 12/348 (3%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y +LG+   A+E+++K AYRQL+ +YHPDK   ++    +   F E+  AY  LSD 
Sbjct: 20  QDYYAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDT---TAHHNFIEVGEAYEALSDP 76

Query: 63  QKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTADSTVP 122
           +KR  YDQ+G                    F  +     G            R+    V 
Sbjct: 77  EKRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQVQ 136

Query: 123 LKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIG 182
            +LT +Q Y G   +F       C  CG +G +         RC  C  +G   ++ R G
Sbjct: 137 EELTLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGKVE----RCTQCSVRGVIVQVGRQG 192

Query: 183 PGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRY 242
                 ++V     G   K +P      CK C G   +++     V VP G+        
Sbjct: 193 FMTQQFQQVCPRLLGPWPKALPK----KCKVCQGHKAIKKNKSFRVEVPPGAPRDFVAVQ 248

Query: 243 PGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTG-FTRIVTRTF 301
            G+++  P  + GD+   + E T  +    R+G +L+ T  +SL EAL G + R +    
Sbjct: 249 QGEAEKVPDMDPGDIYVKVFENTRDNMGYRRQGANLFRTEVLSLKEALHGDWKRELEFLD 308

Query: 302 DERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFP 349
             + +  +  +G+ ++ G   +    G P+ D A FGD+YV  ++  P
Sbjct: 309 PSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAGFGDLYVDYVVILP 356

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  110 bits (274), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 103/375 (27%), Positives = 151/375 (40%), Gaps = 51/375 (13%)

Query: 4   DLYEVLGIASSAS-EQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           D Y++LGI  +   E+E+K AYR+L+ +YHPDK  ++ +   ++  F ++  AY VL D 
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKD---AQQNFIKVGEAYDVLGDP 80

Query: 63  QKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEE-DDFEEVGRTADST- 120
            K+ +YDQ G                     F          H+  D FE++        
Sbjct: 81  DKKRQYDQMGHDAFVNNAQHGGPEGGPGGQPF----------HDPFDMFEKMFHGGGPGG 130

Query: 121 ----------------------VPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRA 158
                                 V  +L+ KQ Y G  FQF       C  C G+G     
Sbjct: 131 GNPFGGNPFGGGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGK 190

Query: 159 AARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKC 218
                  C  C+G G   +I R+G  +  + +  C  C G+G  I       CK C G  
Sbjct: 191 TKV----CPDCKGSGIIIQIIRMG-MMTQQIQQPCGRCRGQGHLIKNF----CKVCNGAK 241

Query: 219 VVQEESIISVYVPRGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDL 278
           V Q+     VYVP GS         GQ++  P  E GD++   +E    +    R+G +L
Sbjct: 242 VQQKLKDFKVYVPPGSPRNHVEVKAGQAEKNPNYEPGDVIIEFNELPLDNLGYRRRGNNL 301

Query: 279 YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGK--VLRPGNYLKFTNEGWPIEDGA- 335
           + T  ISL EAL G         D +  RIN+ R     +  G        G PI +   
Sbjct: 302 FRTEYISLNEALYGNWERTLDFLDPKK-RINLKRSPNVTIYDGEIEILKGFGMPIPNKKN 360

Query: 336 RFGDMYVQVLIEFPK 350
           +FGD+Y+   +  PK
Sbjct: 361 KFGDLYIDYKVIIPK 375

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  108 bits (269), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 101/409 (24%), Positives = 169/409 (41%), Gaps = 56/409 (13%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M +D  LY  L I  +AS+ ++K+AYR  ALRYHPDK    +E E S+ KF++IS AY++
Sbjct: 1   MVKDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDK---NNESEESKKKFQDISEAYSI 57

Query: 59  LSDEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEEDDFEEVGRTAD 118
           L DE +R  YD++GTV                 + F   A     Q  +      G+ ++
Sbjct: 58  LRDENQRKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQ-SN 116

Query: 119 STVPLKLTTKQL-------------YLGKTFQFKARRKVLCPRCGGS----------GLR 155
           S+ P                       G  F  K+R     P    +          G R
Sbjct: 117 SSPPFGFPFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKR 176

Query: 156 KRAAARPMIRCEGCEGQGYKER--------------ISRIGPGLISRERVSCADCGGKGK 201
            +        C  C+G G  +R               +R+GP L +    +C  C G G 
Sbjct: 177 SKLRLERSKLCSICKGDGGVKRSMCNQCHGDGNITETTRLGPMLQTFTH-TCNICNGNGW 235

Query: 202 RIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEPGKE---TGDLV 258
            I   + + C+ C G     E  I  V +  G + G ++ +  + D    K     G+++
Sbjct: 236 VI--ISQETCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVIPGNVI 293

Query: 259 FVIDEQTDVSSSLERKGTDL-YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLR 317
             I+E  D        G DL Y   +I L  +L G    +    + ++++++I  G+++ 
Sbjct: 294 IHINEIEDNKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILPGEIIE 353

Query: 318 PGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNI 366
            G+     + G P   G  +G +Y+Q  +++P      EK  +++I+ I
Sbjct: 354 SGSVKGVESLGMPKNKGNEYGILYIQFQVKYP------EKLNMESIKAI 396

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  107 bits (268), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 118/454 (25%), Positives = 191/454 (42%), Gaps = 72/454 (15%)

Query: 1   MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
           M RD  LYE L +  +A+  ++K+AY++LAL+YHPDK    +  E S+ KF+ +  AY +
Sbjct: 1   MVRDTKLYETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEI 57

Query: 59  LSDEQKRAEYDQFGT-----VXXXXXXXXXXXXXXXXMNFFRYGAG-------------- 99
           L+D+Q RA YD  G      +                M F   G                
Sbjct: 58  LNDKQSRAIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNN 117

Query: 100 ---------RHGYQHEEDDFEEVGRTADSTVP--------LKLTTKQLYLGKTFQFKARR 142
                     H Y + + +       AD  +         LK T ++LY GK  +    R
Sbjct: 118 AAKQPSQSQMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNR 177

Query: 143 KVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKR 202
             LC  C G G  +R        CE C+G G++ +  R+GP ++     +CA C G G  
Sbjct: 178 TRLCLPCNGFGGLQRTT------CESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAGCF 230

Query: 203 IPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRYPGQSD-------MEPGKETG 255
           I     D C  C G+  ++E  I  V V  G Q G  +   G++D       ++     G
Sbjct: 231 IKPN--DVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPG 288

Query: 256 DLVFVIDEQTDVSSSLER-KGTDLYCT-MKISLAEALTGFTRIVTRTFDERVLRINIPRG 313
           D+V  I +  D ++  +     DL      + L  +L G    +      ++++++I  G
Sbjct: 289 DVVITIKQSRDENNCFQMINNKDLLMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIPG 348

Query: 314 KVLRPGNYLKFTNEGWP-IEDGA-----RFGDMYVQVLIEFPK----DNWFNEKAELDAI 363
           ++L+P  +      G P +EDG      R GD+Y+Q  I++P+    +     KA+L+  
Sbjct: 349 EILKPNCFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYPEQLENETMTQLKAQLNKD 408

Query: 364 RNILPGL---ADAPSTKTEDPSNTEEVRAYSIIA 394
           + +   L    +A   + +D    EE    S IA
Sbjct: 409 KYVKEDLRREKEAIDQRLDDCVEVEECVLSSFIA 442

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  106 bits (265), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 138/291 (47%), Gaps = 30/291 (10%)

Query: 109 DFEEVGRTADSTVP-----LKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPM 163
           DFE+ G    ++ P     LK     L+ GK  +    R  LC RC G G +K       
Sbjct: 150 DFEDDGSHEMASGPGIRHNLKCNLYDLFHGKRAKLALNRTRLCQRCQGYGGKKAT----- 204

Query: 164 IRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEE 223
            +C GC+G G      R+GP ++   + +C +C G GK I   + D C +C+G   ++E 
Sbjct: 205 -QCRGCQGTGLFTTTKRMGP-MVQTWQTTCKECSGTGKYI--RSKDACTECSGNGFIKER 260

Query: 224 SIISVYVPRGSQHGDRLRYPGQSD----MEPGKE---TGDLVFVI----DEQTDVSSSLE 272
               V V  G ++G+ +  PG++D     E GKE    GD++  I    +E++++     
Sbjct: 261 KFFDVEVLPGMRNGNEIILPGEADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYL 320

Query: 273 RKGTDLYC-TMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI 331
               DL     ++ L  +L G T I+         +I +  G++L+PG      N+G P+
Sbjct: 321 VHDHDLILDNFEVDLKTSLCGGTIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPV 380

Query: 332 EDGARFGDMYVQVLIEFP---KDNWFNEKAE-LDAIRNILPGLADAPSTKT 378
           +    FG++Y++  ++FP   K +  N+ +E L    NI   L+D+ + K+
Sbjct: 381 DSNGNFGNLYIRFRVKFPEQLKSDTINKLSEILVQDENISSILSDSINNKS 431

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 51/70 (72%), Gaps = 3/70 (4%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++L + ++A+EQE+K+AYR+ AL++HPDK +  +E   S   F++IS AY  LS+  K
Sbjct: 7  LYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAE---SIKLFQDISHAYETLSNSNK 63

Query: 65 RAEYDQFGTV 74
          R  YDQ+GTV
Sbjct: 64 RELYDQYGTV 73

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  106 bits (265), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 123/265 (46%), Gaps = 31/265 (11%)

Query: 97  GAGRHGYQHEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRK 156
           G GRH           + R  D    LK T K+LY+GKT +    R  +C  C G G  K
Sbjct: 172 GEGRH-----------LNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLK 220

Query: 157 RAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTG 216
           + A      C+ C+GQG + + +R+GP L+     +CADCGG G  I   + D C++C G
Sbjct: 221 KYA------CKTCKGQGVQTQTNRMGP-LVQSWSQTCADCGGAG--IFVESKDICQQCQG 271

Query: 217 KCVVQEESIISVYVPRGSQHGDRLRYPGQSD-----MEPGKET---GDLVFVIDEQTDVS 268
              V++  I+ V V  GS H   +   G+ D        G E    GD+V  I    D  
Sbjct: 272 LGFVKQRKILQVAVQPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPR 331

Query: 269 SSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEG 328
             +      +Y   K+ L  +L G    +      ++++++I  G+VL+PG +    N G
Sbjct: 332 FQIVDDYNLIYKKCKVDLMTSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMG 391

Query: 329 WP-IEDGAR--FGDMYVQVLIEFPK 350
            P   +G R  FG MYV+  + +P+
Sbjct: 392 MPKFINGVRSGFGHMYVKFEVTYPR 416

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY+ L + ++AS  E+K+AYR  AL+YHPDK    +  E S+ KF+EI  AY  L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHL 63

Query: 65 RAEYDQFGTV 74
          R+ YDQ+GT 
Sbjct: 64 RSLYDQYGTT 73

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 99.4 bits (246), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 119/253 (47%), Gaps = 24/253 (9%)

Query: 111 EEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGG-SGLRKRAAARPMIRCEGC 169
             + R  D    LK T K+LY+GKT +    R  +C  C G  GLRK         C+ C
Sbjct: 178 HHLNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRKYT-------CKPC 230

Query: 170 EGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVY 229
           +GQG + +  R+GP L+     +CADCGG G  +     D C++C G   +++  I+ V 
Sbjct: 231 KGQGIQTQTKRMGP-LVQSWSQTCADCGGAGTFVKN--KDICEQCQGLGFIKQRKILQVT 287

Query: 230 VPRGSQHGDRLRYPGQSD-----MEPGKET---GDLVFVIDEQTDVSSSLERKGTDLYC- 280
           V  GS H   +   G+ D        G+E    GD+V  I    D    +     DL C 
Sbjct: 288 VQPGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQI-TDNCDLICK 346

Query: 281 TMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWP-IEDGAR--F 337
             ++ L  +L G    +      ++++I+I  G+VL+PG +    N G P   +G R  F
Sbjct: 347 KCEVDLMTSLCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGF 406

Query: 338 GDMYVQVLIEFPK 350
           G +YV+  + +P+
Sbjct: 407 GHLYVKFDVTYPE 419

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY+ L + ++AS  E+K+AYR  AL+YHPDK    +  E S+ KF+EI  AY VL D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 65 RAEYDQFGTV 74
          R+ YDQ+GT 
Sbjct: 64 RSLYDQYGTT 73

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 128/286 (44%), Gaps = 26/286 (9%)

Query: 105 HEEDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMI 164
           +  D+   + R  D    LK T K+LY+GKT +    R  +C  C G G  K+       
Sbjct: 165 NSNDEDHHLDRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKKCT----- 219

Query: 165 RCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEES 224
            C+ C+GQG + +  R+GP L+     +CADCGG G  +     D C++C G   ++E  
Sbjct: 220 -CKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAG--VFVKNKDICQQCQGLGFIKERK 275

Query: 225 IISVYVPRGSQHGDRLRYPGQSD-----MEPGKET---GDLVFVIDEQTDVSSSLERKGT 276
           I+ V V  GS H   +   G+ D        G E    GD+V  I    D +  +     
Sbjct: 276 ILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSN 335

Query: 277 DLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWP-IEDGA 335
            +    KI    +L G    +      ++++++I  G++L+PG +    + G P   +G 
Sbjct: 336 LICKKCKIDFMTSLCGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGV 395

Query: 336 R--FGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADAPSTKTE 379
           R  FG +YV+  + +P      E+ E +  + I   LA+    K E
Sbjct: 396 RSGFGHLYVKFDVTYP------ERLEPENAKKIQNILANDKYIKAE 435

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 3/70 (4%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY+ L + ++AS  E+K+AYR  AL+YHPDK    +  E S+ KF+EI  AY +L D + 
Sbjct: 7  LYDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNRL 63

Query: 65 RAEYDQFGTV 74
          RA YDQ+GT 
Sbjct: 64 RALYDQYGTT 73

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/255 (27%), Positives = 118/255 (46%), Gaps = 21/255 (8%)

Query: 107 EDDFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRC-GGSGLRKRAAARPMIR 165
           +DD   + R  D    LK T ++LY+GKT +    R  +C  C G  GL+K         
Sbjct: 178 DDDEHHLNRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQKYT------- 230

Query: 166 CEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESI 225
           C+ C+GQG + +   +GP L+     +CADCGG G  I   + D C++C G   +++  I
Sbjct: 231 CKTCKGQGVQTQTKCMGP-LVQSWSQTCADCGGAG--IFVESKDICQQCQGLGFIKQRKI 287

Query: 226 ISVYVPRGSQHGDRLRYPGQSDMEPGKE-------TGDLVFVIDEQTDVSSSLERKGTDL 278
           + V V  G+ H   +   G+ D    K         GD+V  I    D    +    + +
Sbjct: 288 LQVTVQPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSLI 347

Query: 279 YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWP-IEDGAR- 336
           Y   K+ L  +L G    +      ++++++I  G+VL+P  +      G P   +G R 
Sbjct: 348 YKKCKVDLMTSLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRS 407

Query: 337 -FGDMYVQVLIEFPK 350
            FG +YV+  + +P+
Sbjct: 408 GFGHLYVKFDVSYPE 422

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY+ L + ++AS  E+K+AYR  ALRYHPDK    +  E S+ KF+EI  AY VL D   
Sbjct: 7  LYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 65 RAEYDQFGTV 74
          R+ YDQ+GT 
Sbjct: 64 RSLYDQYGTT 73

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 114/247 (46%), Gaps = 23/247 (9%)

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSG-LRKRAAARPMIRCEGCEGQG 173
           R  D    LK T  +LY GK  +    R+ +C  C G G LR+R        C+ C GQG
Sbjct: 161 RGPDIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRRT-------CKTCRGQG 213

Query: 174 YKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRG 233
            +    R GP ++     +C DC G G    T  AD C +C G+  ++E  I  V V +G
Sbjct: 214 QQTETRRTGP-MVQTWTQTCPDCNGLGTY--TKQADVCHECRGESYIKERKIFDVEVSKG 270

Query: 234 SQHGDRLRYPGQSD----MEPGKET---GDLVFVIDEQTDVS-SSLERKGTDLYC-TMKI 284
             HG  +  PG++D       G E    GD+V  ID+  D     + R G DL   +  I
Sbjct: 271 MCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLVMGSCSI 330

Query: 285 SLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI--EDGARFGDMYV 342
            L+ +L G    +      ++L+++I  G+++ P         G P    DG + G++Y+
Sbjct: 331 DLSTSLCGGDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGK-GNLYI 389

Query: 343 QVLIEFP 349
           Q  +E+P
Sbjct: 390 QFQLEYP 396

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 5/76 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M RD  LY+ L ++  A+  E+KRAY+ +AL+YHPDK       E ++ KF+E+  AY +
Sbjct: 1  MARDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEI 57

Query: 59 LSDEQKRAEYDQFGTV 74
          L+DE KR  YD++GTV
Sbjct: 58 LADEDKRVMYDRYGTV 73

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 108/415 (26%), Positives = 170/415 (40%), Gaps = 65/415 (15%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+ LG++  AS  ++KRAY +LA +YHPD I+ E     ++  F  +  AY +LSDE
Sbjct: 47  KDPYKTLGVSRDASPSDIKRAYYKLAKKYHPD-INKE---PGADKTFHNLQNAYEILSDE 102

Query: 63  QKRAEYDQFGTVXXXXX---------------XXXXXXXXXXXMNF---FRYGAGRHGYQ 104
           +K+ +YDQ+G+                                +NF   F    GR G++
Sbjct: 103 KKKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFR 162

Query: 105 HEEDDFEEVGRT-------ADST-VPLKLTTKQLYLG-KTFQFKARRKVLCPRCGGSGLR 155
           +  D     GR         DS  +   ++ K    G      K +    C  C GSGL 
Sbjct: 163 NGGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHGSGL- 221

Query: 156 KRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCT 215
           K         C  C G G +  + + G  + S    +C  C G+G  I     D C  C 
Sbjct: 222 KNGEQHKRKTCSYCNGTGTQVHV-KSGFQMAS----TCMHCHGEGTTI--AREDTCSACD 274

Query: 216 GKCV-VQEESIISVYVPRGSQHGDRLRYP----------GQSDMEPGKETGDLVFVIDEQ 264
           G  V +  +  ++V  P G   GD +R P          G++D       GDL+  I  +
Sbjct: 275 GDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVK 334

Query: 265 TDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKF 324
           +D    ++ K  D++   +I +  A  G T +   T D + +R+ +  G   +       
Sbjct: 335 SDPKFFVKNK-YDIWTIKEIPITTAALGGT-VEIETVDGKNIRLKVISG--TQHDQVTSI 390

Query: 325 TNEGWPIEDGARFGDMYVQ--VLIEFPKDNWFNEKAELDAIRNILPGLADAPSTK 377
            N G P  +G   G+M VQ  ++I+ P+ N           R +  GLAD  + K
Sbjct: 391 PNMGIPYRNGTGRGNMNVQYKIVIKKPQSN---------IERCLWEGLADVTNDK 436

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 83/322 (25%), Positives = 137/322 (42%), Gaps = 34/322 (10%)

Query: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGY 174
           R  D    LK   K+LY GK  +    R  LC RC G G    +       C  C GQG 
Sbjct: 151 RGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHGSMTSSV------CGECRGQGV 204

Query: 175 KERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGS 234
             +  R GP L+     SC +C G G  + +   D C+ C G   ++E  I  V +  G 
Sbjct: 205 YSQTRRHGP-LVQTWSSSCRNCSGAGTFVKSN--DVCQTCRGTGYIRERKIFEVEIKPGL 261

Query: 235 QHGDRLRYPGQSDMEP----GKET---GDLVFVIDEQTDVSSSLERKGTDLYCT-MKISL 286
            +   +  PG++D       GK+    GD++ ++ EQ         + +DL  T   + L
Sbjct: 262 SNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFRESDLVLTRCVVDL 321

Query: 287 AEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDG-ARFGDMYVQVL 345
             +L G +  +      R +++ +  G++L PG+     N G P  D  +++GD+Y++  
Sbjct: 322 RTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFC 381

Query: 346 IEFPK----DNWFNEKAELDAIRNIL--PGLADAPSTKTEDPSNTEEVRAYSIIANHTGL 399
           + FP+    +      + L +  NI+    + +  S +T +P   EE     + +N   +
Sbjct: 382 VNFPERLEPETMNVISSALASDSNIIRQENITEPSSAQTRNPDCYEE----HVFSNFNEI 437

Query: 400 PDYLDRENQGYSRQQHESTAGT 421
           PD   R      R  + S AG 
Sbjct: 438 PDLRKR------RHYNSSVAGN 453

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 95/330 (28%), Positives = 143/330 (43%), Gaps = 56/330 (16%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+ LGI S+AS+ ++K+AY +LA +YHPD     ++ E +EAKF ++  AY +LSDE
Sbjct: 46  KDPYKTLGINSNASQSDIKKAYYKLAKKYHPDI----NKEENAEAKFHDLQNAYEILSDE 101

Query: 63  QKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQ-----HEEDDFEEVGRTA 117
           QKR +YDQFG                   + F +G   + +      + ED F    +  
Sbjct: 102 QKRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNAFKQQ 161

Query: 118 DSTVPL--------KLTTKQLYLGKTFQFK----ARRKVL--------CPRCGGSGLRKR 157
            S            +     ++L     FK     ++ V         C  C GSGL+  
Sbjct: 162 HSNNTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSGLKHN 221

Query: 158 AAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGK 217
           A       C+ C G G +  I R G  ++S    +C DC G+G +I     D C  C G 
Sbjct: 222 AHKS---TCQTCNGTGTRVHI-RGGFQMMS----TCNDCNGEGTKI--DPNDYCNHCHGD 271

Query: 218 CV-VQEESIISVYVPRGSQHGDRLR------YPGQSDMEPG--------KETGDLVFVID 262
            V  +    I+V +P   Q GD +R      YP Q  M+P            GD++  I+
Sbjct: 272 GVEFKRNKEITVDLPNALQDGDVIRVSNKGSYP-QMAMDPDLINNNNVRMTRGDILIKIN 330

Query: 263 EQTDVSSSLERKGTDLYCTMKISLAEALTG 292
              D    + R   D++ TM+I +  A  G
Sbjct: 331 VINDTKFKI-RDKYDIWYTMEIPITTAALG 359

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LGI+ SA+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +LSD QK
Sbjct: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REVYDQYG 68

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 64/133 (48%), Gaps = 13/133 (9%)

Query: 222 EESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLERKGTDL 278
           E++ + + +  G + G ++ Y    D  P   TG    L F+I E+        R G DL
Sbjct: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPA--TGRRKTLQFIIQEKK--HPFFTRDGNDL 265

Query: 279 YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED--GAR 336
             T+ ++  E+L GF + + +T D R L ++  R + ++P     +  +G PI    G R
Sbjct: 266 IYTLPLTFKESLLGFNKTI-QTIDGRTLPVS--RIQPIQPSEKSTYPGQGMPIPKTPGQR 322

Query: 337 FGDMYVQVLIEFP 349
            GDM V   +++P
Sbjct: 323 -GDMIVNYKVDYP 334

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++SSAS+ E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +LSD  K
Sbjct: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNK 60

Query: 65 RAEYDQFG 72
          R+ YDQ+G
Sbjct: 61 RSVYDQYG 68

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 50/68 (73%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG+  SA+EQE+K+ YR+ AL+YHPDK + ++E      KFK+IS AY +LSD  K
Sbjct: 7  LYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSDSNK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 77/139 (55%), Gaps = 13/139 (9%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEP---GKETGDLVFVIDEQTDVSSSLE 272
           G   VQE++ I + +  G + G +L Y  + D  P   G++T  L F+IDE+     + +
Sbjct: 216 GPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKT--LQFIIDEKP--HPTFQ 271

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331
           R+  +L CT+ ++  E+L GF++ V +T D R L I+  R + ++P    ++  +G PI 
Sbjct: 272 REDDNLVCTVPLTFKESLLGFSKTV-QTIDGRNLPIS--RSQPIQPTEITRYPGQGMPIS 328

Query: 332 -EDGARFGDMYVQVLIEFP 349
            + G R GD+ V+  I +P
Sbjct: 329 KKPGQR-GDLIVKYKIAYP 346

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ SA+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D QK
Sbjct: 7  LYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 73/138 (52%), Gaps = 11/138 (7%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLE 272
           G     E++ I + +  G + G ++ Y  Q D  P  +TG    L FVI E++    + +
Sbjct: 207 GPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNP--QTGRRKTLQFVIQEKS--HPNFK 262

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331
           R G DL  T+ +S  E+L GF++ + +T D R L ++  R + ++P     +  +G P  
Sbjct: 263 RDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTP 319

Query: 332 EDGARFGDMYVQVLIEFP 349
           ++ ++ G++ V+  +++P
Sbjct: 320 KNPSQRGNLIVKYKVDYP 337

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ SA++QE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +LSD+ K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDKNK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REVYDQYG 68

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 75/138 (54%), Gaps = 11/138 (7%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEP---GKETGDLVFVIDEQTDVSSSLE 272
           G+  + E++ I + +  G + G ++ Y  Q D  P   G++T  L F++ E+       +
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKT--LQFMLQEKN--HPVFK 269

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331
           R+G DL CT+ ++  E+L GF + + +T D R L I+  R + ++P     +  +G PI 
Sbjct: 270 REGDDLTCTLPLTFKESLLGFNKQI-QTIDGRTLPIS--RTQPIQPSETSVYPGQGMPIP 326

Query: 332 EDGARFGDMYVQVLIEFP 349
           +  ++ G++ V+  I++P
Sbjct: 327 KTPSQRGNLIVRYKIDYP 344

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 98/229 (42%), Gaps = 16/229 (6%)

Query: 109 DFEEVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEG 168
           D + + R  D    LK T   LY GK  + +  R   C +C G G      +  +  C  
Sbjct: 223 DDKNLKRGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFG------SLNIKSCSK 276

Query: 169 CEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISV 228
           C G+G   +  + GP +      +C  CGG G      A D C +C G+  + E+ I  V
Sbjct: 277 CNGRGSLTQTKKFGP-MTQTFTQTCDGCGGNGTF--ADAQDICNECQGEGFLNEKKIFEV 333

Query: 229 YVPRGSQHGDRLRYPGQSD----MEPGKE---TGDLVFVIDEQTDVSSSLERKGTDLYCT 281
            +  G   G  +   G++D       GKE    GD++  I+   D +  + +    LY  
Sbjct: 334 EITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLLYAN 393

Query: 282 MKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWP 330
            KI+L  +L G +  +     E +++INI  G++++ G      N G P
Sbjct: 394 YKINLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMP 442

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++L +   + E  +K+AYR LAL+YHPDK    +  E S+  F++IS AY VLS++ K
Sbjct: 7  LYDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKDK 63

Query: 65 RAEYDQFGTV 74
          R  YD++GTV
Sbjct: 64 RQMYDKYGTV 73

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 51/68 (75%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ SA+EQE+K+ Y++ AL+YHPDK + ++E      KFKEIS AY +LSD  K
Sbjct: 7  LYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILSDSSK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 73/138 (52%), Gaps = 11/138 (7%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLE 272
           G     E++ I + +  G + G ++ Y  Q D  P  +TG    L FVI E++    + +
Sbjct: 221 GPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNP--QTGRRKTLQFVIQEKS--HPNFK 276

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331
           R G DL  T+ +S  E+L GF++ + +T D R L ++  R + ++P     +  +G P  
Sbjct: 277 RDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTP 333

Query: 332 EDGARFGDMYVQVLIEFP 349
           ++ ++ G++ V+  +++P
Sbjct: 334 KNPSQRGNLIVKYKVDYP 351

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 53/68 (77%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D+QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILNDKQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 11/138 (7%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEP---GKETGDLVFVIDEQTDVSSSLE 272
           G    QE+  I + +  G + G ++ Y    D  P   G++T  L FVI E+T      +
Sbjct: 218 GPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKT--LQFVIQEKT--HPLYK 273

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIE 332
           R G DL  T+ ++  E+L GF++ + +T D R L ++  R   ++P    ++  +G P+ 
Sbjct: 274 RNGDDLEYTLPLTFKESLLGFSKTI-QTIDGRTLPLS--RSSPVQPTETSRYPGQGMPMP 330

Query: 333 D-GARFGDMYVQVLIEFP 349
              ++ GD+ V+  I++P
Sbjct: 331 KMPSQRGDLVVRFKIDYP 348

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D QK
Sbjct: 7  LYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 69/130 (53%), Gaps = 7/130 (5%)

Query: 222 EESIISVYVPRGSQHGDRLRYPGQSDMEP-GKETGDLVFVIDEQTDVSSSLERKGTDLYC 280
           E++ I + +  G + G ++ Y  Q D  P       L FVI E++    + +R G DL  
Sbjct: 220 EKTQIDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQFVIQEKS--HPNFKRDGDDLIY 277

Query: 281 TMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI-EDGARFGD 339
           T+ +S  E+L GF++ + +T D R L ++  R + ++P     +  +G P  ++ ++ G+
Sbjct: 278 TLPLSFKESLLGFSKTI-QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQRGN 334

Query: 340 MYVQVLIEFP 349
           + V+  +++P
Sbjct: 335 LIVKYKVDYP 344

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 70/132 (53%), Gaps = 11/132 (8%)

Query: 222 EESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLERKGTDL 278
           E++ I + +  G + G ++ Y  Q D     +TG    L FVI E+     + +R G DL
Sbjct: 229 EKTQIDIQLKPGWKAGTKITYKNQGDF--NSQTGRRKTLQFVIQEKG--HPNFKRDGDDL 284

Query: 279 YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI-EDGARF 337
             T+ +S  E+L GF++ + +T D R L ++  R + ++P     +  +G P  ++ ++ 
Sbjct: 285 IYTLPLSFKESLLGFSKTI-QTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPKNPSQR 341

Query: 338 GDMYVQVLIEFP 349
           G++ V+  +++P
Sbjct: 342 GNLIVKYKVDYP 353

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (73%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ SA++QE+K+ YR+ AL+YHPDK +  +E      KFKEIS A+ +LSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTE------KFKEISEAFEILSDSNK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REVYDQYG 68

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (73%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ SA++QE+K+ YR+ AL+YHPDK +  +E      KFK+IS AY +LSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTE------KFKQISEAYEILSDSNK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REVYDQYG 68

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 8/74 (10%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D  LY++LGI+ SA E E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +
Sbjct: 1  MVKDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEI 54

Query: 59 LSDEQKRAEYDQFG 72
          LSD QKR  YD +G
Sbjct: 55 LSDAQKREVYDTYG 68

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++L ++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +LSD +K
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REVYDQYG 68

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 8/74 (10%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D  LY++LG++ SA E E+K+ YR+ AL+YHPDK S ++E      KFKEIS A+ +
Sbjct: 1  MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAE------KFKEISEAFEI 54

Query: 59 LSDEQKRAEYDQFG 72
          L+D QKR  YD +G
Sbjct: 55 LNDPQKREVYDTYG 68

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 71/138 (51%), Gaps = 11/138 (7%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLE 272
           G     E+  + + +  G + G ++ Y  + D  P   TG    L F++ E+    S+  
Sbjct: 208 GPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNP--RTGRRQTLQFILQEKP--HSNYT 263

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331
           R G DL  ++ ++  E+L GF++ + +T D R L I+  R + ++P +   +  +G PI 
Sbjct: 264 RDGNDLIYSLPLTFKESLLGFSKTI-QTIDGRTLPIS--RVQPVQPSDSSTYPGQGMPIA 320

Query: 332 EDGARFGDMYVQVLIEFP 349
           +  ++ G++ V+  I++P
Sbjct: 321 KTPSQRGNLIVKYKIDYP 338

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 50/68 (73%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++L +  +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D QK
Sbjct: 7  LYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQK 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REIYDQYG 68

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 106/241 (43%), Gaps = 34/241 (14%)

Query: 130 LYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRE 189
           ++  K    K R    C  C GSGL+  A+      C  C G G    + R G  ++S  
Sbjct: 207 VFGKKNVSIKFRALDPCGTCNGSGLKSGASK---TTCPSCHGSGTTVHV-RAGFQMMS-- 260

Query: 190 RVSCADCGGKGKRIPTTAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQS-- 246
             +C  CGG+G  +   A+D CK C G+ V V  +  I+V +P G Q GD +R PGQ   
Sbjct: 261 --TCQTCGGEGTTV--NASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSY 316

Query: 247 -DMEPGKET--------GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIV 297
            D+   KE         GD++  I    D   S++ K  D++ T +I +  A  G T + 
Sbjct: 317 PDIAVDKEMAKSVKLSRGDILVRIRVNKDPHFSIKNK-YDIWYTKEIPITTAALGGT-VS 374

Query: 298 TRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARF------GDMYVQ--VLIEFP 349
             T +   +RI +P G    P   +   N G P     R       GDM +Q  V+I  P
Sbjct: 375 IPTIEGTKIRIKVPAGTA--PEQVISIPNMGVPKSSPYRNSAVQARGDMKIQYKVVIRKP 432

Query: 350 K 350
           +
Sbjct: 433 Q 433

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 4/68 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D YE LG+  S+S+ ++K+AY +LA +YHPD I+ E+    +E KF ++  AY +LSDE
Sbjct: 46  KDPYETLGVKKSSSQSDIKKAYYKLAKKYHPD-INKEA---GAEKKFHDLQNAYEILSDE 101

Query: 63  QKRAEYDQ 70
            KR +YDQ
Sbjct: 102 SKRKQYDQ 109

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 52/74 (70%), Gaps = 8/74 (10%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D  LY++LG++ SA E E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +
Sbjct: 1  MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEI 54

Query: 59 LSDEQKRAEYDQFG 72
          L+D QKR  YD +G
Sbjct: 55 LNDPQKREIYDNYG 68

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 222 EESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLERKGTDL 278
           E+  + + +  G + G ++ Y  + D  P   TG    + F+I E+     +  R G DL
Sbjct: 211 EKQQVDIQLRPGWKAGTKITYKNEGDYNP--RTGRRQTMQFIIQEKP--HENYTRDGNDL 266

Query: 279 YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI-EDGARF 337
             T+ ++  E+L GF + + +T D R L I+  R + ++P +   +  +G P+ ++ ++ 
Sbjct: 267 IYTLPLTFKESLLGFNKTI-QTIDGRTLPIS--RVQPVQPSDVSTYPGQGMPVAKNPSQR 323

Query: 338 GDMYVQVLIEFP 349
           G++ V+  I++P
Sbjct: 324 GNLIVKYKIDYP 335

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 103/229 (44%), Gaps = 15/229 (6%)

Query: 125 LTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPG 184
           LT K  Y G +  F       C  C GSG    +    + +C  C G+G   ++ R+G  
Sbjct: 158 LTLKDYYNGGSISFSLLLNDNCDHCHGSG----SEDGKVKKCPDCGGRGVVIQVIRMG-- 211

Query: 185 LISRERVS--CADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRY 242
            I  ++V   C  C G G+ I     + CK C+G  V ++E  ISV    G +       
Sbjct: 212 -IVTQQVQQRCNRCAGSGEII----QNKCKVCSGAKVQKKEKDISVSFDSGIERNHISVQ 266

Query: 243 PGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTG-FTRIVTRTF 301
            G+++  PG E GDL+    E  + +    R+G DL+ T  ++L EA+ G ++R +    
Sbjct: 267 QGEAEKGPGIEPGDLIVEFFEVPEANMGYRRRGKDLFRTEVLTLQEAINGDWSRDIQFLD 326

Query: 302 DERVLRINIPRGKVLRPGNYLKFTNEGWPIEDG-ARFGDMYVQVLIEFP 349
             + L++      ++  G   K    G PI     +FGD+Y+  ++  P
Sbjct: 327 PTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGDLYIDYVVIKP 375

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 51/73 (69%), Gaps = 3/73 (4%)

Query: 1  MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
          + +D Y++LG++ + +E+E+K AYRQL+ ++HPDK  ++   E +  KF EI  AY VLS
Sbjct: 20 LAQDYYKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPND---EDAHNKFIEIGEAYEVLS 76

Query: 61 DEQKRAEYDQFGT 73
          D +KR  YDQFG 
Sbjct: 77 DPEKRRMYDQFGA 89

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 50/68 (73%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ +A+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D   
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNT 60

Query: 65 RAEYDQFG 72
          R  YDQ+G
Sbjct: 61 REVYDQYG 68

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 72/133 (54%), Gaps = 11/133 (8%)

Query: 221 QEESIISVYVPRGSQHGDRLRYPGQSDMEP---GKETGDLVFVIDEQTDVSSSLERKGTD 277
           QE++ I + +  G + G ++ Y  Q D  P   G++T  L FVI E+       +R G D
Sbjct: 187 QEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKT--LQFVIQEK--AHPDFKRDGDD 242

Query: 278 LYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI-EDGAR 336
           L   +++S  E+L GF++ +  T D R L ++  R + ++P     +  +G P+ ++ ++
Sbjct: 243 LIYILRLSFKESLLGFSKTIN-TIDGRKLPLS--RSQPIQPTEISTYPGQGMPVSKNPSQ 299

Query: 337 FGDMYVQVLIEFP 349
            G++ ++  I++P
Sbjct: 300 RGNLIIKYKIDYP 312

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 52/74 (70%), Gaps = 8/74 (10%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D  LY++LG++ SA E E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +
Sbjct: 1  MVKDTKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEI 54

Query: 59 LSDEQKRAEYDQFG 72
          L+D QKR  YD +G
Sbjct: 55 LNDPQKREIYDSYG 68

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 104/231 (45%), Gaps = 12/231 (5%)

Query: 124 KLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGP 183
           +++    Y G+ F++  +    C +C G+G +     R    C  C+G+G   ++ ++G 
Sbjct: 147 EVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGKVTR----CPDCQGRGVIVQVIQMGI 202

Query: 184 GLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQHGDRLRYP 243
                + V C  C G G+ I       C  C G  V + +   +V +P G+Q        
Sbjct: 203 MTQQIQHV-CDRCSGSGEIIKNP----CPHCHGHKVAKMDKEFTVKLPNGAQRNYVDIKH 257

Query: 244 GQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFD- 302
           G+++     + GDL+F   E +  +    R+G  LY T  +S+ EAL G        FD 
Sbjct: 258 GEAEKGADFDAGDLMFEFRENSMNNMGYRRRGDHLYRTEVLSVQEALKGGWERELEFFDK 317

Query: 303 ERVLRINIPRGKVLRPGNYLKFTNEGWPIED--GARFGDMYVQVLIEFPKD 351
           ++ +++     +V+  G        G PI +  G +FGD+++  +I  P++
Sbjct: 318 DKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYVILMPQE 368

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 2  TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
           +D Y++LG+   A+++E+K AYRQL+ +YHPDK   + E   +  KF E+  AY VLSD
Sbjct: 20 AQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEE---AHNKFIEVGEAYDVLSD 76

Query: 62 EQKRAEYDQFGT 73
           +KR  YDQ+G 
Sbjct: 77 SEKRNIYDQYGA 88

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ SAS+ E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +LSD  K
Sbjct: 7  LYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPNK 60

Query: 65 RAEYDQFG 72
          R  YD +G
Sbjct: 61 REVYDTYG 68

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 74/138 (53%), Gaps = 11/138 (7%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEP---GKETGDLVFVIDEQTDVSSSLE 272
           G+  + E+  I + +  G + G ++ Y  + D  P   G++T  + F+I E+       +
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQT--IQFIIQEKP--HEFFK 259

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331
           R G DL  T+ ++  E+L GF + V RT D R  +I+I + + ++P   +++  +G P+ 
Sbjct: 260 RDGNDLIYTLPLTFKESLLGFDKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQGMPLS 316

Query: 332 EDGARFGDMYVQVLIEFP 349
           ++ +  GD+ V+   ++P
Sbjct: 317 KNPSERGDLIVKYKTDYP 334

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 124/294 (42%), Gaps = 49/294 (16%)

Query: 110 FEE-VGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEG 168
           FE+ + R  D    L  T K+LY GK  +    R   C  C G G          I C  
Sbjct: 163 FEKGLSRGPDIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMG------GMNTIICNE 216

Query: 169 CEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISV 228
           C+G+G       +GP ++     +C +C G G  I + +   CK+C G+  ++E +I +V
Sbjct: 217 CQGKGINTETKMLGP-MVQSWSSTCFNCSGMGYFIDSQSG--CKECQGEGYLRERTIFTV 273

Query: 229 YVPRGSQHGDRLRYPGQSD--MEPGKET------GDLVFVIDEQTDVSSSLERKGTD--- 277
            V  G ++  ++   G++D  M  GK        GD++ VI+ Q +  S       D   
Sbjct: 274 TVKPGMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVIN-QIEGKSWKNDSNIDQGE 332

Query: 278 ---------------LYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYL 322
                          L    +I L  +L G    +      ++++++I   ++L+P    
Sbjct: 333 NKNKFHFEIINEKDLLLRNCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLK 392

Query: 323 KFTNEGWP--IED----GARF---GDMYVQVLIEFPKDNWFNEKAELDAIRNIL 367
              N G P  IED    G  +   GD+Y+Q  +++P      E   +D +R+IL
Sbjct: 393 CVENLGMPRYIEDETNNGEEYLPNGDLYIQFKVKYPTK---LENETIDKLRSIL 443

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY +L + ++A+  E+K AY++LAL+YHPDK    +  E S+ KF+EI  AY VL D+ K
Sbjct: 14 LYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKDK 70

Query: 65 RAEYDQFGTV 74
          +  YD +GT+
Sbjct: 71 KLLYDTYGTL 80

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 53/72 (73%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYAVLS 60
           D YE+LGI+SSAS++++K AYR+L+L++HPDK+     E++RE  EA++ +I+ AY  L+
Sbjct: 121 DPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLT 180

Query: 61  DEQKRAEYDQFG 72
           DE  R  Y  +G
Sbjct: 181 DELIRFNYLTYG 192

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 4/69 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           RD YE LG+A  AS  ++K+AY +LA ++HPD   D    E +E KF ++  AY +LSDE
Sbjct: 40  RDPYETLGVAKDASASQIKKAYYKLAKQFHPDINKD----EGAEKKFHDLQNAYEILSDE 95

Query: 63  QKRAEYDQF 71
            KR +YDQF
Sbjct: 96  NKRRQYDQF 104

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 98/262 (37%), Gaps = 51/262 (19%)

Query: 133 GKTFQFKARRKVLCPRCGGSG--LRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRER 190
           G   +  A+R V C  C G+G  +  RA  +    C  C G+GY  R             
Sbjct: 208 GSGLKAGAQRSV-CGGCHGTGTQVHVRAGFQMASTCSQCSGEGYSIR------------- 253

Query: 191 VSCADCGGKGKRIPTTAADNCKKCTGKCVV-QEESIISVYVPRGSQHGDRLRYPGQSD-- 247
                             D C  C+G+ VV      + +  P G Q GD ++ PGQ    
Sbjct: 254 ----------------RGDRCGTCSGEGVVFNRNKEVKMDFPHGLQDGDVVKVPGQGSFP 297

Query: 248 ---MEPGK------ETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVT 298
              ++P          GDL+  +  + D    + +   D++   +I +  A  G T +  
Sbjct: 298 HIQVDPKTAHTMRLRRGDLLVQVQVERDPRFQI-KNNYDIWYVQEIPITTAALGGT-VSI 355

Query: 299 RTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKA 358
            T D   +R+ +  G   +P   +   N+G P       GDM VQ  I   K     EK 
Sbjct: 356 PTVDGDQIRLKVIPG--TQPDQVVSIPNKGVPRGLSGARGDMKVQYRIVMKKPQSKAEKF 413

Query: 359 ELDAIRNILPGLADAPSTKTED 380
             +A+ ++     D  + +TE+
Sbjct: 414 LWEALADV---TGDKTARRTEN 432

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 113/253 (44%), Gaps = 30/253 (11%)

Query: 146 CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPT 205
           C  C GSGL+K A +     C  C G G    + R G  + S    +C  CGG+G  +  
Sbjct: 202 CGVCHGSGLKKNAQSS---TCPSCHGTGTTVHV-RGGFQMAS----TCNQCGGEGTTV-- 251

Query: 206 TAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQSD-----MEPGKET----- 254
              D C KC G+ V +  +  ISV +P+G Q GD +R PGQ       ++P  +      
Sbjct: 252 RPEDVCSKCHGEGVELNSQRSISVDLPQGLQDGDVVRVPGQGSYPHLAVDPKMKNSVKLH 311

Query: 255 -GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRG 313
            GD++  I    D   S+  K TD++ T +I +  A  G  ++   T D+  +R+ +  G
Sbjct: 312 RGDVLVRIRVDKDSRFSIRNK-TDIWFTKEIPITTAALG-GQVTIPTVDDTQIRLKVQPG 369

Query: 314 KVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADA 373
              +    +   N G P   G R G M VQ  I   K     EK   +A+ ++     D 
Sbjct: 370 --TQHDQVISIPNMGVPRIGGER-GAMKVQYKIVIKKPQSKAEKCLWEALADV---TNDQ 423

Query: 374 PSTKTEDPSNTEE 386
            + +TE  S++ E
Sbjct: 424 AARRTETTSHSPE 436

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 4/70 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D YE LG+  +AS  E+K+AY +LA ++HPD I+ E     +EAKF ++  AY +LSD+
Sbjct: 35  KDPYETLGVGKNASSSEIKKAYYKLAKKFHPD-INKEPN---AEAKFHDLQNAYEILSDD 90

Query: 63  QKRAEYDQFG 72
            K+ +YDQFG
Sbjct: 91  TKKQQYDQFG 100

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YEVL I   AS+ E+K+AYR+LA++ HPDK        ASEA FK I+ A+ VLSDEQK
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDK---NKHPRASEA-FKRINRAFEVLSDEQK 78

Query: 65 RAEYDQFG 72
          R  +DQ G
Sbjct: 79 RRIFDQVG 86

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/64 (60%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ S AS+ E+K+AYR+ AL+YHPDK  D  E EA+E KF  I AAY VLSD Q+R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVE-EATE-KFAIIRAAYEVLSDSQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 123/261 (47%), Gaps = 30/261 (11%)

Query: 121 VPLKLTTKQLYLGKTFQFKARRKVL--CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERI 178
           V   ++ K    GK+   K +  V   C  C GSG++K A+     +C GC+G G K  +
Sbjct: 188 VSYNMSFKDAVFGKS-GVKLKFNVFDPCDTCSGSGIKKGASRH---QCPGCQGSGTKIHV 243

Query: 179 SRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCV-VQEESIISVYVPRGSQHG 237
            R G  ++S    +C +C G+G  +   ++D C  C G+ V       I+V +P G Q G
Sbjct: 244 -RGGFQMMS----TCNECQGEGTTV--NSSDLCGACHGEGVHFHRGKEITVDLPHGLQDG 296

Query: 238 DRLRYPGQSD-----MEPG-----KET-GDLVFVIDEQTDVSSSLERKGTDLYCTMKISL 286
           D +R PGQ       ++P      K T GD++  +  + D + ++  K +D++ TM+I +
Sbjct: 297 DVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVRVEEDPTFTIRDK-SDIWYTMEIPI 355

Query: 287 AEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARF-GDMYVQVL 345
             A  G T +   T D   +R+ +  G   + G+ +   N G P  +  R  G M VQ  
Sbjct: 356 TTAALGGT-VQVPTVDGSHIRLKVAPG--TQSGDVITVPNMGVPRSNLTRSRGAMKVQYR 412

Query: 346 IEFPKDNWFNEKAELDAIRNI 366
           I   K +   EK   +A+ ++
Sbjct: 413 IVIKKPSSEVEKCLWEALADV 433

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 4/68 (5%)

Query: 3  RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
          +D Y VLG+ SSAS+ E+K+AY +LA +YHPD I+ E+    +E KF ++  AY +LSDE
Sbjct: 34 KDPYGVLGVKSSASQGEIKKAYYKLAKQYHPD-INKEA---GAEKKFHDLQNAYEILSDE 89

Query: 63 QKRAEYDQ 70
           KR ++DQ
Sbjct: 90 SKRKQFDQ 97

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 51/72 (70%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISD---ESEREASEAKFKEISAAYAVLS 60
           D Y++LGI+SSASE+E+K AYR+L++++HPDK++    E ER   E  + +I+ AY  L+
Sbjct: 119 DPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALT 178

Query: 61  DEQKRAEYDQFG 72
           DE  R  + ++G
Sbjct: 179 DELTRQNFLKYG 190

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 51/72 (70%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYAVLS 60
           D YE+LGI++SASE+++K AYR+L++++HPDK+S    E ER   E  + +I+ AY  L+
Sbjct: 129 DPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALT 188

Query: 61  DEQKRAEYDQFG 72
           DE  R  + ++G
Sbjct: 189 DEAMRENFLKYG 200

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (68%), Gaps = 5/74 (6%)

Query: 1  MTRDL--YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +DL  Y+VLG++  AS  E+K+AYR+ A+  HPDK  D+ +   ++AKF+ +  AY V
Sbjct: 1  MVKDLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPD---AQAKFQRVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSDE+ R  YD+FG
Sbjct: 58 LSDEELRKRYDEFG 71

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 49/67 (73%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++L ++  AS QE+K++YR+LA++ HPDK  D+ +   ++ KF+E++ AY VL D+  R
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQ---AQTKFQELAKAYQVLIDDDLR 64

Query: 66 AEYDQFG 72
           +YDQFG
Sbjct: 65 KKYDQFG 71

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ S AS+ E+K+AYR+ AL+YHPDK  D  E EA++ KF  I AAY VLSD Q+R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVE-EATQ-KFAIIRAAYEVLSDSQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y+VLG++ +A+  E+K+AYR+ A++ HPDK  D+ E   +E KF+ +  AY V
Sbjct: 1  MVKDTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPE---AETKFQAVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD + R+ YDQFG
Sbjct: 58 LSDTELRSRYDQFG 71

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 2/71 (2%)

Query: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS--DESEREASEAKFKEISAAYAV 58
             +D Y++LGI+  A+ +++++AY QL  RYHPDK     ESE++ +  K  EI+ AY  
Sbjct: 556 FNKDYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYET 615

Query: 59  LSDEQKRAEYD 69
           LSDE K++EYD
Sbjct: 616 LSDEAKKSEYD 626

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 49/68 (72%), Gaps = 6/68 (8%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
          LY++LG++ + ++ E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D  K
Sbjct: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNK 60

Query: 65 RAEYDQFG 72
          R  YD++G
Sbjct: 61 REVYDKYG 68

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 74/138 (53%), Gaps = 11/138 (7%)

Query: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEP---GKETGDLVFVIDEQTDVSSSLE 272
           G   + E+  I + +  G + G ++ Y  + D  P   G++T  L F+I E+  +   L+
Sbjct: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQT--LQFIIQEK--MHDFLK 257

Query: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331
           R G DL  T+ +S  E+L GF++ V  T D R  +I I + + ++P    ++  +G P+ 
Sbjct: 258 RDGNDLTYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMPLS 314

Query: 332 EDGARFGDMYVQVLIEFP 349
           ++ +  GD+ V+  I++P
Sbjct: 315 KNPSERGDLIVKYKIDYP 332

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ S AS+ E+K+AYR+ AL+YHPDK  D  + EA+E KF  I AAY VLSD Q+R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQ-EATE-KFAIIRAAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YEVL I  SAS+ E+K++YR+LA++ HPDK        ASEA FK I+ A+ VLSDE+K
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDK---NPHPRASEA-FKVINRAFEVLSDEEK 80

Query: 65 RAEYDQFG 72
          R  YD+ G
Sbjct: 81 RRLYDRLG 88

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 4  DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
          + YE+L +  SASE ++K+AYR+LA++ HPDK        ASEA FK+I+ A+ VLSD+ 
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDK---NRHPRASEA-FKKINRAFEVLSDDS 77

Query: 64 KRAEYDQFG 72
          KR  +DQ G
Sbjct: 78 KRRIFDQLG 86

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 51/72 (70%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYAVLS 60
           D YE+LG+  S++++E+K AYR+L++++HPDK+S   +E ER A E +F  I+ AY  L+
Sbjct: 111 DPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALT 170

Query: 61  DEQKRAEYDQFG 72
           DE  +  Y ++G
Sbjct: 171 DEITKENYRKYG 182

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ + AS+ E+K+AYR+ AL+YHPDK  D  E EA++ KF  I AAY VLSD Q+R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNVE-EATQ-KFAVIRAAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YE+L +  +++E E+K+AYR+LA+R HPDK       +ASEA FK I+ A+ VLSD +K
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDK---NPHPKASEA-FKIINRAFEVLSDNEK 77

Query: 65 RAEYDQFG 72
          R  +DQ G
Sbjct: 78 RRIFDQLG 85

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+L I S A+++E+K+AYR   L  HPDK++  +    +     +I  AY +LS+ QKR
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 66 AEYDQ 70
           EYD+
Sbjct: 70 GEYDK 74

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 77/160 (48%), Gaps = 31/160 (19%)

Query: 6   YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
           YE+LG+  +AS+ E+K+AYR+ AL++HPDK  D  + EA+E  F  I AAY VLSD Q+R
Sbjct: 6   YELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVD-EATE-NFATIRAAYEVLSDPQER 63

Query: 66  AEYDQFGTVXXXXXXXXXXXXXXXXMNFFRYGAGRHGYQHEED---DFEEVGRTADSTV- 121
           A YD                     +N    G    GY  +ED   D    G T D  + 
Sbjct: 64  AWYD---------------AHKEQILNDSPIGTAEDGYYDDEDHVVDSTVTGVTTDELLM 108

Query: 122 --PLKLTTKQ------LY--LGKTFQFKARRKVLCPRCGG 151
              L L TK       LY   GK F   A+ +V+C R  G
Sbjct: 109 FFNLSLYTKVNDSPAGLYQIAGKIFSKLAKDEVMCGRRLG 148

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 51/72 (70%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISD---ESEREASEAKFKEISAAYAVLS 60
           D YE+LGI+SSAS++++K AYR+L++++HPDK++      E++  E  + +I+ AY  L+
Sbjct: 125 DPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLT 184

Query: 61  DEQKRAEYDQFG 72
           DE  R  Y ++G
Sbjct: 185 DELVRQNYLKYG 196

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 51/74 (68%), Gaps = 5/74 (6%)

Query: 1  MTRDL--YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D+  Y+VLGI   A+  E+K+AYR+ A++ HPDK  D+ +   +++KF+ +  AY V
Sbjct: 1  MVKDMEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPD---AQSKFQAVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD Q ++ YDQFG
Sbjct: 58 LSDPQLKSRYDQFG 71

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y+VLG+  +A+  E+K+AYR+ A++ HPDK  D+ E   ++AKF+E+  AY V
Sbjct: 1  MVKDTGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPE---AQAKFQEVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD   R+ YD+FG
Sbjct: 58 LSDPGLRSRYDEFG 71

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 52/72 (72%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYAVLS 60
           D YE+LGI+ SAS++++K AYR+L++++HPDK+S    + ER + E K+ +I+ AY  L+
Sbjct: 121 DPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALT 180

Query: 61  DEQKRAEYDQFG 72
           DE  +  + ++G
Sbjct: 181 DEVIKENFLKYG 192

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 51/70 (72%), Gaps = 4/70 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDK---ISDESEREASEAKFKEISAAYAVL 59
           +D Y++LG+  SA+ ++V+R+Y QL  ++HPDK   ++DE +R+ +E K  EI+ AY +L
Sbjct: 527 KDYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDE-QRQKNEEKMAEINEAYEIL 585

Query: 60  SDEQKRAEYD 69
           SD+ KR +YD
Sbjct: 586 SDDDKRTKYD 595

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 49/64 (76%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG++S+A + E+K+A+R+ AL+YHPDK  D  E EA+E  F +I AAY VL+D Q+R
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVE-EATET-FAQIRAAYEVLNDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 48/74 (64%), Gaps = 3/74 (4%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYAV 58
           T D YE+LG+  S++E+E+K+AYR L+L++HPDK+     E ER + E  F +IS AY  
Sbjct: 119 TFDPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEA 178

Query: 59  LSDEQKRAEYDQFG 72
           L++   +  Y  +G
Sbjct: 179 LTNPATKENYLLYG 192

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 4/69 (5%)

Query: 4  DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
          + YE+L +   AS+ E+K+AYR+LA+R HPDK    +   ASEA FK I+ A+ VLSD  
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDK---NTHPRASEA-FKRINRAFEVLSDVG 79

Query: 64 KRAEYDQFG 72
          KR  +DQ G
Sbjct: 80 KRRMFDQLG 88

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 63.2 bits (152), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 49/69 (71%), Gaps = 4/69 (5%)

Query: 4  DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
          + YE+L +   A++ E+K+AYR+LA++ HPDK    S   ASEA FK I+ A+ VLS+E+
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDK---NSHPRASEA-FKVINRAFEVLSNEE 76

Query: 64 KRAEYDQFG 72
          KR+ YD+ G
Sbjct: 77 KRSIYDRIG 85

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 50/74 (67%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y+VLGI+  A+  E+K+AYR++A+  HPDK  D+ E   ++AKF+ +  AY V
Sbjct: 1  MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPE---AQAKFQAVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          L+D   R +YD+FG
Sbjct: 58 LNDPALRKQYDEFG 71

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 63.5 bits (153), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YE+L I   AS+ +VK+AYR+LA++ HPDK        A+EA FK+I+ A+ VLSDE K
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDK---NRHPRAAEA-FKKINRAFEVLSDENK 80

Query: 65 RAEYDQFG 72
          R  YDQ G
Sbjct: 81 RKVYDQIG 88

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI  +A++ E+K+AYR+ +++ HPDK  + ++  A+E +F++IS AY VLSDE  R
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQQISEAYQVLSDEHLR 64

Query: 66 AEYDQFG 72
            YDQFG
Sbjct: 65 NNYDQFG 71

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 49/70 (70%), Gaps = 4/70 (5%)

Query: 3  RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           + YE+L +   A++ E+K+AYR+LA++ HPDK    S  +A EA FK I+ A+ VLS+E
Sbjct: 20 HEFYEILKVDRKATDSEIKKAYRKLAIKLHPDK---NSHPKAGEA-FKVINRAFEVLSNE 75

Query: 63 QKRAEYDQFG 72
          +KR+ YD+ G
Sbjct: 76 EKRSIYDRIG 85

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y++LGI   AS  E+K+AYR+ A+  HPDK  D+ E   ++AKF+ I  AY V
Sbjct: 1  MVKDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPE---AQAKFQAIGQAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD + R+ YD+FG
Sbjct: 58 LSDPELRSRYDEFG 71

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 109/256 (42%), Gaps = 28/256 (10%)

Query: 124 KLTTKQLYLG-KTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIG 182
           K++ K    G K  Q +      C  C G+G++        + C  C G G    I R G
Sbjct: 207 KVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHK---VSCSTCHGTGTTVHI-RGG 262

Query: 183 PGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLR 241
             ++S    +C  C G+G        DNC KC G+ V V     I+V +P G Q GD +R
Sbjct: 263 FQMMS----TCPTCNGEGTM--KRPQDNCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVR 316

Query: 242 YPGQ---------SDMEPGKET--GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEAL 290
            PGQ         +D++   +   GD++  I    D + S++ K  D++   +I +  A 
Sbjct: 317 IPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVDKDPNFSIKNK-YDIWYDKEIPITTAA 375

Query: 291 TGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPK 350
            G T +   T + + +RI +  G   +    +   N G P     R GDM VQ  I   K
Sbjct: 376 LGGT-VTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVPKTSTIR-GDMKVQYKIVVKK 431

Query: 351 DNWFNEKAELDAIRNI 366
                EK   +A+ ++
Sbjct: 432 PQSLAEKCLWEALADV 447

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+ LG+  SA+  E+K+AY +LA +YHPD I+ E +   +E KF ++  AY +LSDE
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEPD---AEKKFHDLQNAYEILSDE 115

Query: 63  QKRAEYDQ 70
            KR +YDQ
Sbjct: 116 TKRQQYDQ 123

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 52/74 (70%), Gaps = 5/74 (6%)

Query: 1  MTRDL--YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y+VLG+   A+ +++K+AYR+ A++ HPDK  ++ E   ++AKF+E+S AY V
Sbjct: 1  MVKDTKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPE---AQAKFQEVSKAYKV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD + R+ YD+ G
Sbjct: 58 LSDGELRSRYDEVG 71

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ S AS+ E+K+AYR+ AL+YHPDK  +  E EA++A F  I  AY VLSD Q+R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNVE-EATQA-FATIRLAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISD---ESEREASEAKFKEISAAYAVLS 60
           D YE+LGI++SAS++++K AYR+L++++HPDK++      E+   E  + +I+ AY  L+
Sbjct: 125 DPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESLT 184

Query: 61  DEQKRAEYDQFG 72
           DE  R  Y ++G
Sbjct: 185 DELVRQNYLKYG 196

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 7/75 (9%)

Query: 1  MTRD---LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYA 57
          ++RD    YEVL +  +AS+ E+K+AYR+LA++ HPDK       EA    FK I+ A+ 
Sbjct: 17 LSRDKSEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEA----FKVINRAFE 72

Query: 58 VLSDEQKRAEYDQFG 72
          VL DE KR  +DQ G
Sbjct: 73 VLGDEDKRRLFDQLG 87

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISD---ESEREASEAKFKEISAAYAVLS 60
           D Y++LG++ +AS++E+K AYR+L+L++HPDK++    E E+ + E  + +IS AY  L+
Sbjct: 120 DPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALT 179

Query: 61  DEQKRAEYDQFG 72
           DE  +  Y  +G
Sbjct: 180 DELVKQNYLMYG 191

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 47/72 (65%), Gaps = 4/72 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDK---ISDESEREASEAKFKEISAAYAVL 59
           ++ Y++LGI + A+ ++++RAY  L  +YHPDK   +SD +ER   E K   I+ AY VL
Sbjct: 508 KNYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSD-AERAKVEEKMSSINEAYEVL 566

Query: 60  SDEQKRAEYDQF 71
           SDE KR EYD  
Sbjct: 567 SDESKRKEYDML 578

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDE---SEREASEAKFKEISAAYAVLS 60
           D Y++LGI+ SAS++++K AYR+L+L++HPDK+S E    ER A E  + +IS A+  L+
Sbjct: 125 DPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALT 184

Query: 61  DEQKRAEYDQFG 72
           D   R  Y ++G
Sbjct: 185 DPIVRENYLKYG 196

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISD---ESEREASEAKFKEISAAYAVLS 60
           D YE+LGI++SAS++++K AYR+L++++HPDK++      E+   E  + +I+ AY  L+
Sbjct: 125 DPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLT 184

Query: 61  DEQKRAEYDQFG 72
           DE  R  Y ++G
Sbjct: 185 DELVRQNYLKYG 196

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 49/74 (66%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y+ LGI+ +A+  E+K+AYR+ A+  HPDK  D+ E   +E KF+ +  AY V
Sbjct: 1  MVKDTEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPE---AENKFQAVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSDE  RA YD++G
Sbjct: 58 LSDESLRARYDEYG 71

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESERE--ASEAKFKEISAAYAVLS 60
           +D Y++L +  +A+ +++++AY QL  +YHPDK    SE E  A+E K   I+ AY +LS
Sbjct: 506 KDYYKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILS 565

Query: 61  DEQKRAEYD 69
           DE KR EYD
Sbjct: 566 DESKRKEYD 574

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+L ++  AS+ E+K+AYR+ AL+YHPDK + E+  EA+ A F EI AAY VLSD Q+R
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDK-NRENPEEAT-AIFSEIRAAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 49/70 (70%), Gaps = 4/70 (5%)

Query: 3  RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           + YE+L +   A++ ++K+AYR+LA++ HPDK    S  +A EA FK I+ A+ VLS+E
Sbjct: 20 HEFYEILKVDRKATDSDIKKAYRKLAIKLHPDK---NSHPKAGEA-FKVINRAFEVLSNE 75

Query: 63 QKRAEYDQFG 72
          +KR+ YD+ G
Sbjct: 76 EKRSIYDRIG 85

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y++LGI  SA+  E+K+AYR+ A+  HPDK  D+ +   +++KF+ +  AY V
Sbjct: 1  MVKDTEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPD---AQSKFQSVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD+  R  YD+FG
Sbjct: 58 LSDDDLRKRYDEFG 71

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 42/61 (68%), Gaps = 4/61 (6%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YEVL +   AS+ E+K+AYR+LA++ HPDK        ASEA FK I+ A+ VLSDEQK
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDK---NKHPRASEA-FKRINRAFEVLSDEQK 78

Query: 65 R 65
          R
Sbjct: 79 R 79

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YE+L +  +A++ E+K+AYR+LA++ HPDK       +ASEA FK I+ A+ VLSD +K
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDK---NPHPKASEA-FKIINRAFEVLSDVEK 78

Query: 65 RAEYDQFG 72
          R  YD+ G
Sbjct: 79 RQLYDRIG 86

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEA--KFKEISAAYAVLS 60
           RD Y++LG+  +A+ ++++RAY     +YHPDK    SE+E S+   K  +I+ AY  LS
Sbjct: 493 RDYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLS 552

Query: 61  DEQKRAEYDQ 70
           D+ +R EYDQ
Sbjct: 553 DDTRRKEYDQ 562

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREASEAKFKEISAAYAVLS 60
           +D Y++LG++ SAS +E+++AY  L  +YHPDKI  +   ++E+      +I+ AY  LS
Sbjct: 537 KDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLS 596

Query: 61  DEQKRAEYD 69
           D+ KR EYD
Sbjct: 597 DDDKRKEYD 605

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISD---ESEREASEAKFKEISAAYAVLS 60
           D YE+LG+++SAS++++K AYR+L++++HPDK++      E+   E  + +I+ AY  L+
Sbjct: 125 DPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLT 184

Query: 61  DEQKRAEYDQFG 72
           DE  R  Y ++G
Sbjct: 185 DELVRQNYLKYG 196

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 53/67 (79%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI+++A++ E+K+AYR+ +++ HPDK  + ++  A+E +F+ IS AY VLSD+Q R
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDK--NPNDPSATE-RFQAISEAYQVLSDKQLR 64

Query: 66 AEYDQFG 72
          + YD++G
Sbjct: 65 SNYDKYG 71

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+L I S A+++E+KRAYR   L  HPDK++  +    S     +I  AY +LSD + R
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 66 AEYDQF 71
           EYD+ 
Sbjct: 70 CEYDRL 75

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (68%), Gaps = 4/70 (5%)

Query: 3  RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           + Y++L +   A++ E+K+AYR+LA++ HPDK       +ASEA FK I+ A+ VLS+E
Sbjct: 20 HEFYQILKVDKKATDGEIKKAYRKLAIKLHPDK---NPHPKASEA-FKIINRAFEVLSNE 75

Query: 63 QKRAEYDQFG 72
          +KR  YD+ G
Sbjct: 76 EKRGLYDRIG 85

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 103/249 (41%), Gaps = 27/249 (10%)

Query: 130 LYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRE 189
           ++  K  Q K      C  C G+G++        + C  C G G    + R G  ++S  
Sbjct: 218 VFGAKNVQLKFSALDPCGTCSGTGMKPNTHK---VSCTTCHGSGSTVHV-RGGFQMMS-- 271

Query: 190 RVSCADCGGKGKRIPTTAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQ--- 245
             +C  C G+G        DNC  C G+ V       I+V +P G Q GD +R PGQ   
Sbjct: 272 --TCPTCNGEGTM--KRPQDNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSY 327

Query: 246 ------SDMEPGKET--GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIV 297
                 +D++   +   GD++  I    D S S+  K  D++   +I +  A  G T I 
Sbjct: 328 PDIAVEADLQDSIKLSRGDILVRIRVDKDPSFSIRNK-YDIWYDKEIPITTAALGGT-IT 385

Query: 298 TRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEK 357
             T D + +RI +  G   +    +   N G P     R GDM VQ  I   K     EK
Sbjct: 386 IPTVDGQKIRIKVAPG--TQYNQVISIPNMGVPRTATLR-GDMKVQYKIVVKKPQSLAEK 442

Query: 358 AELDAIRNI 366
              +A+ ++
Sbjct: 443 CLWEALADV 451

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+ LG+  SA+  E+K+AY +LA +YHPD I+ E +   +E KF ++  AY +LSD+
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEPD---AEKKFHDLQNAYEILSDD 115

Query: 63  QKRAEYDQ 70
            KR ++DQ
Sbjct: 116 TKRQQFDQ 123

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (67%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y+VLG+   A+  ++K+AYR+ A++ HPDK  D+ E   +++KF+ +  AY V
Sbjct: 1  MVKDTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPE---AQSKFQAVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD   R++YDQFG
Sbjct: 58 LSDPGLRSKYDQFG 71

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++L + S A++ ++KRAYR+ AL YHPDK  +  E EA+E  F +I AAY VLSD Q+R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIE-EATEV-FAQIRAAYEVLSDAQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ S AS+ E+K+AYR+ AL+YHPDK   + E EA+E  F  I  AY VLSD Q+R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVE-EATEI-FATIRTAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREASEAKFKEISAAYAVLS 60
           +D Y++LG++ +A+ +E+++AY  L  +YHPDKI  +   ++E+      +I+ AY  LS
Sbjct: 541 KDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLS 600

Query: 61  DEQKRAEYD 69
           DE KR EYD
Sbjct: 601 DEDKRKEYD 609

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 53/67 (79%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG++++AS  E+K+AYR+ +++ HPDK  + ++ +A+E +F+ IS AY VL D++ R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDLKATE-RFQAISEAYQVLGDDELR 64

Query: 66 AEYDQFG 72
          A+YD+FG
Sbjct: 65 AKYDKFG 71

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 111/273 (40%), Gaps = 30/273 (10%)

Query: 121 VPLKLTTKQLYLG-KTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKERIS 179
           VP  ++ K    G K  + K      C  C GSGL K  A R    C  C G G +  + 
Sbjct: 193 VPFNVSFKDAVFGLKGIKLKYSAYDQCGTCAGSGL-KSGAKRS--SCSICHGTGTQMHV- 248

Query: 180 RIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVV-QEESIISVYVPRGSQHGD 238
           R G  + S    +C  C G+G  I    +D C  C G+ VV   +  I V +P G Q GD
Sbjct: 249 RAGFQMAS----TCTQCNGEGSSI--RRSDQCSSCRGEGVVFNRQKEIDVDLPHGLQDGD 302

Query: 239 RLRYPGQS---------DMEPGKET--GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLA 287
            ++ P Q          +M     T  GDL+  I  + D    + R   D++ T  I + 
Sbjct: 303 VVKVPSQGSFPHVQVDPEMSHTIRTRRGDLLIQIRVERDPRFQI-RNNYDIWYTQDIPIT 361

Query: 288 EALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIE 347
            A  G   +   T D   LR+ I  G   +    +   N+G P    A  GDM VQ  I 
Sbjct: 362 TAALGGV-VNIPTVDGEQLRLKIAPG--TQHEQVVSVPNKGVPKGLTASRGDMKVQYKIS 418

Query: 348 FPKDNWFNEKAELDAIRNILPGLADAPSTKTED 380
             K     EK   +A+ ++     D  + +TE+
Sbjct: 419 LRKPQSKAEKYLWEALADV---TGDNTAKRTEN 448

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 48/72 (66%), Gaps = 4/72 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           RD YE LG++  AS  ++K+AY +LA +YHPD   D    E +E KF ++  AY +LSDE
Sbjct: 50  RDPYETLGVSRDASTSQIKKAYYKLAKKYHPDINKD----EGAEKKFHDLQNAYEILSDE 105

Query: 63  QKRAEYDQFGTV 74
            KR++YDQFG  
Sbjct: 106 SKRSQYDQFGAA 117

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEA--KFKEISAAYAVLS 60
           +D Y+VLGI+ +AS +E+++AY  L  +YHPDK    SE+E  +   K  +++ AY +LS
Sbjct: 521 KDYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILS 580

Query: 61  DEQKRAEYDQ 70
           DE K+ +YD 
Sbjct: 581 DEGKKRDYDN 590

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 4/70 (5%)

Query: 3  RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           D Y VL +  S+ E E+K++YR+LA++ HPDK       +ASEA FK I+ A+ VLSD 
Sbjct: 21 HDFYNVLKVERSSDETEIKKSYRKLAIKLHPDK---NPHPKASEA-FKVINRAFEVLSDN 76

Query: 63 QKRAEYDQFG 72
          +KR  +D+ G
Sbjct: 77 EKREIFDRIG 86

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ ++A++ E+K+AYR+ AL++HPDK  D  E   + A F  + AAY VL+D Q+R
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDKNPDNVEE--TTAIFASVRAAYEVLADPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ ++AS+ ++K+AYR+ AL YHPDK  D  E EA+ A F  I AAY VL+D Q+R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNVE-EAT-AIFATIRAAYEVLADPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+  +A++ E+K+AYR+ AL++HPDK  D  E EA+E  F  I +AY VLSD Q+R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPDNVE-EATEI-FATIRSAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           Y++L +  S+S+ ++K+AYR+LA++ HPDK       EA    FK I+ A+ VLSD QK
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHEA----FKLINRAFEVLSDSQK 77

Query: 65 RAEYDQFG 72
          R  YDQ G
Sbjct: 78 RQIYDQIG 85

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI   A+  E+K+AYR+ A+  HPDK  D+ +   ++AKF+ +  AY VLSD+  R
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDQGLR 64

Query: 66 AEYDQFG 72
          ++YD+FG
Sbjct: 65 SKYDEFG 71

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI   A+  E+K+AYR+ A+  HPDK  D+ +   ++AKF+ +  AY VLSD   R
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 66 AEYDQFG 72
          ++YDQFG
Sbjct: 65 SKYDQFG 71

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYAVLS 60
           D YE+LGI +SA+E+EV+ +YR+L++++HPDK+S    + ER   E ++  I+ AY  L+
Sbjct: 115 DPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALT 174

Query: 61  DEQKRAEYDQFG 72
           +E  R  Y ++G
Sbjct: 175 EEVTRENYLKYG 186

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 109/423 (25%), Positives = 168/423 (39%), Gaps = 61/423 (14%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVL--S 60
           +D Y+ LG+  SAS  E+K+AY +LA +YHPD     ++ + +  KF ++  AY +L  +
Sbjct: 32  KDPYDTLGVGKSASPSEIKKAYYKLAKKYHPDI----NKEQGAGDKFHDLQNAYEILSDA 87

Query: 61  DEQKRAEYDQFGTVXXXXXXXXXXXXXXXXMNFFRY-GAGRHGYQHEED----------- 108
           D++ + +                         F  + G G  G  + ED           
Sbjct: 88  DKKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFGGINFEDLFGAAFGGGGG 147

Query: 109 -----------DFEEVGRTADSTVPLKLTTKQLYLG-KTFQFKARRKVLCPRCGGSGLRK 156
                       F E  R     V  ++  K    G K    K R    C  C GSG++ 
Sbjct: 148 RSSRGSPFGSSMFREY-RGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMK- 205

Query: 157 RAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTG 216
              A+P   C  C G G    + R G  + +    +C  CGG+G    T   D C  C G
Sbjct: 206 -TGAKPQ-SCPSCHGTGTTVHV-RAGFQMAT----TCQQCGGEGTT--TKREDLCGSCHG 256

Query: 217 KCV-VQEESIISVYVPRGSQHGDRLRYPGQS---DMEPGKET--------GDLVFVIDEQ 264
             V   ++  + V +P+G Q GD +R PGQ    +M    E         GD++  I   
Sbjct: 257 DGVEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDVLVRIRVD 316

Query: 265 TDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKF 324
            D   S+ R   D++    I +  A  G T +   T D   +R+ +  G   +    +  
Sbjct: 317 KDPRFSI-RDKWDIWFIQDIPITTAALGGT-VQVPTVDGSHVRLRVQPG--TQHDQIISI 372

Query: 325 TNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADAPSTKTEDPSNT 384
            N G P   G R G M VQ  I+  K     E+   +A+ NI     D+ + +TE+   T
Sbjct: 373 PNMGVPRVAGTR-GSMKVQYKIQVKKPQSKAERCLWEALANI---TNDSNAKRTENLEAT 428

Query: 385 EEV 387
           E+ 
Sbjct: 429 EKA 431

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+  +A+  E+K+AYR+ +++ HPDK  D+     +  +F+ IS AY VLSDE  R
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDP---MATERFQAISEAYQVLSDEDLR 64

Query: 66 AEYDQFG 72
           +YD+FG
Sbjct: 65 GKYDRFG 71

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YE+L +  +A++ E+K++YR+LA+R HPDK        ASEA FK I+ A+ VL D +K
Sbjct: 23 FYEILKVERTANDNEIKKSYRKLAIRLHPDK---NPHPRASEA-FKLINRAFEVLGDSEK 78

Query: 65 RAEYDQFG 72
          R+ YD+ G
Sbjct: 79 RSLYDRLG 86

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ ++AS+ ++K+AYR+ AL+YHPDK  D  E EA+   F  I +AY VL+D Q+R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVE-EATTV-FATIRSAYEVLADPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 48/74 (64%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y++LG+   AS  ++K+AYR+ A+  HPDK  D+ E   ++AKF+ I  AY V
Sbjct: 1  MVKDTEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPE---AQAKFQAIGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD   R+ YD+FG
Sbjct: 58 LSDPDLRSRYDEFG 71

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YE+L +   AS+ ++K+AYR++A++ HPDK       EA    FK+++ A+ VLSDE+K
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFEVLSDEKK 80

Query: 65 RAEYDQFG 72
          R  YDQ G
Sbjct: 81 RRVYDQLG 88

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 109/250 (43%), Gaps = 34/250 (13%)

Query: 146 CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKG--KRI 203
           C  C G+G++        + C  C G G    I R G  ++S    +C  C G+G  KR 
Sbjct: 229 CSTCSGTGMKPNTHK---VNCSTCHGTGTTVHI-RGGFQMMS----TCPTCNGEGTMKR- 279

Query: 204 PTTAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQ---------SDMEPGKE 253
                D+C KC G+ V V     I+V +P G Q GD +R PGQ         +D++   +
Sbjct: 280 ---PQDSCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVK 336

Query: 254 T--GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIP 311
              GD++  I    D + S++ K  D++   +I +  A  G T +   T + + +RI + 
Sbjct: 337 LSRGDILVRIRVDKDPNFSIKNK-YDIWYDKEIPITTAALGGT-VTIPTVEGQKIRIKVA 394

Query: 312 RGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLA 371
            G   +    +   N G P     R GDM +Q  I   K     EK   +A+ ++     
Sbjct: 395 PG--TQYNQVISIPNMGVPKTTTIR-GDMKIQYKIVVKKPQSLAEKCLWEALADV---TN 448

Query: 372 DAPSTKTEDP 381
           D  + KT +P
Sbjct: 449 DDMAKKTMEP 458

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+ LG+  SA+  E+K+AY +LA +YHPD I+ E +   +E KF ++  AY +LSDE
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEVD---AEKKFHDLQNAYEILSDE 115

Query: 63  QKRAEYDQ 70
            KR +YDQ
Sbjct: 116 NKRQQYDQ 123

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           Y++L +  +A + E+K++YR+LA++ HPDK       +ASEA FK I+ A+ VL DE+K
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDK---NPHPKASEA-FKRINRAFEVLGDEKK 80

Query: 65 RAEYDQFG 72
          R  +D+ G
Sbjct: 81 RVLFDRIG 88

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDE---SEREASEAKFKEISAAYAVLS 60
           D Y +LG++ SA+++++K AYR+L++++HPDK+S +    ER   E  + +IS AY  L+
Sbjct: 123 DPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALT 182

Query: 61  DEQKRAEYDQFG 72
           DE  +A Y  +G
Sbjct: 183 DEITKANYLTYG 194

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 51/67 (76%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI  SA++ E+K+AYR+ +++ HPDK  + ++ +A+E +F+ IS AY VLSDE  R
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDK--NPNDPQATE-RFQAISEAYQVLSDESLR 64

Query: 66 AEYDQFG 72
           +YD++G
Sbjct: 65 LKYDKYG 71

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 103/236 (43%), Gaps = 30/236 (12%)

Query: 146 CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPT 205
           C  C GSG+++ A      +C  C G G K  I R G  ++S    +C +C G+G  +  
Sbjct: 222 CHTCHGSGIKQGAQKH---QCPSCHGSGQKVHI-RSGFQMVS----TCNECHGEGTIL-- 271

Query: 206 TAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQSD-----MEPGKET----- 254
            A+D C  C G  V    +  I+V +P G Q GD +R PGQ +     ++P  +      
Sbjct: 272 NASDYCGTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALDPELKNSVKLT 331

Query: 255 -GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRG 313
            GD++  I    D   S++ K  D++ T  I +  A  G   +   T D   LR+ +  G
Sbjct: 332 RGDVLVRIRVDKDNRFSIKDK-YDIWFTKDIPITTAALGGI-VTIPTVDGTTLRLKVQAG 389

Query: 314 KVLRPGNYLKFTNEGWP---IEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNI 366
              +    +   N G P   I    R G+M VQ  I   K     EK   +A+ ++
Sbjct: 390 --TQHDQVISIPNLGVPRSSINKENR-GNMKVQYRIVIRKPQSQAEKCLWEALADV 442

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 4/72 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+VLGI  SA+  E+K+AY +LA +YHPD     ++   +E KF ++  AY +LSDE
Sbjct: 50  KDPYKVLGINKSATSSEIKKAYYKLAKKYHPDI----NKEPTAEKKFHDLQNAYEILSDE 105

Query: 63  QKRAEYDQFGTV 74
            K+++YD FG+ 
Sbjct: 106 TKKSQYDTFGSA 117

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           Y++L +  SA   E+K++YR+LA++ HPDK       +A EA FK I+ A+ VLSD++K
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDK---NPHPKAGEA-FKVINRAFEVLSDDEK 80

Query: 65 RAEYDQFG 72
          R+ +D+ G
Sbjct: 81 RSVFDRIG 88

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI   A+  E+K+AYR+ A+  HPDK  D+ +   ++AKF+ +  AY VLSD   R
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 66 AEYDQFG 72
          ++YD+FG
Sbjct: 65 SKYDEFG 71

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 111/262 (42%), Gaps = 31/262 (11%)

Query: 122 PLKLTTK-----QLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYKE 176
           P++LT +      ++  K    K      C  C GSGL+  A+      C GC G G + 
Sbjct: 177 PIELTHRISFKDSVFGTKNVNLKFSAYDPCGTCDGSGLKPGAS---RTTCPGCSGTGTRV 233

Query: 177 RISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGK-CVVQEESIISVYVPRGSQ 235
            I R G  + S    +C  CGG+G  +    +D C  C G+   + ++  I V +P G Q
Sbjct: 234 HI-RAGFQMAS----TCNQCGGEGSVV--RDSDTCATCHGEGASLNKDHAIKVDLPHGLQ 286

Query: 236 HGDRLRYPGQSD-----MEPG-KET-----GDLVFVIDEQTDVSSSLERKGTDLYCTMKI 284
            GD +R  GQ       ++P  K+T     GD++  I    D    ++ K  D++ T  I
Sbjct: 287 DGDVIRISGQGSYPNIAVDPAMKDTVRLSRGDVLLRIRVDKDPRFQIKNK-YDIWLTQDI 345

Query: 285 SLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQV 344
            +  A  G   +   T D   +R+ +  G   +  + +  + +G P       GDM VQ 
Sbjct: 346 PITTAALGGI-VTVPTVDGEQVRLKVAPGT--QHNDVVSISQKGVPRGAFGSRGDMKVQY 402

Query: 345 LIEFPKDNWFNEKAELDAIRNI 366
            I   K     E+   +A+ ++
Sbjct: 403 KISIKKPQSQAERCLWEALADV 424

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (68%), Gaps = 4/70 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y  LG++ SAS  E+K+AY +LA +YHPD     ++ E ++ KF ++  AY +LSD+
Sbjct: 39  KDPYATLGVSKSASGSEIKKAYYKLAKKYHPDI----NKAEDAQKKFHDLQNAYEILSDD 94

Query: 63  QKRAEYDQFG 72
            KR ++DQFG
Sbjct: 95  SKRQQWDQFG 104

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISD---ESEREASEAKFKEISAAYAVLS 60
           D Y +LG+A+SA+++EV+ AYR+L++++HPDK++    + +R   E ++  I+ AY  L+
Sbjct: 116 DPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALT 175

Query: 61  DEQKRAEYDQFG 72
           DE  +  Y +FG
Sbjct: 176 DEITKENYLKFG 187

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI   A+  E+K+AYR+ A+  HPDK  D+ +   ++AKF+ +  AY VLSD   R
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 66 AEYDQFG 72
          ++YD+FG
Sbjct: 65 SKYDEFG 71

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREASEAKFKEISAAYAVLS 60
           +D Y+ LG+  SA+ +E+++AY  L  +YHPDKI  +   ++E+      +I+ AY  LS
Sbjct: 537 KDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALS 596

Query: 61  DEQKRAEYD 69
           D+ KR EYD
Sbjct: 597 DDNKRKEYD 605

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREA---SEAKFKEISAAYAVLS 60
           D YE+LG+++SA+++E+K AYR+L++++HPDK+  +   EA    E  + +I+ AY  L+
Sbjct: 122 DPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLT 181

Query: 61  DEQKRAEYDQFG 72
           DE  +  Y ++G
Sbjct: 182 DENVKENYLRYG 193

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 108/257 (42%), Gaps = 37/257 (14%)

Query: 146 CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPT 205
           C  C G+G++        + C  C G G    I R G  ++S    +C  C G+G     
Sbjct: 235 CGTCSGTGMKPNTHK---VNCGTCHGTGTTVHI-RGGFQMMS----TCPTCNGEGTM--K 284

Query: 206 TAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQSDM------EPGKET---- 254
              D+C KC G+ V V     I+V +P G Q GD +R PGQ         E  K++    
Sbjct: 285 RPQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEEDLKDSVKLS 344

Query: 255 -GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRG 313
            GD++  I    D + S++ K  D++   +I +  A  G T +   T + + +RI +  G
Sbjct: 345 RGDILVRIRVDKDPNFSIKNK-YDIWYNKEIPITTAALGGT-VTIPTVEGQKIRIKVAPG 402

Query: 314 KVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNIL------ 367
              +    +   N G P     R GDM VQ  I   K     EK   +A+ ++       
Sbjct: 403 --TQYNQVISIPNMGVPKTPTIR-GDMKVQYKIVVKKPQSLAEKCLWEALADVTNDDMAK 459

Query: 368 ----PGLADAPSTKTED 380
               PG A   +T +E+
Sbjct: 460 KTMQPGAAAGATTISEE 476

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+ LG+  SA+  E+K+AY +LA +YHPD I+ E +   +E KF ++  AY +LSDE
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEPD---AEKKFHDLQNAYEILSDE 115

Query: 63  QKRAEYDQF 71
            KR +YDQF
Sbjct: 116 SKRQQYDQF 124

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++L + S AS+ ++K+AYR+ AL+YHPDK  D  E EA+   F EI AAY VLSD Q+R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVE-EATTI-FAEIRAAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREASEAKFKEISAAYAVLS 60
           +D Y+VLG+A  A+ +E+++AY  L  +YHPDKI  +   + E       +I+ AY  LS
Sbjct: 534 KDYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLS 593

Query: 61  DEQKRAEYD 69
           D+ KR EYD
Sbjct: 594 DDDKRKEYD 602

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 109/266 (40%), Gaps = 29/266 (10%)

Query: 101 HGYQHEEDDFEEVGRTADSTVPLKLTTKQLYLG-KTFQFKARRKVLCPRCGGSGLRKRAA 159
           HG      DF    +  + TVP +++ K    G K  +   +    C  C GSGL+   A
Sbjct: 154 HGAGFGGSDFVREYKGENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLK---A 210

Query: 160 ARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCV 219
                 C  C G G +  + R G  + S    +C  C G+G  I    +D C  C     
Sbjct: 211 GHSRSVCPTCHGTGTQVHV-RAGFQMAS----TCQTCDGEGSTIKD--SDKCGTCHSHGF 263

Query: 220 -VQEESIISVYVPRGSQHGDRLRYPGQSD-----MEPGKET------GDLVFVIDEQTDV 267
            +     I+V +P G Q GD +R P Q       ++P  ++      GDL+  +  + D 
Sbjct: 264 KLNSNKTITVDLPHGLQDGDTIRVPNQGSYPGMAIDPSMKSELHLTRGDLLIRVRVRKDT 323

Query: 268 SSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNE 327
              +     D+  T +I +  A  G   I   T +E  +R+ +  G   +    ++  N+
Sbjct: 324 RFQVS-NNYDIIYTQEIPITTAALGGV-IEVPTVEEEKIRLKVSSG--TQHDQVIRIPNK 379

Query: 328 GWPIEDGARFGDMYV--QVLIEFPKD 351
           G P       GDM V  +++I+ PKD
Sbjct: 380 GVPRGARGDRGDMLVKFKIVIKKPKD 405

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 4/70 (5%)

Query: 3  RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
          +D Y+VLGI  ++S+ ++K+AY +LA +YHPD     ++ E S+ KF ++  AY +LSDE
Sbjct: 24 KDPYKVLGINKNSSQSDIKKAYYKLAKKYHPDI----NKEEDSQKKFHDLQNAYEILSDE 79

Query: 63 QKRAEYDQFG 72
           KR +YDQFG
Sbjct: 80 DKRKQYDQFG 89

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASE--AKFKEISAAYAVL 59
            +D Y+VL I +SA+++E+++AY  L  +YHPDK    S ++ ++  AK   I+ AY +L
Sbjct: 558 NKDFYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEIL 617

Query: 60  SDEQKRAEYD 69
           SDE KR +YD
Sbjct: 618 SDENKRRDYD 627

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+  +A++ E+K+AYR+ AL++HPDK  D  + EA+E  F  I +AY VLSD Q+R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVD-EATEI-FATIRSAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 97/224 (43%), Gaps = 34/224 (15%)

Query: 146 CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPT 205
           C +C GSGL + A       C  C G G K  I R G  ++S    +C  C G+G  I  
Sbjct: 252 CNKCSGSGLNRNAK---RTTCPSCHGSGQKVHI-RSGFQMVS----TCNHCHGEGTII-- 301

Query: 206 TAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQSD-------MEPGKET--- 254
            + D C  C G  V +     I V +P G Q GD +R PGQ +       ++P       
Sbjct: 302 DSKDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAMMNSIK 361

Query: 255 ---GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIP 311
              GDL+  +    D + S+ R   D++ T +I +  A+ G   +   T D   +R+ + 
Sbjct: 362 LSRGDLLVRVRVNKDPNFSI-RDKYDIWFTKQIPITTAILGGV-VKIPTVDGTQIRLKVS 419

Query: 312 RGKVLRPGNYLKFTNEGWP---IEDGARFGDMYVQ--VLIEFPK 350
            G   +    +   N G P   I    R G+M VQ  ++++ P+
Sbjct: 420 PG--TKHDQIISIPNLGVPRSSINKDNR-GNMKVQYKIIMKTPQ 460

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 4/70 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y VLG+ +SAS  E+K+AY +LA +YHPD     +++  +E KF ++  AY +LSDE
Sbjct: 78  KDPYSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSDE 133

Query: 63  QKRAEYDQFG 72
            KR +YD FG
Sbjct: 134 NKRKQYDTFG 143

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y++LG+   A+  E+K+AYR+ A++ HPDK  D+ +   ++AKF+ +  AY V
Sbjct: 1  MVKDTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPD---AQAKFQAVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD   R+ YD+FG
Sbjct: 58 LSDPGLRSRYDEFG 71

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG+   A+  E+K+AYR+ A+  HPDK  D+ E   +++KF+ +  AY VLSD   R
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPE---AQSKFQAVGEAYQVLSDPGLR 64

Query: 66 AEYDQFG 72
          + YD+FG
Sbjct: 65 SRYDEFG 71

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y  LG++S+A+E E+ ++Y  LA + HPDK    S+ EAS  +FK IS A++VL DE KR
Sbjct: 15 YSTLGLSSNANEAEIHKSYMMLARQLHPDK----SKSEASAEQFKLISHAHSVLMDEAKR 70

Query: 66 AEYDQ 70
           +YD+
Sbjct: 71 LKYDE 75

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDES--EREASEAKFKEISAAYAVLS 60
           +D Y++LG+A ++  + +++AY  L  +YHPDK    S  E+E +  K  EI+ AY +L 
Sbjct: 553 KDYYKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILG 612

Query: 61  DEQKRAEYD 69
           DE K+ EYD
Sbjct: 613 DESKKKEYD 621

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 4  DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
          + Y+VLGI  +A+  E+K+AYR+ A+  HPDK  D+    ASE +F+++  AY VLSD  
Sbjct: 6  EYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDP--TASE-RFQQVGEAYQVLSDPD 62

Query: 64 KRAEYDQFG 72
           R +YD+FG
Sbjct: 63 LRKQYDEFG 71

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+L I S A+++E+K+AYR   L  HPDK++ ++  + +      I  AY VLS+ + R
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 66 AEYDQF 71
           EYD+ 
Sbjct: 70 GEYDKL 75

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LG+ S AS+ ++K+AYR+ AL+YHPDK +  + ++A+E  F  I AAY VLSD Q+R
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDK-NIGNVQQATEI-FASIRAAYEVLSDAQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LGI ++A+  E+K+AYR+ ++  HPDK  ++     +  +F+ IS AY VLSD   R
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDP---GATERFQAISEAYQVLSDSDLR 64

Query: 66 AEYDQFG 72
          A YD+FG
Sbjct: 65 ANYDKFG 71

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDK---ISDESEREASEAKFKEISAAYAV 58
            +D Y++LG+  ++  +E++++Y  L  +YHPDK   +S+E E+E +  K ++I+ AY  
Sbjct: 602 NKDYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEE-EQERNHKKMEQINEAYEC 660

Query: 59  LSDEQKRAEYD 69
           LSDE KR EYD
Sbjct: 661 LSDESKRKEYD 671

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 5/74 (6%)

Query: 1  MTRD--LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          M +D   Y++LG+   A+  E+K+AYR+ A+  HPDK  ++     ++AKF+ +  AY V
Sbjct: 1  MVKDTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPN---AQAKFQAVGEAYQV 57

Query: 59 LSDEQKRAEYDQFG 72
          LSD++ R  YDQ G
Sbjct: 58 LSDDELRKRYDQLG 71

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI  +A+  E+K+AYR+ +++ HPDK  + ++  A+E +F+ IS AY VLS E+ R
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSSEELR 64

Query: 66 AEYDQFG 72
          A+YD+FG
Sbjct: 65 AKYDKFG 71

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 53/67 (79%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG++++A+  E+K+AYR+ +++ HPDK  + ++ +A+E +F+ IS AY VL D++ R
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVLGDDELR 64

Query: 66 AEYDQFG 72
          A+YD++G
Sbjct: 65 AKYDKYG 71

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 51/67 (76%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG++++AS  E+K+AYR+ +++ HPDK  + ++  A+E +F+ IS AY VL D+  R
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLGDDDLR 64

Query: 66 AEYDQFG 72
          A+YD++G
Sbjct: 65 AKYDKYG 71

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 2/70 (2%)

Query: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREAS--EAKFKEISAAYAVL 59
            +D Y++L ++  A  ++++++Y  L  ++HPDK    SE+E    + K  EI+ AY VL
Sbjct: 525 NKDYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVL 584

Query: 60  SDEQKRAEYD 69
           SDE KR EYD
Sbjct: 585 SDETKRNEYD 594

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+L I S A++ E+K+AYR   L  HPDK+S       S     +I  AY +LS+ + R
Sbjct: 10 YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTR 69

Query: 66 AEYDQF 71
           EYD+ 
Sbjct: 70 REYDRL 75

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+L +   A + E+K+AYR+ AL+YHPDK + E+  EA+E  F  I AAY VLSD Q+R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK-NPENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 66 AEYD 69
          A YD
Sbjct: 64 AWYD 67

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG+  ++++ E+K+AYR+ +++ HPDK  +  +   +  KF+ IS AY VLSD+  R
Sbjct: 8  YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPD---ATKKFQAISEAYQVLSDKNLR 64

Query: 66 AEYDQFG 72
          + YD+FG
Sbjct: 65 SNYDKFG 71

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDE------SEREASEAKFKEISAAYAVL 59
          YEVL I S A+ QE+K+AY+Q  L  HPDK S +      +  + +     +I  AY +L
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 60 SDEQKRAEYDQ 70
          S+E  R +YD+
Sbjct: 71 SNESTREQYDE 81

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG+A+ A + ++K+AYR+ +++ HPDK  D+     +  +F+ IS AY VLS E+ R
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDP---TATERFQAISEAYQVLSSEELR 64

Query: 66 AEYDQFG 72
           +YD+FG
Sbjct: 65 MKYDKFG 71

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+LGI+ SA+  E+K+AYR+ +++ HPDK  + ++  A+E +F+ IS AY VLSD+  R
Sbjct: 8  YELLGISPSATAIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSDDTLR 64

Query: 66 AEYDQFG 72
           +YD++G
Sbjct: 65 LKYDKYG 71

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y+V+G+    S++++K +Y++L  + HPDK S    +EA    F  +  AY  LS++QKR
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEA----FALVHKAYKTLSNKQKR 80

Query: 66 AEYDQFG 72
          A YD++G
Sbjct: 81 AMYDKYG 87

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDE---SEREASEAKFKEISAAYAVLS 60
           D Y +L +++S++++E++ AYR+L++++HPDK+S +   +ER   E ++  I+ AY  L+
Sbjct: 117 DPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALT 176

Query: 61  DEQKRAEYDQFG 72
           DE  R  Y ++G
Sbjct: 177 DEVTRENYLKYG 188

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y+ LGI+  A+  E+K+AYR+ A+  HPDK  ++ +   ++AKF+ +  AY VLSD   R
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPD---AQAKFQAVGQAYQVLSDPGLR 64

Query: 66 AEYDQFG 72
          + YD+FG
Sbjct: 65 SRYDEFG 71

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 1  MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYA 57
          M R  YE+LGI S AS  E+KRAYR + L  HPDK     + +    S     +I  AY 
Sbjct: 1  MQRSFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQ 60

Query: 58 VLSDEQKRAEYDQ 70
           L D+  R +YD+
Sbjct: 61 TLIDQDLRKKYDE 73

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDE---SEREASEAKFKEISAAYAVLS 60
           D Y +L I++S++++E++ AYR+L++++HPDK+S +    ER   E ++  I+ AY  L+
Sbjct: 115 DPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALT 174

Query: 61  DEQKRAEYDQFG 72
           DE  R  Y ++G
Sbjct: 175 DEITRENYLRYG 186

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 51/67 (76%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG++++AS  E+K+AYR+ +++ HPDK  + ++ +A+E +F+ IS AY VL D + R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVLGDNELR 64

Query: 66 AEYDQFG 72
           +YD++G
Sbjct: 65 VKYDKYG 71

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 49/71 (69%), Gaps = 2/71 (2%)

Query: 4  DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
          D Y  L +++ A + +VK++YR+L LRYHPDK+S++  +E ++ +F ++  +Y VL+  +
Sbjct: 12 DPYATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT--K 69

Query: 64 KRAEYDQFGTV 74
           R  YD+ G++
Sbjct: 70 FREIYDKSGSI 80

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDK---ISDESEREASEAKFKEISAAYAVL 59
           +D Y+ LG++ +A+ ++++RAY QL  +YHPDK   +S E ER   + K   I+ AY  L
Sbjct: 503 KDYYKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQE-ERLKVDEKMSAINEAYETL 561

Query: 60  SDEQKRAEYD 69
            D+ KR EYD
Sbjct: 562 RDDSKRKEYD 571

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 47/70 (67%), Gaps = 3/70 (4%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDE---SEREASEAKFKEISAAYAVL 59
           ++ Y++LGI   AS++E+++AY  L  +YHPDK   +    E + ++ K  EI+ AY VL
Sbjct: 540 KNYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVL 599

Query: 60  SDEQKRAEYD 69
           +DE+KR EYD
Sbjct: 600 NDEEKRKEYD 609

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 1  MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
          M    YE LG+ S  S +E+K+AY++  L  HPDKI DES    S  +  +I  AY VL 
Sbjct: 1  MISSHYETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDES----SSVEVNKIQEAYKVLC 56

Query: 61 DEQKRAEYDQ 70
          D   R +YD+
Sbjct: 57 DVNLREKYDE 66

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 95/218 (43%), Gaps = 26/218 (11%)

Query: 146 CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPT 205
           C  C GSGL+K    +    C  C G G +  + R G  + S    +C  C G+G  I  
Sbjct: 219 CDTCHGSGLKKGENHKRR-SCSYCNGTGTQIHV-RSGFQMAS----TCNHCHGEGTII-- 270

Query: 206 TAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQSDM------EPGKE----- 253
              D C KC G  V +  +  I+V +P     GD +R PG+         E  K+     
Sbjct: 271 AFEDMCTKCHGDGVKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVKLS 330

Query: 254 TGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRG 313
            GDL+  I  + D   +++ K  D++   +I +  A  G T I  +T D++ +R+ +  G
Sbjct: 331 RGDLLVRIRVKPDPDYTIKNK-YDIWSVKEIPITTAALGGT-ITIKTIDDKQIRLKVMAG 388

Query: 314 KVLRPGNYLKFTNEGWPIEDGARFGDMYVQ--VLIEFP 349
              +        N G P  +G   GDM +Q  V+I  P
Sbjct: 389 --TQHDQVTSIPNMGVPRRNGLGRGDMKIQYKVVIRKP 424

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 4/70 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+ LG+A SAS+ E+K+AY +LA +YHPD I+ E +   +E  F  +  AY +LSDE
Sbjct: 55  KDPYKTLGVARSASQSEIKKAYYKLAKKYHPD-INKEPD---AEKTFHNLQNAYEILSDE 110

Query: 63  QKRAEYDQFG 72
            KRA++DQFG
Sbjct: 111 DKRAQFDQFG 120

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 101/233 (43%), Gaps = 26/233 (11%)

Query: 146 CPRCGGSGLRKRAAARPMIRCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGKRIPT 205
           C  C GSGL K  A+R    C GC G G +  + R G  + S    +C  CGG+G  +  
Sbjct: 210 CNTCDGSGL-KPGASRST--CPGCSGTGTRVHV-RAGFQMAS----TCNQCGGEGSVL-- 259

Query: 206 TAADNCKKCTGKCV-VQEESIISVYVPRGSQHGDRLRYPGQSD-----MEPG-KET---- 254
             AD C+ C G+   + +   + V +P G Q GD +R  G+       ++P  K+T    
Sbjct: 260 RDADTCQTCHGEGAKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLS 319

Query: 255 -GDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRG 313
            GDL+  I    D    ++ K  D++ T  I +  A  G   +   T D   +R+ +  G
Sbjct: 320 RGDLLLRIRVDKDPRFQIKNK-YDIWFTQDIPITTAALGGV-VTIPTVDGEQVRLKVSPG 377

Query: 314 KVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFNEKAELDAIRNI 366
              +  + +    +G P       GDM VQ  +   K     EK   +A+ +I
Sbjct: 378 --TQHHDVVSIPQKGVPRGSFGTRGDMKVQYRVVIKKPQSQAEKCLWEALADI 428

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 50/70 (71%), Gaps = 4/70 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y  LG+++SA+  E+K+AY +LA +YHPD I+  ++   ++ KF ++  AY +LSD+
Sbjct: 38  KDPYSTLGVSNSATSSEIKKAYYKLAKKYHPD-INKAAD---AQKKFHDLQNAYEILSDD 93

Query: 63  QKRAEYDQFG 72
            KR ++DQ+G
Sbjct: 94  CKRQQWDQYG 103

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESE--REASEAKFKEISAAYAVLS 60
           +D Y++L I  +A+ +E+++AY      YHPDK    SE  ++ ++ K  EI+ AY  LS
Sbjct: 474 KDYYKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLS 533

Query: 61  DEQKRAEYD 69
           DE KR EYD
Sbjct: 534 DEGKRREYD 542

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG++ +A   E+K+AYR+ +++ HPDK  ++    ++  +F+ IS AY VLS+E+ R
Sbjct: 8  YDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDP---SATERFQSISQAYQVLSNEELR 64

Query: 66 AEYDQFG 72
           +YD+FG
Sbjct: 65 TKYDKFG 71

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS---DESEREASEAKFKEISAAYAVLS 60
           D YE+L + S A+++E++ AYR+L++++HPDK++    ++ER   E ++  I+ AY  L+
Sbjct: 115 DPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALT 174

Query: 61  DEQKRAEYDQFG 72
           D+  R  + ++G
Sbjct: 175 DDATRDNFLRYG 186

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 5/73 (6%)

Query: 4   DLYEVLGIASSASEQ----EVKRAYRQLALRYHPDK-ISDESEREASEAKFKEISAAYAV 58
           DLY+VLG+ S+  ++    EVKR Y++L L+YHPDK +S   +     ++F  + +A+ +
Sbjct: 82  DLYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQI 141

Query: 59  LSDEQKRAEYDQF 71
           L D   R +YDQ+
Sbjct: 142 LCDSSLRTQYDQW 154

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKIS--DESEREASEAKFKEISAAYAVLS 60
           ++ Y+VLG+   A+ ++++++Y  +  +YHPDK     E+++  ++ K  EI+ AY +LS
Sbjct: 504 KNYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILS 563

Query: 61  DEQKRAEYD 69
           DE KR EYD
Sbjct: 564 DEGKRKEYD 572

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG++  A   E+K+AYR+ +++ HPDK  + ++ +A+E +F+ IS AY VLS ++ R
Sbjct: 8  YDLLGVSPDAKAIEIKKAYRKKSVQEHPDK--NPNDPKATE-RFQAISEAYQVLSSDELR 64

Query: 66 AEYDQFG 72
          A+YD+FG
Sbjct: 65 AKYDKFG 71

>NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92
          Length = 276

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 7/70 (10%)

Query: 3  RDLYEVLGIASS----ASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAV 58
          +DLYE L I  +     S QE+KR YR LAL+YHPDK  ++S       KF EIS A  +
Sbjct: 13 KDLYEDLEITDALTRRISIQEIKRQYRTLALKYHPDKHPNDSNL---IHKFHEISIATNI 69

Query: 59 LSDEQKRAEY 68
          L+DE+   EY
Sbjct: 70 LTDEKLSEEY 79

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++L I  +A+  E+K+AYR+ +++ HPDK  + ++  A+E +F+ IS AY VLSD+  R
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQAISEAYQVLSDKNLR 64

Query: 66 AEYDQFG 72
          A YD+FG
Sbjct: 65 ANYDKFG 71

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LG+  +A++ E+K+AYR+ ++  HPDK  D+    A+  +F+ IS AY VLS++  R
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDP---AATERFQSISEAYQVLSNKDLR 64

Query: 66 AEYDQFG 72
          A YD+ G
Sbjct: 65 ANYDKSG 71

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 4  DLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQ 63
          D YEVLG+  S +E+E+K+ YR+L LR HPDK  D +  EA E KF +I  A+ VL  ++
Sbjct: 14 DPYEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWTP-EAKE-KFHKIQFAFEVL--DK 69

Query: 64 KRAEYDQFGTV 74
           +  YD+ G+V
Sbjct: 70 FKETYDKTGSV 80

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 1  MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREA--SEAKFKEISAAYAV 58
          M +  YEVL + + AS  ++KRAYR+  L  HPDK + +  R    ++A  ++I  AY V
Sbjct: 1  MNKSHYEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRV 60

Query: 59 LSDEQKRAEYD 69
          L+D  +R +YD
Sbjct: 61 LADPTRREQYD 71

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 2  TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61
          T   Y +LG+ ++AS  E++++Y +LA + HPDK   E   E     FK +  A+++L++
Sbjct: 10 TSTYYSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAEL----FKLVVDAHSILNN 65

Query: 62 EQKRAEYDQ 70
          +Q RAEYD+
Sbjct: 66 DQLRAEYDK 74

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          Y++LGI  +A+  E+K+AYR+ +++ HPDK  ++     +  +F+ IS AY VLS+++ R
Sbjct: 8  YDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDP---GATERFQAISEAYQVLSNDELR 64

Query: 66 AEYDQFG 72
          A+YD+ G
Sbjct: 65 AKYDRLG 71

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 4/71 (5%)

Query: 3   RDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDE 62
           +D Y+VLG+   A   E+K+AY +LA +YHPD   D+     S+ KF +I+ AY +LSDE
Sbjct: 46  KDPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDK----GSDKKFHDITNAYEILSDE 101

Query: 63  QKRAEYDQFGT 73
           +K+ +YDQFG+
Sbjct: 102 KKKMQYDQFGS 112

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64
           YE+L +  +A++ E+K+AYR+LA++ HPDK       +A+EA FK I+ A+ VL + +K
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDK---NPHPKAAEA-FKLINRAFEVLGNSEK 78

Query: 65 RAEYDQFG 72
          R  +++ G
Sbjct: 79 REIFNRIG 86

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YE+L +  +AS+ ++K+AYR+ AL+YHPDK +  + +EA++  F  I  AY +LSD Q+R
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDK-NINNIKEATDI-FANIRTAYEILSDPQER 63

Query: 66 AEYD 69
            YD
Sbjct: 64 VWYD 67

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 6  YEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKR 65
          YEVL +   AS  E+K+AYR   L  HPDK +DE+ + A       I  AY VLSDE+ R
Sbjct: 5  YEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDEN-KPALNVSVNAIQEAYRVLSDEKLR 63

Query: 66 AEYDQ 70
           EYD 
Sbjct: 64 REYDH 68

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 4  DLYEVLGI---ASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60
          +LY++LG     S+ +  E+K+ YR LAL+YHPDK  ++        KF +I+ A  +L+
Sbjct: 14 NLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDL---TLVEKFHKITIALNILT 70

Query: 61 DEQKRAEYDQF 71
          + Q + EYD++
Sbjct: 71 NNQLKTEYDKW 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,969,299
Number of extensions: 1799857
Number of successful extensions: 5725
Number of sequences better than 10.0: 377
Number of HSP's gapped: 5188
Number of HSP's successfully gapped: 446
Length of query: 427
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 315
Effective length of database: 40,638,807
Effective search space: 12801224205
Effective search space used: 12801224205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)