Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR083W8.265ON29529511381e-157
Ecym_43058.265ON3113115851e-73
SAKL0H16962g8.265ON3363432093e-18
KLLA0F19206g8.265ON2631141852e-15
YDR113C (PDS1)8.265ON3733211628e-12
ZYRO0C01584g8.265ON2822581553e-11
Suva_2.2738.265ON3763791547e-11
Smik_4.3588.265ON3713201521e-10
KLTH0G13618g8.265ON3022561441e-09
TDEL0F039208.265ON3222521403e-09
Kwal_56.237818.265ON2932281173e-06
TBLA0E044608.265ON2771341163e-06
Skud_4.3748.265ON3731781112e-05
NDAI0J013508.265ON422621085e-05
KNAG0H032308.265ON2811311004e-04
Kpol_543.418.265ON306125950.002
NCAS0B038308.265ON325142930.003
KAFR0B055108.265ON275119900.006
CAGL0L12298g8.265ON286245890.009
NOTE: 1 genes in the same pillar as AGR083W were not hit in these BLAST results
LIST: TPHA0A01780

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR083W
         (295 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...   442   e-157
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...   229   1e-73
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    85   3e-18
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    76   2e-15
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    67   8e-12
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    64   3e-11
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    64   7e-11
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    63   1e-10
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    60   1e-09
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    59   3e-09
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    50   3e-06
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    49   3e-06
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    47   2e-05
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    46   5e-05
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    43   4e-04
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    41   0.002
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    40   0.003
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    39   0.006
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    39   0.009

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score =  442 bits (1138), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 230/295 (77%), Positives = 230/295 (77%)

Query: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLK 60
           MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLK
Sbjct: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLK 60

Query: 61  TSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKDTSDCX 120
           TS           SKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKDTSDC 
Sbjct: 61  TSGAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKDTSDCE 120

Query: 121 XXXXXXXXXXGNPLAAKLKSRLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQEDVPPV 180
                     GNPLAAKLKSRLC                             TQEDVPPV
Sbjct: 121 SANEESEEEEGNPLAAKLKSRLCSAEEGGNEDDGSSGLLLGEALSQLAAAGETQEDVPPV 180

Query: 181 EYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLEF 240
           EYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLEF
Sbjct: 181 EYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLEF 240

Query: 241 GALXXXXXXXXXXXXXXNGAALGAIALSQEEPDEVQFEFAVGEGLDSKDLHSLLD 295
           GAL              NGAALGAIALSQEEPDEVQFEFAVGEGLDSKDLHSLLD
Sbjct: 241 GALDDSQSSSDEDDATSNGAALGAIALSQEEPDEVQFEFAVGEGLDSKDLHSLLD 295

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score =  229 bits (585), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 172/311 (55%), Gaps = 16/311 (5%)

Query: 1   MKKHEDKENLVT-SAGRGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGL 59
           MKKHEDKEN+ T S   G+++PRTP+HQLKRS+SN+  +N++R+PLASKDRN+SQ  F L
Sbjct: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNL 60

Query: 60  K-----TSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLK 114
           K                  SKRPAS+S  KNMPDSKLKKYGSVLGV Y  L K KSLVLK
Sbjct: 61  KQQLVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLK 120

Query: 115 DTSDCXXXX----XXXXXXXGNPLAAKLKSRLCXXXXXXXXXXXXXXXXXXXXXXXXXXX 170
           D SD                GNPLAAKL+SRL                            
Sbjct: 121 DASDGSQDNGEESDDYDDEEGNPLAAKLRSRLTSGVEDENEDDGSSGLLLGGGLKKLIKL 180

Query: 171 XXTQ----EDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEEN 226
             +     E+VP +E APEK+PEL H+PNGYE  +  ++ KLA Y SPFLRF D+E++++
Sbjct: 181 HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDS 240

Query: 227 TEPGDSQQLIPLEFGALXXXXXXXXXXXXXXNGAALGAIALSQ--EEPDEVQFEFAVGEG 284
                 + LIPL+FG +                       + +   + DE+QF F +G+G
Sbjct: 241 DSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKG 300

Query: 285 LDSKDLHSLLD 295
           L S +L SLLD
Sbjct: 301 LSSNELQSLLD 311

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 85.1 bits (209), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 131/343 (38%), Gaps = 55/343 (16%)

Query: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNL--------AGRNSTRMPLASKDRNQ 52
           M+ HE+KEN++ S+     +P TP H LKRS S +          ++  R+PLASKD N+
Sbjct: 1   MRTHENKENVIFSS---ENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNK 57

Query: 53  SQGVF--GLKTSXXXXXXXXXX------XSKRPASSS----IAKN--------MPDSKLK 92
           S  +   G K++                   RP  S+    I  N        +PDS+LK
Sbjct: 58  SNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLK 117

Query: 93  KYGSVLGVGYGSLAKAKSLVLKDTSD----------CXXXXXXXXXXXGNPLAAKLKSRL 142
           KYGSVL  GY  L + KSLVLKD  +                       NPLAAKL   L
Sbjct: 118 KYGSVL--GYNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKAL 175

Query: 143 CXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQEDVPP---VEYAPEKLPELPHVPNGYES 199
                                          +E       +E  P    ELPHVPNGY  
Sbjct: 176 NNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSP 235

Query: 200 LKSADLAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLEFGALX------XXXXXXXXX 253
            K +D+ KL  + SPF     KED +  E  D   L+ +                     
Sbjct: 236 FKESDVIKLNTFTSPFSMH--KEDSDCEECDDYDGLLTISMVKSEDEEQDDDTNDRKRRK 293

Query: 254 XXXXNGAALGAIALSQEEPDEVQFE-FAVGEGLDSKDLHSLLD 295
                G A     L      E+  E    GEGL+ +DL SLLD
Sbjct: 294 SWIDEGLATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 70/114 (61%), Gaps = 8/114 (7%)

Query: 4   HEDKENLVTSAG-RGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLKTS 62
           +E KEN+++       +  RTP++Q+KR+ S + G    R PLASKD N++Q +  +K +
Sbjct: 3   NEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRG---NRRPLASKDNNRTQSILSVKNN 59

Query: 63  XXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKDT 116
                       KRPASS   KNMP++KLKKYGSVLG+    + + KSLVLKDT
Sbjct: 60  AALGKSDHPL--KRPASS-FMKNMPENKLKKYGSVLGMN-TFMPRTKSLVLKDT 109

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 174 QEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215
           +ED   +EYAP++  ELP++PNGY+      + KL  + SPF
Sbjct: 151 KEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPF 192

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 113/321 (35%), Gaps = 90/321 (28%)

Query: 1   MKKHEDKENLVTSAGR---GAMMPRTPIHQLKRSSSNL---------------------- 35
           M  +EDKEN +   G    G   P+TP H LKRS SN+                      
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 36  -----------------AGRNSTRMPLASKDRNQS--------------------QGVFG 58
                              +   R+PLA+KD N+S                    Q    
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121

Query: 59  LKTSXXXXXXXXXXXSK-RPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKDTS 117
           ++ +           S+ R   + +  N    KL+KYGSVLG  Y +L K KSLVLKD +
Sbjct: 122 IRKNDQLRKLSQISRSRSRANHNDLLSNS--RKLQKYGSVLG--YNALPKMKSLVLKDLA 177

Query: 118 DCXXXXXXXXXXXGNP-----LAAKLKSRLCXXXXXXXXXX--------------XXXXX 158
           D            GN      L  KL+S L                              
Sbjct: 178 DSGKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIK 237

Query: 159 XXXXXXXXXXXXXXTQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRF 218
                          + D   +E AP++   LP+VP GY   +  D+ KL  ++SP+   
Sbjct: 238 NSTKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKL- 296

Query: 219 GDKEDEENTEPGDSQQLIPLE 239
            D EDE++T   D   L+PLE
Sbjct: 297 -DLEDEDDT--PDKVDLLPLE 314

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 105/258 (40%), Gaps = 58/258 (22%)

Query: 2   KKHEDKEN-LVTSAGRGA--MMPRTPIHQLKRSSSNLAG----------------RNSTR 42
           K  ++KEN +V   G      +P+TPIH LKRS  N+                  R   R
Sbjct: 4   KVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRR 63

Query: 43  MPLASKDRNQSQGVFGLKTSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGY 102
           +PLASKD N+S     +K              ++P       + P  KL+KYGSVL  GY
Sbjct: 64  LPLASKDHNKSSAAGPVK-------------KRQPTLQGELLSNP-RKLQKYGSVL--GY 107

Query: 103 GSLAKAKSLVLKDTSDCXXXXXXXXXXXGNPLAAKLKSRLCXXXXXXXXXXXXXXXXXXX 162
             L + KSLVLKD  D               L   +  R                     
Sbjct: 108 TDLPRTKSLVLKDGDDEDDDEEEENSELQKKLQDAMNRR---------------EDSNEG 152

Query: 163 XXXXXXXXXXTQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRF-GDK 221
                     T++D   +EYAP +LP L + P+G+   +  D+ KL K     LR   D+
Sbjct: 153 LGGLAKLVRDTKDD---IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD---LRIRDDQ 206

Query: 222 EDEENTEPGDSQQ-LIPL 238
           +D E+ EP ++   L+PL
Sbjct: 207 DDHEDNEPQENDDGLLPL 224

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 96/379 (25%), Positives = 136/379 (35%), Gaps = 89/379 (23%)

Query: 1   MKKHEDKENLVTSAGR---GAMMPRTPIHQLKRSSSNL-----------------AGRN- 39
           M  +EDKEN +   G        P+TP H LKRS SN+                 +G+N 
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 40  ---------------------STRMPLASKDRNQSQG-VFGLKTSXXXXXXXXXXXSKRP 77
                                  R+PLA+KD N+S+  VF L+T+            +  
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 78  AS----------SSIAKNMP----------DSKLKKYGSVLGVGYGSLAKAKSLVLKDTS 117
            S          S +++N              KL+KYGSVLG  Y +L K KSLVLKD +
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLG--YNALPKMKSLVLKDLA 178

Query: 118 DCXXXXXXXXXXXG-----NPLAAKLKSRLCXXXXXXXXXXXXX-----------XXXXX 161
           D            G     N L+ KL+S                                
Sbjct: 179 DPAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIK 238

Query: 162 XXXXXXXXXXXTQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDK 221
                         D   +E AP++   LP+VP+GY   +  D+ KL  ++SP+     +
Sbjct: 239 NTAKGKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPY-GLDLE 297

Query: 222 EDEENTEPGDSQQLIPL-EFGALXXXXXXXXXXXXXXNGAALGAIALSQEEPDE-----V 275
            +  NT   D   L+ L E                    A L ++AL   E D+     +
Sbjct: 298 GNSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAEL-SLALQNSEDDDNAAMPL 356

Query: 276 QFEFAVGEGLDSKDLHSLL 294
                 GEGLDS++L  LL
Sbjct: 357 IESLYNGEGLDSEELEDLL 375

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 113/320 (35%), Gaps = 89/320 (27%)

Query: 1   MKKHEDKENLVTSAGRGAM---MPRTPIHQLKRSSSNL---------------------- 35
           M  +EDKEN +  +G G+     P+TP H LKRS SN+                      
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 36  -----------------AGRNSTRMPLASKDRN----------------------QSQGV 56
                              +   R+PLA+KD N                      Q Q  
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 57  FGLKTSXXXXXXXXXXXSK-RPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKD 115
             ++ +           ++ R   S +  N    KL+KYGSVLG  Y +L K KSLVLKD
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNT--RKLQKYGSVLG--YNALPKMKSLVLKD 176

Query: 116 TSDCXXXXXXXXXXXG-----NPLAAKLKSRLCXXXXXXXXXXXX-----------XXXX 159
             D            G     N L+ KL++ L                            
Sbjct: 177 LVDPGKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQL 236

Query: 160 XXXXXXXXXXXXXTQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFG 219
                           D   +E AP++L  LP+VP+GY   +  D+ KL  ++SP+    
Sbjct: 237 IKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYEL-- 294

Query: 220 DKEDEENTEPGDSQQLIPLE 239
           D ED+  +   D   L+PLE
Sbjct: 295 DLEDDGGS--TDKVDLLPLE 312

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 96/256 (37%), Gaps = 30/256 (11%)

Query: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAG----RNSTRMPLASKDRNQSQGV 56
           M +HEDKEN + S    + +P TP H L RS S +      R   R PLASKD N+S   
Sbjct: 1   MGRHEDKENSIWSE---SNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSY 57

Query: 57  FGLKTSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKD- 115
            G K               RP  +     + +++L   G    +      K KSLVLKD 
Sbjct: 58  LGTKEPLRKRT--------RPGVNHAGSFVGNARL---GPAPTLNASGAPKIKSLVLKDG 106

Query: 116 -----TSDCXXXXXXXXXXXGNPLAAKLKSRLCXXXXXXXXXXXXXXXXXXXXXX----X 166
                +               N LAAKL+++L                            
Sbjct: 107 IEEEGSQSEGAEVDEDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPK 166

Query: 167 XXXXXXTQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYH-SPF-LRFGDKEDE 224
                   +    VE  P +   LPHVP GY      ++AKL     SPF L F   +++
Sbjct: 167 LSQRAEESDSDQEVEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFSGVDED 226

Query: 225 ENTEPGDSQQLIPLEF 240
           E+    DS QL  L F
Sbjct: 227 EDINSQDSTQLFTLNF 242

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 92/252 (36%), Gaps = 38/252 (15%)

Query: 1   MKKHEDKEN---LVTSAGRGAMMPRTPIHQLKRSSS------------NLAGRNST---- 41
           M  +E+KEN   L      G   P+TP H LKRS S            NL  R+      
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60

Query: 42  -----------RMPLASKDRNQSQGVFGLKTSXXXXXXXXXXXS---KRPASSSIAKNMP 87
                      R PLASKD N+S G                  S   KR A+    + + 
Sbjct: 61  RASPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLT 120

Query: 88  D-SKLKKYGSVLGVGYGSLAKAKSLVLKDTSDCXXXXXXXXXXXGNPLAAKLKSRLCXXX 146
           +  +LKKYGSVLG  Y +L K KSLVLKD                     +LK       
Sbjct: 121 NPRRLKKYGSVLG--YNALPKMKSLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDR 178

Query: 147 XXXXXXXXXXXXXXXXXXXXXXXXXXTQEDVP--PVEYAPEKLPELPHVPNGYESLKSAD 204
                                      ++D     +EY P++   LP++P G+ SL   D
Sbjct: 179 SDEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQED 238

Query: 205 LAKLAKYHSPFL 216
             KL  + SP+L
Sbjct: 239 YDKLKTFRSPYL 250

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 80/228 (35%), Gaps = 28/228 (12%)

Query: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAG----RNSTRMPLASKDRNQSQGV 56
           M   E+KEN + S      +P TP H L RS S +      R   R PLASKD N+S G 
Sbjct: 1   MGARENKENAIWSE---RSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGF 57

Query: 57  FGLKTSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKDT 116
            G K                 A S I    P       G V  +      + KSLVLKD 
Sbjct: 58  LGAKEPLRKRTRPTVNH----AGSFIGNTRP-------GVVPILNTNGAPRIKSLVLKDD 106

Query: 117 SD---CXXXXXXXXXXXGNPLAAKLKSRLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 173
            +                N LAAKL+ +L                              +
Sbjct: 107 IEEEQSQSDGGEAEDDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANTKLHS 166

Query: 174 Q-----EDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYH-SPF 215
           +      D+  VE  P +   LPH+P+GY      D+ KL     SPF
Sbjct: 167 ETLDSDSDL-EVEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPF 213

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 32/134 (23%)

Query: 6   DKENLVTSAGRGAMMPRTPIHQLKRSSSNLAGRNST----------------------RM 43
           +KEN+ T+       PRTP  QLKR SSN+   NST                      R 
Sbjct: 4   NKENIFTA-------PRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARR 56

Query: 44  PLASKDRNQSQGVFGLKTSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGYG 103
           PLASKD+N  +   G +             S      +    +P ++LKKYGSVLG    
Sbjct: 57  PLASKDKNVRRTALG-QVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGSVLGYSNN 115

Query: 104 SLAK--AKSLVLKD 115
           ++    +K+L+LKD
Sbjct: 116 TINSNASKTLILKD 129

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 69/178 (38%), Gaps = 65/178 (36%)

Query: 1   MKKHEDKENLVTSAGR---GAMMPRTPIHQLKRSSSNL---------------------- 35
           M  +EDKEN +   G    G   P+TP H LKRS SN+                      
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 36  -----------------AGRNSTRMPLASKDRNQSQG-VFGLKTSXXXXXXXXXXXSKRP 77
                              +   R+PLA+KD N+S+  VF  +T+            +  
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 78  AS----------SSIAKNMPDS----------KLKKYGSVLGVGYGSLAKAKSLVLKD 115
            S          S I++N   +          KL+KYGSVLG  Y +L K KSLVLKD
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLG--YNALPKMKSLVLKD 176

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 183 APEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215
           AP++   LP+VP+GY S +  D+ KL  ++SP+
Sbjct: 262 APQRQEPLPYVPDGYPSFQREDIEKLRTFNSPY 294

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 180 VEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEP--GDSQQLIP 237
           +EYAP +   LP++P GY    + D+ KL  YHSPF    D  D + +    GD + L+ 
Sbjct: 276 IEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLS 335

Query: 238 LE 239
           L+
Sbjct: 336 LQ 337

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 61/161 (37%), Gaps = 70/161 (43%)

Query: 5   EDKENLVT--------SAGRGAMMPRTPIHQLKRSSS----------------------- 33
           EDKEN  T         +G+  + P+TP H LKRSSS                       
Sbjct: 14  EDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAG 73

Query: 34  ------NLAGRN-----STRMPLASKDRNQSQGVFGLKTSXXXXXXXXXXXSKRPASSSI 82
                 N++ R        R PL+ KD N S   F LK                      
Sbjct: 74  AGAVPPNISPRRQLLQLQNRFPLSKKDNNNS---FILKQQ-------------------- 110

Query: 83  AKNMPDSKLKKYGSVLGVG-----YGSLAKAKSLVLKDTSD 118
            +     +LKKYGSVLG+G     + +L + KSLVLKD  D
Sbjct: 111 QQQFDHKRLKKYGSVLGLGTDGNNHNNLTRIKSLVLKDIDD 151

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 54/131 (41%), Gaps = 36/131 (27%)

Query: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQL------------KRSSSNLAGRNS----TRMP 44
           M+ +EDKEN V        +P+TP   +             R   + + R S     R+P
Sbjct: 1   MQDNEDKENAVA-------VPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLP 53

Query: 45  LASKDRNQSQGVFGLKTSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGVGYGS 104
           LASKD N S  V   K             S R             KLK+YGS+LG     
Sbjct: 54  LASKDNNASGLVVSGKLGRQPADQVREANSSR-------------KLKRYGSLLGYDNRQ 100

Query: 105 LAKAKSLVLKD 115
           L ++KSL+LKD
Sbjct: 101 LTRSKSLILKD 111

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 180 VEYAPEKLPELPHVPNGYESLKSADLAKLAKY 211
           +E  P+   ELP++P+G+  L  AD+AKL  Y
Sbjct: 171 LEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 10/125 (8%)

Query: 174 QEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF-LRFGDKEDEENTEPGDS 232
            EDV  +E+     P+  ++P+ +      D+AKL  ++SPF L   + +DEE     DS
Sbjct: 188 NEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEE-----DS 242

Query: 233 QQLIPLEFGALXXXXXXXXXXXXXXNGAALGAIALSQEE--PDEVQFEFAVGEGLDSKDL 290
            +L+ L                      ++     S++    D +  E + GEGLDS DL
Sbjct: 243 SELLLL--ANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADILDIEPSYGEGLDSNDL 300

Query: 291 HSLLD 295
             LLD
Sbjct: 301 EDLLD 305

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 59/140 (42%), Gaps = 35/140 (25%)

Query: 5   EDKENLVTSAGRGAMMPRTPIHQLKRSSS--------NLAGRN------STRMPLASKDR 50
           ++KEN +        MP+TP + LKR+ S        ++ G N        R+PLASKD 
Sbjct: 3   QNKENNIFRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASKDN 62

Query: 51  NQSQGVFGLKTSXXXXXXXXXXXS----------------KRPASSSIAKNMPDSKLKKY 94
           N+S                    +                ++  S  +A    D KLKKY
Sbjct: 63  NRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSGILAD---DRKLKKY 119

Query: 95  GSVLGVGYGSLAKAKSLVLK 114
           GSVLG  Y +L K KSLVLK
Sbjct: 120 GSVLG--YNALPKVKSLVLK 137

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 59/142 (41%), Gaps = 53/142 (37%)

Query: 1   MKKHEDKENLVT------SAGRGAMMPRTPIHQL-KRSSSNLAGRNST------------ 41
           +  +EDKEN  T      S  +  +MP TP H L KRS S +   NS             
Sbjct: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELGNISPR 62

Query: 42  ---------RMPLASKDRNQSQGVFGLKTSXXXXXXXXXXXSKRPASSSIAKNMPDSKLK 92
                    R+PLA KD N S                    S++   ++I K      LK
Sbjct: 63  RRQLLQLQNRLPLAKKDNNNS-----------------SFSSRKNGLNNIKK------LK 99

Query: 93  KYGSVLGVGYGSLAKAKSLVLK 114
           KYGSVLG+   +L + KSL+LK
Sbjct: 100 KYGSVLGM--DALPRTKSLILK 119

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 180 VEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLE 239
           +EYAP +   LP VP GY      D+ KL  +HS +     K D   +   D+ +L+ LE
Sbjct: 215 IEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSY-----KLDSPVSTVEDADKLLALE 269

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 22/119 (18%)

Query: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLK 60
           M    DKEN +++          P+  L+  ++N   +N+T   ++   R Q QG   L+
Sbjct: 1   MSNQSDKENNLST---------IPVLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQ 51

Query: 61  TSXXXXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLGV---GYGSLAKAKSLVLKDT 116
           +              +  S  I+    ++++KKYGS+LG+   G   L K KSL+LKD 
Sbjct: 52  S----------KNGNKSNSILISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKDN 100

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 87/245 (35%), Gaps = 38/245 (15%)

Query: 6   DKENLVTSAGRGAMMPRTPIHQLKRSSSNLA-GRNSTRMPLASKDRNQSQGVFGLKTSXX 64
           DKEN V    R    P TP   LKR+ S L   +N  R PLASKD+N ++    L     
Sbjct: 7   DKENNVVGTLR-EKGPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYL----- 60

Query: 65  XXXXXXXXXSKRPASSSIAKNMPDSKLKKYGSVLG-VGYGSLAKAKSLVLKDTSD----- 118
                           S+ +N    KLK   +  G     +  +  SL+LKD +      
Sbjct: 61  ----------------SLKRNSNQKKLKPAVTRAGSTANNANRRVTSLILKDIASGDEKE 104

Query: 119 CXXXXXXXXXXXGNPLAAKLKSRLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQEDVP 178
                        NPLA K+K  L                               +    
Sbjct: 105 SASESDSEDDEESNPLALKIKQALTHSIASAEGKTGLLNGKSGLRKIFNDRDLDRE---- 160

Query: 179 PVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLR---FGDKEDEENTEPGDSQQL 235
            +E A  + PE P+ P GYE L  +DL KL K  +   R     D     +    DS QL
Sbjct: 161 -IEVASVREPEKPYEPEGYEPLDDSDLEKL-KLKNAINRPTFIMDSPRAISIVGDDSPQL 218

Query: 236 IPLEF 240
           +PL+ 
Sbjct: 219 LPLDL 223

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,112,108
Number of extensions: 799415
Number of successful extensions: 1611
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1598
Number of HSP's successfully gapped: 41
Length of query: 295
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 186
Effective length of database: 40,982,805
Effective search space: 7622801730
Effective search space used: 7622801730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)