Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR082C8.266ON26626613070.0
Ecym_43048.266ON2892844351e-51
TDEL0F039308.266ON2802523662e-41
Kwal_56.237778.266ON2672653485e-39
ZYRO0C01562g8.266ON2772523495e-39
KLLA0F19228g8.266ON3052723429e-38
SAKL0H16940g8.266ON3032643211e-34
KLTH0G13596g8.266ON2671722901e-30
Kpol_392.48.266ON2811652151e-19
KAFR0B027408.266ON2562541973e-17
NDAI0B020108.266ON2812611975e-17
Smik_12.1508.266ON2922931668e-13
YLR091W (GEP5)8.266ON2932721482e-10
Suva_10.1758.266ON2992771448e-10
NCAS0B050408.266ON2732631402e-09
TPHA0J007608.266ON2492231304e-08
KNAG0G020608.266ON2861791304e-08
Skud_12.1598.266ON2942771243e-07
CAGL0L12320g8.266ON278108721.1
KAFR0C04240singletonON34392711.3
Ecym_72844.58ON19839673.6
CAGL0B01397g3.6ON51474666.5
KLTH0E03476g5.383ON147458667.5
ZYRO0A10472g8.592ON40776657.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR082C
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   508   0.0  
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   172   1e-51
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   145   2e-41
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   138   5e-39
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   139   5e-39
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   136   9e-38
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   128   1e-34
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   116   1e-30
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    87   1e-19
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    80   3e-17
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...    80   5e-17
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    69   8e-13
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    62   2e-10
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    60   8e-10
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...    59   2e-09
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    55   4e-08
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    55   4e-08
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    52   3e-07
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    32   1.1  
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               32   1.3  
Ecym_7284 Chr7 (594277..594873) [597 bp, 198 aa] {ON} similar to...    30   3.6  
CAGL0B01397g Chr2 (127374..128918) [1545 bp, 514 aa] {ON} simila...    30   6.5  
KLTH0E03476g Chr5 complement(311391..315815) [4425 bp, 1474 aa] ...    30   7.5  
ZYRO0A10472g Chr1 (846938..848161) [1224 bp, 407 aa] {ON} simila...    30   7.9  

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/266 (95%), Positives = 253/266 (95%)

Query: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLV 60
           MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLV
Sbjct: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLV 60

Query: 61  FHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVL 120
           FHVHFQLMLRAP             QRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVL
Sbjct: 61  FHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVL 120

Query: 121 QQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEI 180
           QQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEI
Sbjct: 121 QQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEI 180

Query: 181 GMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECPTRAMRRIY 240
           GMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECPTRAMRRIY
Sbjct: 181 GMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECPTRAMRRIY 240

Query: 241 LRACRRAYVLDADAQLFRVSRLRHFI 266
           LRACRRAYVLDADAQLFRVSRLRHFI
Sbjct: 241 LRACRRAYVLDADAQLFRVSRLRHFI 266

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  172 bits (435), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 148/284 (52%), Gaps = 24/284 (8%)

Query: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLV 60
           MN  +  IVSRLPLH  T +VI   +     +   +R++++EP+N +L  G    L+R++
Sbjct: 4   MNRKVLEIVSRLPLHAHTKKVIADNVG-SVGKGEFKRVDVIEPINRYLLSGEVSYLRRVI 62

Query: 61  FHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVL 120
           F V+F+++                 Q FWPYERH  LL+       S R LW     +VL
Sbjct: 63  FDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVL 122

Query: 121 QQMQYCRHHWLREGDVP----------------------ERYALTQAQREEVLHRVFAQY 158
             M+Y RH WLR+ +                        ++  L + +R  +L  +F+ Y
Sbjct: 123 DIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHY 182

Query: 159 MFLKQRPALWSVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTP 218
           +F+K RP L   + LPIP+VE+GM+PLG D+PDVR+D LF+ ++K+ L+ L  + P L+ 
Sbjct: 183 LFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSR 242

Query: 219 AAEEDMLRIIAECPTRAMRRIYLRACRRAYVLDADAQLFRVSRL 262
             E  +  II EC  R+M R+Y  +C  AY +D     F VS L
Sbjct: 243 EVESLLHSIIKEC-DRSMGRLYKWSCNGAYTMDPKTNQFEVSSL 285

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  145 bits (366), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 132/252 (52%), Gaps = 9/252 (3%)

Query: 7   RIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGH----QGLQRLVFH 62
           + + +LPLH  T +++   L   + +  T  I L + +++           + L+ +++H
Sbjct: 11  KALEKLPLHSKTLDLLACKLKGDELK--TVIIPLAKLVSNLESSRAETQRIKALESIIYH 68

Query: 63  VHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQ 122
            HF      P                WPYERH S+L +   RS SLR  WED  + VL  
Sbjct: 69  THFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSKTVLSM 128

Query: 123 MQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSV-RRLPIPVVEIG 181
            +Y ++ W+ +  + ++  LT  QR+ + H VF+ Y+FLK  P L +  R LPIP+VEI 
Sbjct: 129 AEYSKNPWIEDNILSKK--LTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIP 186

Query: 182 MTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECPTRAMRRIYL 241
           M PLG DI   R+  LFK K     R+L  E+P L+  +E  +  II++  +R  RR+Y 
Sbjct: 187 MRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDASSRKQRRLYQ 246

Query: 242 RACRRAYVLDAD 253
            +C+RAYV++ D
Sbjct: 247 ASCKRAYVMEYD 258

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  138 bits (348), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/265 (34%), Positives = 137/265 (51%), Gaps = 20/265 (7%)

Query: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLV 60
           MN  IQ ++ +LPL   T ++I   L +       E +  +E    +  K  ++ L+ ++
Sbjct: 1   MNRGIQ-VLEKLPLDVRTLKLIEKRLER------AESLRFLELARQYEAKKDYKTLENII 53

Query: 61  FHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVL 120
            H +F      P             + FWPYE H ++L +   +SQS+R LW  G   VL
Sbjct: 54  HHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVL 113

Query: 121 QQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRR-LPIPVVE 179
             M+Y  + W REG   ER  LT+ +R    H +F  ++FL++RP L   R+ L +P+VE
Sbjct: 114 AAMRYGSYGWNREGG-GER--LTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVE 170

Query: 180 IGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECP------- 232
           I M PLG +I DVR+  LFK K   V R+L  ++PAL+ A  E +L  I E P       
Sbjct: 171 IPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALS-AENESLLMDIIESPQLPQGQT 229

Query: 233 -TRAMRRIYLRACRRAYVLDADAQL 256
            +R ++R+Y RACR AYV+     L
Sbjct: 230 SSRMLKRLYQRACRGAYVIKPHPTL 254

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  139 bits (349), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 138/252 (54%), Gaps = 8/252 (3%)

Query: 5   IQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLVFHVH 64
           + R + +LPLH  T +V+  Y   + + Y +  + + + +++F +   H+ L+ L+   H
Sbjct: 13  LSRSIRQLPLHIETQKVLEFYC--RNSSYKS--LLVAQDISEFEKHNDHKYLEALIQKTH 68

Query: 65  FQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQ 124
           F      P                WPYE   SLL++S+ R +S   LW DG+E  L  ++
Sbjct: 69  FLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLR 128

Query: 125 YCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPAL-WSVRRLPIPVVEIGMT 183
           + +H W  E ++ ER  L+  Q  ++LH +F QY FLK    L ++ R++P+P+VEI + 
Sbjct: 129 FEKHRWADE-NIIER--LSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLR 185

Query: 184 PLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECPTRAMRRIYLRA 243
           P+G D+ D R+  LFK KT  V  LL  E+  L+   E+ +  II +  TR+MRR+Y RA
Sbjct: 186 PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSETRSMRRLYQRA 245

Query: 244 CRRAYVLDADAQ 255
            RRAYV+  + +
Sbjct: 246 SRRAYVVTNEGK 257

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  136 bits (342), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 125/272 (45%), Gaps = 29/272 (10%)

Query: 14  LHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLVFHVHFQLMLRAPX 73
           LH  T + I    SK       ++ E +  LN F      + L++LV+ VHF L+   P 
Sbjct: 15  LHSITKDAI----SKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLNDPPK 70

Query: 74  XXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQYCRHHWLRE 133
                        +FWPYE  HS+L + D    S   LW    ++ L  + + RH WLR 
Sbjct: 71  HVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLSFNRHKWLRP 130

Query: 134 GD----------------------VPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVR 171
            +                      + E   L   + +E L ++F  Y FLK  P L + +
Sbjct: 131 KNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFLKTNPKLCATK 190

Query: 172 RLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAEC 231
           +L  P+VEIGM P GFDI D+R+D LFK K K +  LLY ++P LT  AE  +  I+ + 
Sbjct: 191 KLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAESILTSIVNDP 250

Query: 232 P-TRAMRRIYLRACRRAYVLDADAQLFRVSRL 262
              R  +R+Y     R+Y+   D + F +S L
Sbjct: 251 DLNRRTKRLYKNVASRSYLF-KDGK-FEISEL 280

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  128 bits (321), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 125/264 (47%), Gaps = 37/264 (14%)

Query: 40  LVEPLNDFLRKGGHQGLQRLVFHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLA 99
           L + L D+      + L+ +V++ +F      P             +  WPYERH  LL+
Sbjct: 39  LEQKLFDYQANENSKSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLS 98

Query: 100 LSDVRSQSLRRLWEDGQEEVLQQMQYCRHHWLREGDVPERYALT-------QAQREE--- 149
           +S     S+R +W D  ++VL  M++ R+ W R   + +  A         QA  EE   
Sbjct: 99  MSAPERVSIRHMWNDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNR 158

Query: 150 -----------------VLHRVFAQYMFLKQRPALWSV-RRLPIPVVEIGMTPLGFDIPD 191
                            + H +F  YMFLK+ P L    ++LPIP+VEI M PLG DIP 
Sbjct: 159 GSMLSTLPKISQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPL 218

Query: 192 VRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIA------ECPTRAMRRIYLRACR 245
           VR+  LFK K  +  +LL  E+P L+   E  +L IIA          R ++R+Y RAC+
Sbjct: 219 VRIRNLFKRKAAATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACK 278

Query: 246 RAYVLDADAQL---FRVSRLRHFI 266
            +YV+  D  +   F++S+L   I
Sbjct: 279 HSYVICEDRSIGLDFQISKLSKNI 302

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  116 bits (290), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 98/172 (56%), Gaps = 13/172 (7%)

Query: 89  WPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQYCRHHWLREGDVPERYA-LTQAQR 147
           WPYE H S+L++   ++QS+R LW     +VL +M Y ++      D  ER + LT+ QR
Sbjct: 82  WPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEKY----AHDTEERPSRLTELQR 137

Query: 148 EEVLHRVFAQYMFLKQRPALWSVRR-LPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVL 206
               H VF  ++FLK RP L   R+ L +P+VEI M PLG +IP+VRV  LFK K   V 
Sbjct: 138 TVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVW 197

Query: 207 RLLYREHPALTPAAEEDMLRIIAE-------CPTRAMRRIYLRACRRAYVLD 251
           ++L  + PAL+   E  + +II            R ++R+Y RACR AY ++
Sbjct: 198 KVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTIE 249

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 83/165 (50%), Gaps = 5/165 (3%)

Query: 89  WPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQY-CRHHWLREGDVPERYALTQAQR 147
           WPYE H  +L ++   + SL  L  +  +      +    + W    D   +Y LT  QR
Sbjct: 104 WPYEFHSDVLNMARPGTGSLIYLCLNNDDRFFNFYKSQINNKWFNSVD---QYKLTDEQR 160

Query: 148 EEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLR 207
             + + +F Q  FLK+   +  V +  +P+VE+ + P+G DIP  R+  LF  K   + +
Sbjct: 161 VSIYNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWK 220

Query: 208 LLYREHPALTPAAEEDMLRIIAECP-TRAMRRIYLRACRRAYVLD 251
           LL    PA++ + E+ ++ I+ +    R + R+Y R+ + +YV D
Sbjct: 221 LLSLSSPAISLSHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFD 265

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/254 (21%), Positives = 115/254 (45%), Gaps = 28/254 (11%)

Query: 3   EHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLVFH 62
           + I   +  LPLH+ T   +   L +  A      I L+  +  +   G  + L+ +++ 
Sbjct: 18  DKITNAIEGLPLHQKTLLQLQDTLKRNDALA----IPLLRDVVSYETTGKSKFLESIIYR 73

Query: 63  VHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQ 122
           ++FQ +   P             +  WP ERH                 +++ + E +  
Sbjct: 74  LYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIK---------------FKNAEPEAIS- 117

Query: 123 MQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEIGM 182
               R+ W+R     +  A+  +  + V+  +   + +L+        +++ +P++E+ +
Sbjct: 118 ---LRNAWMRN----KATAVDLSTSDGVIKPILNHFRYLRVNEDRLCKKKVGLPILEVPL 170

Query: 183 TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECP-TRAMRRIYL 241
              G +IP+ RV+ L K +   V + L  ++P L+P  E+ +  II +   TRA++R+YL
Sbjct: 171 NVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYL 230

Query: 242 RACRRAYVLDADAQ 255
           R+C RAY  +++ +
Sbjct: 231 RSCSRAYTGESNPK 244

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score = 80.5 bits (197), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 112/261 (42%), Gaps = 33/261 (12%)

Query: 11  RLPLHRAT-SEVILAYLSKQQAQYPTERIELVEPLNDFLR-------KGGHQGLQRLVFH 62
            LPLH  T +++    L++      + +I L+  +N + +       K  ++ L+ +++H
Sbjct: 18  NLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYH 77

Query: 63  VHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQE----- 117
            +F+                     FWP+  H  +    D +  S+   W          
Sbjct: 78  TYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSIILTWNKSSNSKNML 133

Query: 118 -EVLQQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSV-RRLPI 175
            E+L  + Y       +  VP++        + +  +++  Y+FL   P+L S  +RLP 
Sbjct: 134 RELLSHLNYT------QSLVPQKKDF-----QVIFKKIYQHYIFLSLNPSLCSNGKRLPS 182

Query: 176 PVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRII---AECP 232
           P+VEI M  +G+DIP  R++ L + K       L   +P L    E  +  II   +   
Sbjct: 183 PIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIINGSSAIK 242

Query: 233 TRAMRRIYLRACRRAYVLDAD 253
           +R +R++Y RAC  +YV+  +
Sbjct: 243 SRQLRKLYRRACSNSYVIKNE 263

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 127/293 (43%), Gaps = 34/293 (11%)

Query: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR----------- 49
           +N+ +  ++  +PLH+ T   ++  L+  Q+ Y  +  E+  PL   L+           
Sbjct: 5   VNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFK--EIAVPLTKLLQVHEKAQRRQDL 62

Query: 50  KGGHQGLQRLVFHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLAL-----SDVR 104
           +   + L+ +++  HF+     P                WP+E H  L+         + 
Sbjct: 63  RTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLN 122

Query: 105 SQSLRRLWEDGQEEVLQQMQYCRHHWLREGDVPERYALTQ-----AQREEVLHRVFAQYM 159
           S   +  W       L Q+   ++ W++    P+  + T       +R  +++ +  QY 
Sbjct: 123 SIPSKTTWLKADWATLFQV---KNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYK 179

Query: 160 FLKQRPAL-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALT 217
           FL     L ++ ++ P P V+I +   LG   P  ++  LF  +   +   L+ E+P L+
Sbjct: 180 FLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLS 239

Query: 218 PAAEEDMLRIIAE-CPTRAMRRIYLRACRRAYVL-DADAQL----FRVSRLRH 264
           PA +  ++ I  +    R  +R+Y+RAC RAY + +AD+ +    FR ++  H
Sbjct: 240 PANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWDH 292

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 118/272 (43%), Gaps = 30/272 (11%)

Query: 8   IVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR-----------KGGHQGL 56
           ++   PLH+ T   +   L+ +Q+ Y  + I +  PL   L+           +   + L
Sbjct: 12  VIESTPLHQITKVALTTTLTSKQSDYKFKEIAV--PLTKSLQLYEKAQRRQDLRASLKAL 69

Query: 57  QRLVFHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSL---LALSD--VRSQSLRRL 111
           + +++  HFQ     P                WP+E H  L   +A+++  + S S R +
Sbjct: 70  ESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSSRSV 129

Query: 112 WEDGQEEVLQQMQYCRHHWLREGDVPERYALTQ-----AQREEVLHRVFAQYMFLKQRPA 166
           W       L  +   ++ W++      R + T       +R  +++ +   Y FL     
Sbjct: 130 WLKADWITLFNV---KNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKFLIANSH 186

Query: 167 L-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDM 224
           L ++ ++ P P V+I +   LG   P  ++  LF  +   + + L+ E+P L+P  E  +
Sbjct: 187 LSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSPENELAL 246

Query: 225 LRII-AECPTRAMRRIYLRACRRAY-VLDADA 254
             +   E   R +RR+Y+RAC RAY   +AD+
Sbjct: 247 TAVFYDETVERRLRRLYMRACARAYTTTNADS 278

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 115/277 (41%), Gaps = 33/277 (11%)

Query: 8   IVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR-----------KGGHQGL 56
            +  LPLH+ T   +   L+   + +  + I +  PL + L+           +   + L
Sbjct: 12  FIDSLPLHQITKTALTTRLTDIHSDFKFKEIAV--PLTESLQVYEKAQRAQDLRTSLKAL 69

Query: 57  QRLVFHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDGQ 116
           + +V+  HFQ     P                WP+E H SL+     ++  L  L   G 
Sbjct: 70  ESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTSKGN 129

Query: 117 --EEVLQQMQYCRHHWLR-------------EGDVPERYALTQAQREEVLHRVFAQYMFL 161
             +     +   ++ W+R             +  + E  A T A+R  ++  +   Y FL
Sbjct: 130 WLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFT-AERTFLVKSLGNHYKFL 188

Query: 162 KQRPAL-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPA 219
                L ++ ++ P PVV+I +   LG   P  ++  LF  +   +   L+ E+P L+ A
Sbjct: 189 VTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVENPPLSTA 248

Query: 220 AEEDMLRIIAECP-TRAMRRIYLRACRRAYVL-DADA 254
            E  ++ +  +    R   R+Y+RAC RAY + +AD+
Sbjct: 249 NELALMTVFDDGTLERRHTRLYMRACARAYTIANADS 285

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 106/263 (40%), Gaps = 31/263 (11%)

Query: 7   RIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFL-----------RKGGHQG 55
           R +  +PLHR T +++   +  Q A   + R     PL   L           ++G  + 
Sbjct: 11  RSLPNVPLHRKTLDLLERKI--QTANDKSTRHSFKVPLLQLLCKYERYNIQEDKRGIEKV 68

Query: 56  LQRLVFHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWEDG 115
           L+ + ++ +F      P             +R+WP   H  +    D +  S+       
Sbjct: 69  LESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGM----DTKRDSI------- 117

Query: 116 QEEVLQQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWS-VRRLP 174
              ++Q  +      L +G +        A+   +  ++F  Y+FL     + S  +RL 
Sbjct: 118 ---IVQWAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHYIFLTLNARITSNAKRLQ 174

Query: 175 IPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIA---EC 231
            P+V + M  +G  IP VRV  LF+ K       L   +P L       +  II    E 
Sbjct: 175 PPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEIINADYEN 234

Query: 232 PTRAMRRIYLRACRRAYVLDADA 254
            +R++RR+Y RA + A+V+  ++
Sbjct: 235 TSRSLRRLYQRASKNAHVIAGES 257

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 95/223 (42%), Gaps = 35/223 (15%)

Query: 9   VSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPL----NDFLRK---GGHQGLQRLVF 61
           ++RLPLH  T    L  L KQ     T+  EL+E L    N F+ K   G  + LQR++F
Sbjct: 25  LNRLPLHPNT----LDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIF 80

Query: 62  HVH--FQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDV--RSQSLRRLWEDGQE 117
             H  F    +                  WPYERH  L A +     +++L  LW +   
Sbjct: 81  KTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNS 140

Query: 118 EVLQQM---------QYCRHHWLREGD-----VPERY-----ALTQAQREEVLHRVFAQY 158
           + L  M         +  ++ ++ EGD     + ERY      L++   E+ +       
Sbjct: 141 DNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGE 200

Query: 159 MFLKQRPALWSVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDK 201
           +F KQ   + ++ +L IP+V + +  LG  IP  R+   FK K
Sbjct: 201 LF-KQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKK 242

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 70/179 (39%), Gaps = 20/179 (11%)

Query: 87  RFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQYCRHHWLREGDVPERYALTQAQ 146
           R WP E H SL   S     +L+  W    +  LQ            G++  R +L Q  
Sbjct: 100 RIWPRESHLSL-KQSTKGHATLKHAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQ-- 156

Query: 147 REEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVL 206
                  + + Y  L     ++   +L +PV EI +   G +IP  R   L + K   V 
Sbjct: 157 -------ILSHYQLLYNNMRMFGKIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVK 209

Query: 207 RLLYREHPAL--TPAAEEDMLRIIAECPT--------RAMRRIYLRACRRAYVLDADAQ 255
           R+L  E PAL  T    E    I  + P         R +RR+Y RA    Y L + AQ
Sbjct: 210 RVLIEELPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQ 268

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 111/277 (40%), Gaps = 33/277 (11%)

Query: 8   IVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR-----------KGGHQGL 56
            +  LPLHR T   +   L   Q+ Y  + I +  PL + L+           +   + L
Sbjct: 12  FIESLPLHRITKTALTTTLVGIQSDYKFKEIAV--PLTESLQVYEKAQRRQDLRTSLKAL 69

Query: 57  QRLVFHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLAL-----SDVRSQSLRRL 111
           + ++F  HFQ     P                WP+E H SL+         + S + +  
Sbjct: 70  ESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSMASKGT 129

Query: 112 WEDGQEEVLQQMQYCRHHWLREGDVPERYALTQA--------QREEVLHRVFAQYMFLKQ 163
           W       L Q+   ++ W++        A            +R  +++ +   Y FL  
Sbjct: 130 WLKADWTTLFQV---KNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNHYKFLVA 186

Query: 164 RPAL-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAE 221
              L ++ ++ P P V+I +   LG      ++  LF  +   +   L+ E+P L+   E
Sbjct: 187 NSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPPLSADNE 246

Query: 222 EDMLRII-AECPTRAMRRIYLRACRRAY-VLDADAQL 256
             ++ +   +   R  +R+Y+RAC RAY  +++D+ +
Sbjct: 247 LALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTI 283

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 55/108 (50%), Gaps = 16/108 (14%)

Query: 169 SVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALT-PAAEE---DM 224
           S R+ P+ + E  +TPLG    + +     +    S+ RLL  +HP L+ P A+E    +
Sbjct: 170 SFRQCPLTIRE--LTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTL 227

Query: 225 LRIIAECPT-RAMRRIYLRACRRAYV-------LDADAQL--FRVSRL 262
            R +    T R++ R YL+  +RAY         +A+AQL   RVS+L
Sbjct: 228 KRTLGTSRTDRSIARAYLQLLQRAYTYTYTYTDTEAEAQLQYSRVSQL 275

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 15/92 (16%)

Query: 113 EDGQEEVLQQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRR 172
           ED +EE  + ++YC  H LR  D  + Y+  ++++            FL +    +++RR
Sbjct: 36  EDDREEAFKILKYCYDHGLRTFDTADVYSNGESEK------------FLGEFLKRYNIRR 83

Query: 173 LPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKS 204
             + ++     P+  ++P+    G FKD   S
Sbjct: 84  ETVVILTKVYFPVDDELPEF---GGFKDLAAS 112

>Ecym_7284 Chr7 (594277..594873) [597 bp, 198 aa] {ON} similar to
           Ashbya gossypii AGL042W
          Length = 198

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 111 LWEDGQEEVLQQMQYCRHHWLREGDVPE-RYALTQAQRE 148
           L ++ QEE+ +++Q C H W   G+V E   A+ ++Q+E
Sbjct: 137 LMDNHQEEIAEKLQECGHLWSIHGNVEELCVAIVRSQKE 175

>CAGL0B01397g Chr2 (127374..128918) [1545 bp, 514 aa] {ON} similar
           to uniprot|Q08287 Saccharomyces cerevisiae YOL144w NOP8
           nucleolar protein required for 60S ribosome biogenesis
          Length = 514

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 11/74 (14%)

Query: 54  QGLQRLVFHVHFQLMLRAPXXXXXXXXXXXXXQRFWPYERHHSLLALSDVRSQSLRRLWE 113
           QGL+ + F ++    L+                + W YER      L  V   S  R W+
Sbjct: 144 QGLRNITFRLNVGGALKV---------YKCYKTKLWGYERDKDTRDL--VHKFSNHRFWK 192

Query: 114 DGQEEVLQQMQYCR 127
           DG + V++++ Y R
Sbjct: 193 DGSDHVVERLDYSR 206

>KLTH0E03476g Chr5 complement(311391..315815) [4425 bp, 1474 aa] {ON}
            some similarities with uniprot|Q05471 Saccharomyces
            cerevisiae YDR334W SWR1 Swi2/Snf2-related ATPase
            component of the SWR1 complex required for the
            incorporation of Htz1p into chromatin
          Length = 1474

 Score = 30.0 bits (66), Expect = 7.5,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1    MNEHIQRIVSRL--PLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGL 56
            + E +++++ R   PLH+  +++ +A+  K   QY   +++ +  L   L+ GGH+ L
Sbjct: 1166 LREDLKQVLRRTDNPLHKLQTKLAIAFPDKSLLQYDCGKLQKLATLLRDLKDGGHRAL 1223

>ZYRO0A10472g Chr1 (846938..848161) [1224 bp, 407 aa] {ON} similar
           to uniprot|P38292 Saccharomyces cerevisiae YBR168W PEX32
           Peroxisomal integral membrane protein involved in
           negative regulation of peroxisome size partially
           functionally redundant with Pex31p genetic interactions
           suggest action at a step downstream of steps mediated by
           Pex28p and Pex29p
          Length = 407

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 5/76 (6%)

Query: 125 YCRHHWL-REGDVPERYALTQAQREEVLHRVFAQYMFLKQRPA--LWSVRRLPIPVVEIG 181
           YCR H++   G  P    +T A    VLHR++   +      +  +W    L +P + + 
Sbjct: 34  YCRAHFIYHHGQKPSLTLVTPATMSSVLHRIYPLLLIADATLSNLMWICEDLCLPFIHLV 93

Query: 182 MTPL--GFDIPDVRVD 195
           M  +   F   D++VD
Sbjct: 94  MVLMVVNFLCEDLQVD 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,649,380
Number of extensions: 856969
Number of successful extensions: 2324
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2345
Number of HSP's successfully gapped: 25
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 65 (29.6 bits)