Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR081C8.267ON1301306751e-92
Ecym_43038.267ON1091043061e-36
KLLA0F19250g8.267ON1161112931e-34
Kwal_56.237768.267ON1301162923e-34
SAKL0H16918g8.267ON1111082695e-31
KLTH0G13574g8.267ON112752583e-29
TDEL0F039408.267ON1101102426e-27
ZYRO0C01540g8.267ON971162382e-26
TPHA0A017708.267ON104732331e-25
Kpol_543.428.267ON112812313e-25
NCAS0B038208.267ON115822159e-23
Suva_2.2748.267ON1051112104e-22
KAFR0B054908.267ON85602085e-22
YDR115W8.267ON105622071e-21
Smik_4.3598.267ON105522071e-21
Skud_4.3758.267ON105522052e-21
NDAI0J013408.267ON141522012e-20
CAGL0B01793g8.267ON98501973e-20
KNAG0H032208.267ON86741946e-20
TBLA0E044708.267ON94541947e-20
Skud_13.3788.722ON459118710.37
ZYRO0G18326g1.187ON42931633.4
KNAG0E031208.28ON127636634.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR081C
         (130 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...   264   1e-92
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...   122   1e-36
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...   117   1e-34
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...   117   3e-34
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...   108   5e-31
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...   103   3e-29
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    98   6e-27
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    96   2e-26
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    94   1e-25
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    94   3e-25
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    87   9e-23
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    86   4e-22
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    85   5e-22
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    84   1e-21
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    84   1e-21
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    84   2e-21
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    82   2e-20
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    80   3e-20
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    79   6e-20
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    79   7e-20
Skud_13.378 Chr13 complement(659681..661060) [1380 bp, 459 aa] {...    32   0.37 
ZYRO0G18326g Chr7 (1515959..1517248) [1290 bp, 429 aa] {ON} simi...    29   3.4  
KNAG0E03120 Chr5 (623076..626906) [3831 bp, 1276 aa] {ON} Anc_8....    29   4.9  

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score =  264 bits (675), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%)

Query: 1   MLTAPSDEHTVLHYTIVAHRTMFSMYRSMLQWSSRRTIMTVVSPVRKMAPVPQIQYGAIG 60
           MLTAPSDEHTVLHYTIVAHRTMFSMYRSMLQWSSRRTIMTVVSPVRKMAPVPQIQYGAIG
Sbjct: 1   MLTAPSDEHTVLHYTIVAHRTMFSMYRSMLQWSSRRTIMTVVSPVRKMAPVPQIQYGAIG 60

Query: 61  AFTPAAAPKPSMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRR 120
           AFTPAAAPKPSMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRR
Sbjct: 61  AFTPAAAPKPSMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRR 120

Query: 121 REKGRWYLTH 130
           REKGRWYLTH
Sbjct: 121 REKGRWYLTH 130

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score =  122 bits (306), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 80/104 (76%)

Query: 27  RSMLQWSSRRTIMTVVSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLSMLLGLTQKRWKS 86
           RS+LQW  RR+++T+VS    M  + Q    +    + +   +PS++S++ GL Q+RWKS
Sbjct: 6   RSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKS 65

Query: 87  RGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           RGNT+QPSTLKRKRRVGFLARARS+TG+ ILKRR+EKGRWYLT+
Sbjct: 66  RGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score =  117 bits (293), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 79/111 (71%), Gaps = 7/111 (6%)

Query: 27  RSMLQWSSRRTI--MTVVSPVRKMA-----PVPQIQYGAIGAFTPAAAPKPSMLSMLLGL 79
           R++LQW+S+RT+   +  SP+R +      P+ Q+    I   +   A   S+  ML  L
Sbjct: 6   RNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLFDL 65

Query: 80  TQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           TQ+RWKSRGNT+QPSTLKRKRRVGFLARARSR+G+ ILKRR+ KGRWYLT+
Sbjct: 66  TQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score =  117 bits (292), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/116 (57%), Positives = 81/116 (69%), Gaps = 9/116 (7%)

Query: 21  TMFSMYRSMLQWSSRR--TIMTVVSPVRKM---APVPQIQYG-AIGAFTPAAAPKPSMLS 74
           TM  +   + Q+S+RR  T M+  SP+      +PV Q+    A G+   +++  PS LS
Sbjct: 18  TMSFLSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGS---SSSAMPSYLS 74

Query: 75  MLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
            L GLTQKRWKSRGNTYQPSTLKRKRRVGFLAR +S+ G  ILKRRREKGRWYLTH
Sbjct: 75  SLFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score =  108 bits (269), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (67%), Gaps = 2/108 (1%)

Query: 25  MYRSMLQWSSRRTIMTV--VSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLSMLLGLTQK 82
           + + +  +S+RRT  T    SP+R +     + +         +    S++++LLGLTQ+
Sbjct: 4   LSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNNPLLSQSQSQQPSSIMNILLGLTQR 63

Query: 83  RWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           RWKSRGNTYQPSTLKRKRRVGFLARA+++    ILK R+EKGRWYLTH
Sbjct: 64  RWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score =  103 bits (258), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 58/75 (77%), Gaps = 5/75 (6%)

Query: 61  AFTPAAAPKPS-----MLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRN 115
           A  P AA + S     + S L G TQ+RWKSRGNTYQPSTLKRKRRVGFLARA+S+ G  
Sbjct: 38  AAAPMAAERSSQGSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYK 97

Query: 116 ILKRRREKGRWYLTH 130
           +LKRRREKGRWYLTH
Sbjct: 98  VLKRRREKGRWYLTH 112

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 97.8 bits (242), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 77/110 (70%), Gaps = 7/110 (6%)

Query: 25  MYRSMLQWSSRRTI--MTVVSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLSMLL--GLT 80
           + R  LQ ++RRT+  ++  SP+R +    + Q G +G   P      S +S+L   G+ 
Sbjct: 4   LARKPLQLNARRTLTSLSSFSPLRSLFAQNKSQ-GLLGV--PETHSPLSSISLLFPFGIM 60

Query: 81  QKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           Q+RWKSRGNT+QPSTLKRKRR+GFLARARS+TG  +L+RR+ KGRWYLT+
Sbjct: 61  QRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 96.3 bits (238), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (62%), Gaps = 26/116 (22%)

Query: 22  MFSMYRSMLQWSSRRTIMTV-------VSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLS 74
           M+S  R++ Q  +RR++ T+       VSP++++                     PS LS
Sbjct: 1   MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLL-------------------GPSPLS 41

Query: 75  MLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
              G+ Q+RWKSRGNT+QPSTLKRKRRVGFLARARS+ G  IL+RR+ KGRW+LTH
Sbjct: 42  SGFGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 94.4 bits (233), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (80%), Gaps = 3/73 (4%)

Query: 58  AIGAFTPAAAPKPSMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNIL 117
           AIG+ T  A+     L++ LGL Q+RWKSRGNTYQPSTLKRKRR+GFLARARS+ G  IL
Sbjct: 35  AIGSRTGLASILG--LNLDLGL-QRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKIL 91

Query: 118 KRRREKGRWYLTH 130
           +RR+ KGRWYLTH
Sbjct: 92  ERRKAKGRWYLTH 104

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 93.6 bits (231), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 60/81 (74%), Gaps = 4/81 (4%)

Query: 52  PQIQYGAIGAFTPAAAPKP--SMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARAR 109
           P     ++G F P  A     S ++ LLGL Q+RWKSRGNTYQPSTLKRKR+ GFLARAR
Sbjct: 34  PFAGLNSVGLF-PGTATNTFGSAITGLLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARAR 91

Query: 110 SRTGRNILKRRREKGRWYLTH 130
           SR+G  IL+RR+ KGRWYL+H
Sbjct: 92  SRSGSKILERRKAKGRWYLSH 112

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 87.4 bits (215), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 48/82 (58%), Positives = 56/82 (68%), Gaps = 5/82 (6%)

Query: 54  IQYGAIGAFTPAAA----PKPSMLSML-LGLTQKRWKSRGNTYQPSTLKRKRRVGFLARA 108
           I+ G  G  +P  +      P M S+L  G+ Q+RWKSRGNTYQPSTLKRKR+ GFLA+A
Sbjct: 34  IRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKA 93

Query: 109 RSRTGRNILKRRREKGRWYLTH 130
           R      ILKRRR KGRWYLTH
Sbjct: 94  RDSQKCKILKRRRLKGRWYLTH 115

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 85.5 bits (210), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (64%), Gaps = 11/111 (9%)

Query: 24  SMYRSMLQWSSRRTIMTVVSPVRKMAPV-PQIQYGAIGAFTPAAAPKPSMLSMLLG---L 79
           S++  + Q+ SRR + + +SP+  ++ + PQ       +    ++P  +M     G   +
Sbjct: 2   SLFGRLYQFQSRR-MFSSISPISALSVLRPQT------SMLLNSSPLKTMSLTPFGFGFI 54

Query: 80  TQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
            Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L+H
Sbjct: 55  GQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 84.7 bits (208), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%)

Query: 71  SMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           ++  +L    QKRWKSRGNTYQPSTLKRKR+ GFL+RA+S+    ILK R+EKGRWYL+H
Sbjct: 26  NVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 84.3 bits (207), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 70  PSMLSMLLGLT-QKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYL 128
           PS   +  GL  Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L
Sbjct: 44  PSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFL 103

Query: 129 TH 130
           +H
Sbjct: 104 SH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 84.3 bits (207), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (86%)

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           + Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L+H
Sbjct: 54  IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 83.6 bits (205), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (86%)

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           + Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L+H
Sbjct: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 82.0 bits (201), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (82%)

Query: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           + QKRWKSRGNTYQPSTLKRKR+ GFL+R R R    ILKRR+ KGRW+L+H
Sbjct: 90  INQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 80.5 bits (197), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%)

Query: 81  QKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           Q+RWKSRGNTYQPSTLKRKR+ GFLAR  ++    I+KRR+EKGRWYLTH
Sbjct: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 79.3 bits (194), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (67%), Gaps = 5/74 (6%)

Query: 57  GAIGAFTPAAAPKPSMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNI 116
           GA    T    P   ++++      +RWKSRGNTYQPSTLKRKR+ GFLAR R+     +
Sbjct: 18  GASALLTGGIRPTTGVVTL-----TRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKV 72

Query: 117 LKRRREKGRWYLTH 130
           LKRR+EKGRWYL+H
Sbjct: 73  LKRRKEKGRWYLSH 86

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 79.3 bits (194), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 45/54 (83%)

Query: 77  LGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130
           L +  +RWKSRGNTYQPSTLKRKR+ GFL+RA+S T   ILKRR+ KGRW+L+H
Sbjct: 41  LMIDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>Skud_13.378 Chr13 complement(659681..661060) [1380 bp, 459 aa] {ON}
           YMR209C (REAL)
          Length = 459

 Score = 32.0 bits (71), Expect = 0.37,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 50/118 (42%), Gaps = 21/118 (17%)

Query: 11  VLHYTIVAHRTMFSMYRSMLQW------------SSRRTIMTVVSPVRKMAPVPQIQYGA 58
           +L   IV   T+    +S  +W            S+    + V+SP  K+    ++    
Sbjct: 9   ILIALIVVLMTLLRQNKSFKKWFVSNIEILLSRTSNSTQKINVLSPTLKLVSDEKL---- 64

Query: 59  IGAFTPAAAPKPSMLSMLLGLTQK-----RWKSRGNTYQPSTLKRKRRVGFLARARSR 111
           +GA+ P  A   S L  LL LTQ       ++ RG +Y     +R R++G ++  + R
Sbjct: 65  MGAYRPNFAKLNSRLPRLLELTQNLIRLHEYRVRGESYNGLLFQRTRQLGGISEDQLR 122

>ZYRO0G18326g Chr7 (1515959..1517248) [1290 bp, 429 aa] {ON}
          similar to uniprot|Q03178 Saccharomyces cerevisiae
          YKL164C PIR1 Protein containing tandem internal repeats
          Length = 429

 Score = 28.9 bits (63), Expect = 3.4,   Method: Composition-based stats.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%)

Query: 43 SPVRKMAPVPQIQYGAIGAF--TPAAAPKPS 71
          S V++ APV QI  G I A   TP+ +PKPS
Sbjct: 62 SQVKRAAPVTQIGDGQIQATTATPSPSPKPS 92

>KNAG0E03120 Chr5 (623076..626906) [3831 bp, 1276 aa] {ON} Anc_8.28
           YFL036W
          Length = 1276

 Score = 28.9 bits (63), Expect = 4.9,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 66  AAPKPSMLSMLLGLTQ-KRWKSRGNTYQPSTLKRKR 100
           A+ +P +L ML+   + K WKS G  Y  STL R R
Sbjct: 591 ASVQPQLLPMLVKPREWKNWKSGGYFYSQSTLVRSR 626

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.131    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,581,229
Number of extensions: 435692
Number of successful extensions: 1169
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1167
Number of HSP's successfully gapped: 25
Length of query: 130
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 33
Effective length of database: 42,358,797
Effective search space: 1397840301
Effective search space used: 1397840301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)