Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR080W8.268ON27527511891e-166
SAKL0H16896g8.268ON2852516766e-88
KLTH0G13552g8.268ON2812626741e-87
Kwal_56.237758.268ON2812646722e-87
Ecym_43028.268ON2752746686e-87
KLLA0F19272g8.268ON2662726676e-87
Smik_4.3608.268ON2852706611e-85
YDR116C (MRPL1)8.268ON2852116566e-85
TDEL0F039508.268ON2762726349e-82
TPHA0J007708.268ON2782466295e-81
Suva_2.2758.268ON2852696253e-80
Kpol_392.38.268ON2812806243e-80
ZYRO0C01518g8.268ON2772656201e-79
NCAS0B038108.268ON3142906222e-79
Skud_4.3768.268ON2852116072e-77
KAFR0B054808.268ON2802135681e-71
KNAG0H032108.268ON2852115532e-69
NDAI0J013308.268ON3142125483e-68
CAGL0B01815g8.268ON2902175262e-65
TBLA0I031908.268ON2412113711e-42
TBLA0H020905.193ON72132750.57
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR080W
         (275 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   462   e-166
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   265   6e-88
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   264   1e-87
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   263   2e-87
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   261   6e-87
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   261   6e-87
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   259   1e-85
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   257   6e-85
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   248   9e-82
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   246   5e-81
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   245   3e-80
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   244   3e-80
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   243   1e-79
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   244   2e-79
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   238   2e-77
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   223   1e-71
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   217   2e-69
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   215   3e-68
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   207   2e-65
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   147   1e-42
TBLA0H02090 Chr8 (500161..502326) [2166 bp, 721 aa] {ON} Anc_5.1...    33   0.57 

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  462 bits (1189), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/275 (84%), Positives = 233/275 (84%)

Query: 1   MLFSRVGLLSFRRGLHLTAVQLSQEAAATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXX 60
           MLFSRVGLLSFRRGLHLTAVQLSQEAAATSSKLSKD                        
Sbjct: 1   MLFSRVGLLSFRRGLHLTAVQLSQEAAATSSKLSKDQLKKRELRRLAQRKAAARRPASAS 60

Query: 61  XXYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVF 120
             YMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVF
Sbjct: 61  PLYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVF 120

Query: 121 TNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGP 180
           TNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGP
Sbjct: 121 TNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGP 180

Query: 181 KGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAA 240
           KGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAA
Sbjct: 181 KGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAA 240

Query: 241 FRAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDFLK 275
           FRAAMTSQ                HGPGIVIDFLK
Sbjct: 241 FRAAMTSQKTKKTSLFGTTTLTSTHGPGIVIDFLK 275

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  265 bits (676), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 170/251 (67%)

Query: 23  SQEAAATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXXXYMPVQQALRFLRAAEVGQPA 82
           S+E +  ++KLSKD                          YMPV QALRFLRAAEVGQP 
Sbjct: 34  SEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQ 93

Query: 83  TQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGA 142
           +QQTIS+ T+VI ++GA  L+G ++ P P+++ K+AVFTND ++ + AR ++ C+LVGG+
Sbjct: 94  SQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGS 153

Query: 143 ELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGD 202
           EL+E++K GEV +DFDKAFATPDIA  + ++LGR+LGP+GLLP+ KKGTV  D+S L+ D
Sbjct: 154 ELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVTEDISSLIKD 213

Query: 203 DINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQXXXXXXXXXXXXXX 262
            + + PF+QR NCIS+A+ KC F+D Q++EN+LA Q +F+ A+ +Q              
Sbjct: 214 SMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLT 273

Query: 263 XXHGPGIVIDF 273
             HGPG+VIDF
Sbjct: 274 TTHGPGLVIDF 284

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  264 bits (674), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 125/262 (47%), Positives = 178/262 (67%), Gaps = 1/262 (0%)

Query: 13  RGLHLTAVQLSQEAAAT-SSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXXXYMPVQQALR 71
           R LH++A   ++E     +SKLSKD                          YMPV +ALR
Sbjct: 19  RRLHVSASLRAEEPVGNATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALR 78

Query: 72  FLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETAR 131
           FLRAAEVGQP +QQT+SV T+VI ++GA LLSG V+ P+ ++E K+AVFTND +QA+ AR
Sbjct: 79  FLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAR 138

Query: 132 TKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGT 191
            K+ C++VGG+ELVE++K G+V +DFDK+FATP+IA L+A++LGR+LGP+GLLP+ KKGT
Sbjct: 139 EKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGT 198

Query: 192 VAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQXXX 251
           V+ +L  L+ D + + PF+QR N IS+A+G+C F+D+Q++EN++A Q + + A+ +Q   
Sbjct: 199 VSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAK 258

Query: 252 XXXXXXXXXXXXXHGPGIVIDF 273
                         GPGIVIDF
Sbjct: 259 KPSLLGQTTLTSTRGPGIVIDF 280

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  263 bits (672), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 175/264 (66%), Gaps = 1/264 (0%)

Query: 11  FRRGLH-LTAVQLSQEAAATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXXXYMPVQQA 69
           + R LH  +A++  +  +   SKLSKD                          YMPV +A
Sbjct: 17  YARNLHAFSALRAEETPSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKA 76

Query: 70  LRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAET 129
           LRFLRAAE GQP +QQT+SV T+VI ++GA  LSG ++ P P+++ K+AVFTND +QA+ 
Sbjct: 77  LRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQI 136

Query: 130 ARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKK 189
           AR K+GC+LVGG++LVE++K G V +DFDK+FATP+I  L+A++LGR+LGP+GLLP+ KK
Sbjct: 137 AREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKK 196

Query: 190 GTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQX 249
           GTVA +L  LL + + + PF+QR N +S+A+GKC F+D+Q++EN+LA Q   + A+ +Q 
Sbjct: 197 GTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQK 256

Query: 250 XXXXXXXXXXXXXXXHGPGIVIDF 273
                          HGPGIVIDF
Sbjct: 257 TKKPSLLGQTTLTSTHGPGIVIDF 280

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  261 bits (668), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 183/274 (66%), Gaps = 2/274 (0%)

Query: 2   LFSR-VGLLSFRRGLHLTAVQLS-QEAAATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXX 59
           +F R + L++ RRGL+ T+V+ +   + ++++KLSK+                       
Sbjct: 1   MFPRCLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFE 60

Query: 60  XXXYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAV 119
              YMPVQQA RFLRAAEVGQP +QQTIS+ T+V+ DKGA LLSG +  P+P+R+ KVAV
Sbjct: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120

Query: 120 FTNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLG 179
           FTN+ EQ E AR ++ C+LVGG EL+E +K+G+  +DFDKA ATPD+   + ++L  VLG
Sbjct: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180

Query: 180 PKGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQA 239
           P+ LLP+VKKGTV+ +++ L+ +++ + PF+QR   +S+A+GKC FSD+Q+++N++AVQ 
Sbjct: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240

Query: 240 AFRAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           AF+ A+  Q                HGPGIVIDF
Sbjct: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  261 bits (667), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 125/272 (45%), Positives = 177/272 (65%), Gaps = 7/272 (2%)

Query: 2   LFSRVGLLSFRRGLHLTAVQLSQEAAATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXX 61
           +F R+    F R   +T+ +L++E   T +KL+K+                         
Sbjct: 1   MFPRI----FTRQFQITSFRLAEE---TGTKLTKEQLRKRELRKMVQRRLQAKTPASDHP 53

Query: 62  XYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFT 121
            YMPV +ALR+LRA EVGQPA+QQTI++ T+V+ ++G   L+G V+   P+++ KVAVFT
Sbjct: 54  LYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFT 113

Query: 122 NDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPK 181
           ND  QA   + KY  +LVGG++LV Q+K+GEV +DFDKAFATPDI P +A+++GR+LGP+
Sbjct: 114 NDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPR 173

Query: 182 GLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAF 241
           GLLP+ KKGTVA DL  L+ D ++S PF+QR N ISL + K HF+D++++ENLLA Q AF
Sbjct: 174 GLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAF 233

Query: 242 RAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           + ++T+Q                HGPGIVIDF
Sbjct: 234 KQSITNQQTKKPSILSQTTLTSTHGPGIVIDF 265

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  259 bits (661), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 175/270 (64%), Gaps = 6/270 (2%)

Query: 10  SFRRGLHLTAVQLSQEA------AATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXXXY 63
           S RR L  TA +L  E       ++ +  L+KD                          Y
Sbjct: 15  STRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLY 74

Query: 64  MPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTND 123
           MPV  ALR+LRAAEVG+P +QQTI++ T+V+G++G A LSG+VT P P+R  KVA FTND
Sbjct: 75  MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTND 134

Query: 124 PEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGL 183
             + E  R KY  +L+GGA+LV ++KSGE+ VDFDKAFATPDI P + +++ R+LGP+G+
Sbjct: 135 ENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGV 194

Query: 184 LPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRA 243
           LPS+KKGTV+ D++ LL + + S PF+QR N ISL +GKC+FSDR+I++N+++ ++AF+A
Sbjct: 195 LPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKA 254

Query: 244 AMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           A+ +Q                HGPGIVIDF
Sbjct: 255 AVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  257 bits (656), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 113/211 (53%), Positives = 159/211 (75%)

Query: 63  YMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTN 122
           YMPV +ALR+LRAAEVG+P +QQTI++ T+V+G++G A LSG+VT P P+R  K+A FTN
Sbjct: 74  YMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTN 133

Query: 123 DPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKG 182
           D  + E  R KY  +L+GGA+LV ++KSGE+ VDFDKAFATPDI P + +++ R+LGP+G
Sbjct: 134 DESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRG 193

Query: 183 LLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFR 242
           +LPSVKKGTV+ D+S LL + + S PF+QR N IS+ +GKC+F+DR+I++N+++ +AAF+
Sbjct: 194 VLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFK 253

Query: 243 AAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
            A+ +Q                HGPGIVIDF
Sbjct: 254 TAVDNQKSKKPNILSKTTLSSTHGPGIVIDF 284

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  248 bits (634), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 132/272 (48%), Positives = 175/272 (64%), Gaps = 1/272 (0%)

Query: 3   FSRVGLLSFRRG-LHLTAVQLSQEAAATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXX 61
           FS +G    RR  LH   V  ++EAAA  SKLSKD                         
Sbjct: 4   FSCIGRSVLRRSFLHTGNVLRAEEAAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHP 63

Query: 62  XYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFT 121
            YM +  ALRFLRAAEVGQP TQQTI++ T V+ ++G   L+G+V+ P P++E K+AVF+
Sbjct: 64  LYMSIPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFS 123

Query: 122 NDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPK 181
            D +Q + AR K+ C+LVGG E++E++KSGE+ VDFDKAFATPDIAP + ++L R+LGP+
Sbjct: 124 GDEDQLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPR 183

Query: 182 GLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAF 241
           G+LP+VKKGTVA D+S L+ D + S PF+QR N IS+A+GK  FSDRQI+EN +A   A 
Sbjct: 184 GVLPTVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAV 243

Query: 242 RAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           + A+ +Q                HGPGIVIDF
Sbjct: 244 KEALANQVSKKTSLLGKTTLSSTHGPGIVIDF 275

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  246 bits (629), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 166/246 (67%), Gaps = 1/246 (0%)

Query: 28  ATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXXXYMPVQQALRFLRAAEVGQPATQQTI 87
           A  SKLSKD                          YM V QALRFLRAAEVGQP +QQTI
Sbjct: 33  AQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTI 92

Query: 88  SVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQ 147
           ++ T+V+ +KG+  L+G +   +P++E K+A+FTND  Q + A+ K+ CY+VGG+EL+ +
Sbjct: 93  NLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISK 152

Query: 148 LKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGDDINST 207
           +K+GE++VDFDKAFATPDI   + + + R+LGP+G+ PS+KKGTV+ ++ +L+  ++ S 
Sbjct: 153 IKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSI 211

Query: 208 PFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQXXXXXXXXXXXXXXXXHGP 267
           PF+Q  NCIS+AIGKC+FSDRQI+ENL++V+ AF+ ++++Q                HGP
Sbjct: 212 PFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGP 271

Query: 268 GIVIDF 273
           GIVIDF
Sbjct: 272 GIVIDF 277

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  245 bits (625), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 169/269 (62%), Gaps = 6/269 (2%)

Query: 11  FRRGLHLTAVQLSQE---AAATSSK---LSKDXXXXXXXXXXXXXXXXXXXXXXXXXXYM 64
            RR L  TA QL  E    AA SS    L+KD                          +M
Sbjct: 16  IRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHM 75

Query: 65  PVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDP 124
           PV  ALR+LRAAEVG+P +QQTI++ T+V+G++G A +SG VT   P+R  KVAVFTND 
Sbjct: 76  PVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDE 135

Query: 125 EQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLL 184
            + +  R KY   +VGG +LV ++K+ E  VDFDKAFATPDI P + +++ R+LGP+G+L
Sbjct: 136 VKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVL 195

Query: 185 PSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAA 244
           PSVKKGTV+ D++ LL + + S PF+QR N ISL IGKC+F+DR++++N+++ + AFRAA
Sbjct: 196 PSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAA 255

Query: 245 MTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           + +Q                HGPGIVIDF
Sbjct: 256 VDNQKAKKPSLLSKTTLSSTHGPGIVIDF 284

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  244 bits (624), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 175/280 (62%), Gaps = 7/280 (2%)

Query: 1   MLFSRVGLLSFRRGLHLTAVQLSQEAAATS-------SKLSKDXXXXXXXXXXXXXXXXX 53
           ML    G+LS R   H   V L++  AA+        SK  KD                 
Sbjct: 1   MLSRSFGILSRRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADA 60

Query: 54  XXXXXXXXXYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMR 113
                    YMP+ QALR+LRAAEVGQP +QQ I++ T V+ ++G   L+G ++  +P++
Sbjct: 61  RKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIK 120

Query: 114 ETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAK 173
           + K+AVF+NDPE+    + ++ C+L+GG +LVE++KSG+  VDFDKAFATPDI+P++ ++
Sbjct: 121 DVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQ 180

Query: 174 LGRVLGPKGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMEN 233
           L RVLGP+G+LP++KKGTV+ D+S L+   I   PF+Q  N IS+++G+C+FSD+QI+EN
Sbjct: 181 LARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILEN 240

Query: 234 LLAVQAAFRAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           ++AV++A+   ++SQ                HGPGI IDF
Sbjct: 241 IIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDF 280

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  243 bits (620), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 164/265 (61%), Gaps = 2/265 (0%)

Query: 10  SFRRGLHLTAVQLSQEAAATSSKLSKDXXXXXXXXXXXXXXXXXXXXXXXXXXYMPVQQA 69
           S  R L  TA  L  E A   SKL+K+                          YMP   A
Sbjct: 15  STSRCLFHTAALLRAEEAG--SKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLA 72

Query: 70  LRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAET 129
           LR+LRA EVG PA+QQ I+V T V+ D+G   ++G V+LPSP+++  VAVF+ND +Q   
Sbjct: 73  LRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSM 132

Query: 130 ARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKK 189
           AR K+ C+LVGG++++ ++K GE+ VDFDKAFATPDIA  + +++ R+LGPK +LP  K+
Sbjct: 133 ARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKR 192

Query: 190 GTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQX 249
           GTVA DL  L+ D   S PF+Q+ N ISLA+ KC FSDRQ++ENLLAVQ AF+ A+++Q 
Sbjct: 193 GTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQK 252

Query: 250 XXXXXXXXXXXXXXXHGPGIVIDFL 274
                          HGPGIVID +
Sbjct: 253 AKRPSILGRTTLTTTHGPGIVIDLV 277

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  244 bits (622), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 179/290 (61%), Gaps = 18/290 (6%)

Query: 3   FSRV----GLL------SFRRGLHLTAVQLSQEAAATSSK--------LSKDXXXXXXXX 44
           F+RV    GLL      S  RG+H T+   ++EAA+T++         LSK+        
Sbjct: 25  FNRVPIRGGLLAQCTSSSQSRGIHSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELR 84

Query: 45  XXXXXXXXXXXXXXXXXXYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSG 104
                             YMPV +ALR++RAAEVG+P+ QQTI++ ++V+ +KG A L+G
Sbjct: 85  RLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNG 144

Query: 105 TVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATP 164
            ++LP P++  KVAVF+ + E     + KY C+LVGG EL+ ++K+GEVK DFDKAFA+ 
Sbjct: 145 HISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASS 204

Query: 165 DIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCH 224
           D+A +++A+LG+ LG +GLLP+ KKGTV+ DL  LL D I S PF+Q  NCIS+ IGKCH
Sbjct: 205 DMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCH 264

Query: 225 FSDRQIMENLLAVQAAFRAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDFL 274
           FSD +I+ N++A ++A   A++ Q                HGPGIVIDF+
Sbjct: 265 FSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDFI 314

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  238 bits (607), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 158/211 (74%)

Query: 63  YMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTN 122
           YMPV  ALR+LRAAEVG+P +QQTI++ T+V+G++G A LSG+V  P P+R  KVAVFTN
Sbjct: 74  YMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTN 133

Query: 123 DPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKG 182
           D  + +  R KY  +L+GGA+LV ++K+GE+ VDFDKA+AT DI P + +++ R+LGP+G
Sbjct: 134 DENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRG 193

Query: 183 LLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFR 242
           +LPSVKKGTV+ D++ LL + + S PF+QR N ISL IGKC+F+DR++++N++A +AAF+
Sbjct: 194 VLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFK 253

Query: 243 AAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           AA++ Q                HGPGIVIDF
Sbjct: 254 AAVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  223 bits (568), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 146/213 (68%), Gaps = 1/213 (0%)

Query: 63  YMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTN 122
           YM V  ALRFLRA EVGQP +QQTI++ T+VI +KG   + G V LP+P+R +KV V ++
Sbjct: 68  YMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSD 127

Query: 123 DPEQAETARTKY-GCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPK 181
           DP++ E  +  +   +LVGG ELV++ K+ ++++DFDK  ATPDI       LG++ GPK
Sbjct: 128 DPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPK 187

Query: 182 GLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAF 241
           GLLP+VKKGTV+ +L EL+ ++++S PF+QR  CISL IGK  FSD+QI+EN++A + AF
Sbjct: 188 GLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAF 247

Query: 242 RAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDFL 274
              +++Q                HGPGIVIDF+
Sbjct: 248 LNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI 280

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  217 bits (553), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 142/211 (67%)

Query: 63  YMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTN 122
           Y+ V +A+R LRA EVGQP +QQTI++ TMV+ +KG   L G V LP+P++  ++A F+ 
Sbjct: 74  YLSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSA 133

Query: 123 DPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKG 182
           DPE  +  + +    +VGGAEL++QLKSGEV V FDKAFATPDIAP + +KLG +LG +G
Sbjct: 134 DPELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQLNSKLGALLGRRG 193

Query: 183 LLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFR 242
           LLP++KKGTV  DL  ++   + + PF+QR   ++  I KCHFSDRQ++ NL+A + AF+
Sbjct: 194 LLPNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQVLGNLIAAREAFQ 253

Query: 243 AAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
            A+ +Q                HGPGIVID 
Sbjct: 254 LAIQNQKSKKRSILGRSTLSSTHGPGIVIDL 284

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  215 bits (548), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 144/212 (67%)

Query: 63  YMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTN 122
           YM V  ALRF+RAAEVG+P  QQTI++ T+++ +KG +LL+G + L  P++E K+AVF+ 
Sbjct: 103 YMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFST 162

Query: 123 DPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKG 182
           D E  E  ++++ C LVGG E VE +K G ++ +FD AFATP+I P + ++LG+ LG +G
Sbjct: 163 DKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRG 222

Query: 183 LLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFR 242
           +LP+ KKGTV+ DL  L+   + + PFKQ  N IS+ IGKC+FSD+ I+ N++A + AF+
Sbjct: 223 ILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFK 282

Query: 243 AAMTSQXXXXXXXXXXXXXXXXHGPGIVIDFL 274
            A+ +Q                HGPGIVIDF+
Sbjct: 283 EALANQKAKRPSILSKTTLSSTHGPGIVIDFV 314

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  207 bits (526), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 95/217 (43%), Positives = 150/217 (69%), Gaps = 6/217 (2%)

Query: 63  YMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTN 122
           YMP+  ALR+LR+AEVG+P   QTI+V T+V+ DKG A L+G +  P P+++ K+A+F++
Sbjct: 73  YMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAIFSS 132

Query: 123 DPEQAETARTKYG--CYLVGGAELVEQLKSGEVKVD-FDKAFATPDIAPLMAAKLGRVLG 179
           + E+ +  ++KY     + GG +++  +KSG++KVD  +K FATP+I P +A++LGRVLG
Sbjct: 133 NKEKLDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGRVLG 192

Query: 180 PKGLLPSVKK---GTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLA 236
           PKGL+P++KK    TV  DL  L+ +++    F+QR N +S+++G+C+FSDR I+EN++A
Sbjct: 193 PKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDILENIIA 252

Query: 237 VQAAFRAAMTSQXXXXXXXXXXXXXXXXHGPGIVIDF 273
           V+ AF+ +++SQ                 GPGIVIDF
Sbjct: 253 VRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 123/211 (58%), Gaps = 2/211 (0%)

Query: 64  MPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTND 123
           M V  ALR+LRA E G+ +++QT+++ T+V   +G   L G +     +R+  +AVFT D
Sbjct: 33  MEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVFTED 92

Query: 124 PEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGL 183
           PEQ + A+ + G  ++GG+EL++++ SGE K+ F  AFAT D+   +A ++ + LG + +
Sbjct: 93  PEQHKIAK-EMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA-RVAQKLGKQKV 150

Query: 184 LPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRA 243
           LP +KK TV  ++ ELL D +   PF ++ + IS  +GKC F+D +I+ NL+  +   + 
Sbjct: 151 LPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREGLQK 210

Query: 244 AMTSQXXXXXXXXXXXXXXXXHGPGIVIDFL 274
           A+  Q                HGPGI ID  
Sbjct: 211 ALREQNNKKPSTIIKATLTSTHGPGIDIDLF 241

>TBLA0H02090 Chr8 (500161..502326) [2166 bp, 721 aa] {ON} Anc_5.193
           YGR186W
          Length = 721

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 139 VGGAELVEQLKSGEVKVDFDKAFATPDIAPLM 170
           + GAE  E   + EV++DFD+ FA  + AP+M
Sbjct: 416 IDGAEESEHDDNSEVELDFDEEFADDEEAPIM 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,580,305
Number of extensions: 664098
Number of successful extensions: 1697
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1692
Number of HSP's successfully gapped: 21
Length of query: 275
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 167
Effective length of database: 41,097,471
Effective search space: 6863277657
Effective search space used: 6863277657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)