Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR079W8.269ON54254226860.0
Ecym_43018.269ON56456612811e-171
SAKL0H16874g8.269ON56355011691e-154
YDR117C (TMA64)8.269ON56555911101e-145
KLTH0G13530g8.269ON57456411061e-145
Kwal_56.237718.269ON56255111031e-144
Suva_2.2768.269ON56555910711e-140
TDEL0F039608.269ON55854910661e-139
Skud_4.3778.269ON56256310641e-138
KLLA0F19294g8.269ON57056210581e-137
Smik_4.3618.269ON56555610331e-134
TPHA0J007808.269ON58357210151e-131
TBLA0I032008.269ON56356610091e-130
ZYRO0C01496g8.269ON56756410031e-129
NCAS0B038008.269ON5655539981e-128
CAGL0B01837g8.269ON5695599821e-126
KAFR0B054708.269ON5625539791e-126
Kpol_392.28.269ON5665639381e-119
NDAI0J013108.269ON5795759241e-117
KNAG0H032008.269ON5615548821e-111
Smik_4.822na 1ON34451705.1
YDR541Cna 1ON34451705.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR079W
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...  1039   0.0  
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   498   e-171
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   454   e-154
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   432   e-145
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   430   e-145
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   429   e-144
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   417   e-140
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   415   e-139
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   414   e-138
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   412   e-137
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   402   e-134
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   395   e-131
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   393   e-130
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   390   e-129
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   389   e-128
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   382   e-126
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   381   e-126
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   365   e-119
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   360   e-117
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   344   e-111
Smik_4.822 Chr4 complement(1441244..1442278) [1035 bp, 344 aa] {...    32   5.1  
YDR541C Chr4 complement(1519664..1520698) [1035 bp, 344 aa] {ON}...    32   5.3  

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score = 1039 bits (2686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/542 (93%), Positives = 508/542 (93%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
           GTRRGRVVGIASTRAPGVVKAVGICEMDLE             RVLHTYGDGLCRVFKVQ
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 REAPEASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVDHLLTRAVYYTIKADG 240
           REAPEASEAK                     LAEELERLTMEDVDHLLTRAVYYTIKADG
Sbjct: 181 REAPEASEAKGASPEAREPEAEPPKTAPGEGLAEELERLTMEDVDHLLTRAVYYTIKADG 240

Query: 241 RLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQGLLTLKGKPESF 300
           RLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQGLLTLKGKPESF
Sbjct: 241 RLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQGLLTLKGKPESF 300

Query: 301 TVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYHYVPNRTLLPQLNGLGIS 360
           TVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYHYVPNRTLLPQLNGLGIS
Sbjct: 301 TVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYHYVPNRTLLPQLNGLGIS 360

Query: 361 GGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHKNVNADTPRSLPRPEAL 420
           GGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHKNVNADTPRSLPRPEAL
Sbjct: 361 GGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHKNVNADTPRSLPRPEAL 420

Query: 421 AALLSRSFSEYFVVMRGDAPLSKPQKGRAPPIKVTNERKIYKKVVTKVSNFEVYGVDPEE 480
           AALLSRSFSEYFVVMRGDAPLSKPQKGRAPPIKVTNERKIYKKVVTKVSNFEVYGVDPEE
Sbjct: 421 AALLSRSFSEYFVVMRGDAPLSKPQKGRAPPIKVTNERKIYKKVVTKVSNFEVYGVDPEE 480

Query: 481 LAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIVSILNKHGIPSKYITLDCKVQPKK 540
           LAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIVSILNKHGIPSKYITLDCKVQPKK
Sbjct: 481 LAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIVSILNKHGIPSKYITLDCKVQPKK 540

Query: 541 KK 542
           KK
Sbjct: 541 KK 542

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  498 bits (1281), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 257/566 (45%), Positives = 355/566 (62%), Gaps = 27/566 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKK+P +   SN KNSERK+L  ++R Q   + +QFS+T +K  TFKT +  GT++TD 
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           +N P++F+ KH +  IPT+ +CW +P LL VV TH+HV+++KLK GADLMLPGT+PPFS 
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
              RG++VG+AS+  P VV+A+G+C+++L              +VLHT  DGL  VFK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 REAP-----------------EASEAKXXXXXXXXXXXXXXXX-----XXXXXLAEELER 218
            E P                 +A +A                           +AE+LE 
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 219 LTMEDVDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKA 278
           L++E VDH LT+AVYYT+  D  L+LP+ AS FIA HV+KNLP +  +QV++KRSSW +A
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 279 AKLLKHFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSL 338
           +K LK+FE QG L LKGK E+ TVVSVN     +KSF+PYRT+    ST SKN+     +
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNND-KHDV 359

Query: 339 EIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTL 398
           E+V +Y P  T    L+ LG +    L AKDI+  L +YV  +K V+  D+ ++ LDDTL
Sbjct: 360 EVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDDTL 419

Query: 399 AQLLHKNVNADTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL-SKPQKGRAPPIKVTNE 457
             L +K   +D+ R + R +    +LS SF+E F + +   PL SKP K +   + V  E
Sbjct: 420 FSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFKDGKPLSSKPLKSKNRNVSVMTE 479

Query: 458 RKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT--KAVEVQVQGPHEAT 515
            KI++K+VT++SNFE+YGVDPEEL+ ELR RCSGS+T+ + P+T     EVQVQGPH  T
Sbjct: 480 MKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLE-PSTLQSTTEVQVQGPHGNT 538

Query: 516 IVSILNKHGIPSKYITLDCKVQPKKK 541
            ++ILN+HGIPSKYI  D K+  KKK
Sbjct: 539 AINILNEHGIPSKYIDFDNKLNKKKK 564

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  454 bits (1169), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 236/550 (42%), Positives = 337/550 (61%), Gaps = 18/550 (3%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKK+P++   SN KNSERK+L AS+REQ E   YQF +  +K  TFK Q++ GTVYTD 
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
            N+P+WF+ KH     PTV++CW +PD+LPVV TH+HVVE KL  GADLMLPG VPPFSS
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
              +G +VG+ASTR+P V+KA+GI ++DL               ++HT+ DGLC+ FK++
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 REAPEASE-------------AKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVDHL 227
            E PEA E                                     +E+L  L+ ED+DH 
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240

Query: 228 LTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEA 287
           LTR++YYT+  D RLQLPV AS F++ H+L NLPP+D +Q+ +K+SSW K+AK LKHFE 
Sbjct: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300

Query: 288 QGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVS--DKASTGSKNSSTTQSLEIVYHYV 345
              L LKGK +   VV +N   + LK F PYR  S  +   T +K    +  ++ V  Y 
Sbjct: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQAVSLYK 360

Query: 346 PNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHKN 405
           P  +       + +      +A++++  L+ Y+  +  V+  DK M+ LDDTL  +++++
Sbjct: 361 PISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLFPMINRS 420

Query: 406 VNADTP-RSLPRPEALAALLSRSFSEYFVVMRGDAPLSKPQ-KGRAPPIKVTNERKIYKK 463
              +   R++ R + +   L+ +F+E+F +++GD PL K   KG  P I++  E KI +K
Sbjct: 421 TKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEIQIVTEMKIGRK 480

Query: 464 VVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQVQGPHEATIVSILNK 522
           VVTKVSNFE + +D E LAAELR RCSGSTTI +  ++ K +EV VQGPH A ++ +LN+
Sbjct: 481 VVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIGMLNE 540

Query: 523 HGIPSKYITL 532
           +GIP+K+I  
Sbjct: 541 YGIPTKWINF 550

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  432 bits (1110), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 223/559 (39%), Positives = 331/559 (59%), Gaps = 29/559 (5%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP++   SN KNSERK+L  + ++Q   E Y F ++ IK   F  Q +VGTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           NN P+ F+ KH +   PTVYSCW++P LLP+V TH  V+E  L  GA+LM+ G++PPF  
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
             + G + GIAS +AP  V A+GI E+DL              +++H + DGL +VFK++
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 REAP---------------EASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVD 225
            E P               +   ++                     +AE L+  T+ DVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHF 285
           + +TRA+YYT+  D  L+LP++AS FI+ H+++NLPP+D ++V VK++SW K+AK LKHF
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 286 EAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQ--------S 337
           E +G L LKGK +  T+V  N+  + LK+F PY+    K++T S+ S+T++        S
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 338 LEIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDT 397
           L +   +   + LL ++N   ++     +++DIR  + QY++ +   D  DK  + +DD 
Sbjct: 361 LTLYKPFNLAKDLLKEVN---LASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDL 417

Query: 398 LAQLLHKNVNA-DTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPPIKV 454
           L  +++K     +  R + R E L  LL+ +F+E++ + + D  L    P KG  P IK+
Sbjct: 418 LFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKI 477

Query: 455 TNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEA 514
             E KI +KV+T+VSNFEV+ VDPE LAA+LR  CSGSTTI++    K  EVQVQGPH  
Sbjct: 478 ITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQ 537

Query: 515 TIVSILNKHGIPSKYITLD 533
           +I+  LNK GIPSK+I  +
Sbjct: 538 SIIDHLNKLGIPSKWIDFE 556

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  430 bits (1106), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 224/564 (39%), Positives = 332/564 (58%), Gaps = 33/564 (5%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP +   SN KNSERK +Q+  +EQ     Y F S  IK  TFKT  T GTV+TD 
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
            N+P+WF+ K      PTV++CW +  LLP+V  HE+VVE KL  GA+LMLPGTVPPF  
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
              + R+V +AST AP VVKA+GI +++L               ++HT+GD LC+VFKV+
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 REAPEAS---------------------EAKXXXXXXXXXXXXXXXXXXXXXLAEELERL 219
            + PE S                      A                      ++E+L  L
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 220 TMEDVDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAA 279
            +EDVDH  TR++YY++  D +L+ P++AS F++ H+L+NLPP+D +QV +K++SW K A
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 280 KLLKHFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQS-- 337
           K LK+FE +G L LKGK +  T++ V+     LK+F PYR +   AS+  K +S+  +  
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYR-IGGGASSSEKGASSVANEK 359

Query: 338 -----LEIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSML 392
                ++ V  Y P  +    L+   +      + +DI+  +++Y++A+  V P +KS +
Sbjct: 360 EQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAV 419

Query: 393 RLDDTLAQLLHKNVNADTP-RSLPRPEALAALLSRSFSEYFVVMRGDA-PLSK-PQKGRA 449
           RLDD L  L++++   +   R++ R + +A +L  +FSE+F++++ D  PL K P KG  
Sbjct: 420 RLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSI 479

Query: 450 PPIKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQV 508
           P +++  E KI +KVVTKVSNFE + VD +ELA  LR +CSGSTTI +   + K +EV V
Sbjct: 480 PQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTV 539

Query: 509 QGPHEATIVSILNKHGIPSKYITL 532
           QGPH   ++ +LN+ GIP+K+I  
Sbjct: 540 QGPHGPAVIELLNESGIPTKWINF 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  429 bits (1103), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 223/551 (40%), Positives = 326/551 (59%), Gaps = 19/551 (3%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP +   SN KNSERK+LQ+  REQ +   Y F S  IK  TFKT  T GTVYTD 
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
            NIP+WF+ K      PTV+SCW + DL+P+V  HE+VVE KL  GA+LMLPGTVPPF  
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
              + ++VG+AST +P VVKA+GI +++L               ++HT+ D LC+ FKV+
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 REAPEASEAKXXXXXXXXXXXXXXXXXXXX---------------XLAEELERLTMEDVD 225
            + PE ++                                       AE+L +L++EDVD
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHF 285
           H  TRA+YYT+  D +L++P +AS F++ H+L+NLPP+D +QV +K++SW K AK LKHF
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 286 EAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYHYV 345
           E +G L LKGK +  T+V ++   + LK F PYRT  +   +    S     ++ +  Y 
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQNSMMKALVIYK 360

Query: 346 PNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHKN 405
           P  +  P L    +S     S ++++  ++ Y+A++  V   +K+ +RLDD L  L++++
Sbjct: 361 PMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFSLVNRS 420

Query: 406 VNADTP-RSLPRPEALAALLSRSFSEYFVVMRGDA-PLSK-PQKGRAPPIKVTNERKIYK 462
              +   R++ R + +  +L  +F+E+F+V++ D  PL K P KG  P I++  E KI +
Sbjct: 421 TKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTEMKIGR 480

Query: 463 KVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQVQGPHEATIVSILN 521
           KVVTKVSNFE + VD +ELA  LR +CSGSTTI +   + K  EV VQGPH   ++ +LN
Sbjct: 481 KVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAVIELLN 540

Query: 522 KHGIPSKYITL 532
           +  IP+K+I  
Sbjct: 541 QLAIPTKWINF 551

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  417 bits (1071), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 220/559 (39%), Positives = 328/559 (58%), Gaps = 29/559 (5%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP++   SN KNSERK+L  + ++Q   E Y F ++ IK   F  Q ++GTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           NN P+ F+ KH++   PTVYSCW++  LLP+V TH  V+E  L  GA+LM+ G++PPF  
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
             + G + G+AS +AP +V AVGI EMDL              +++H + DGL + FKV+
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 REAPEASEA---------------KXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVD 225
            E P A +                +                     +AE L+ L++ DVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHF 285
           + +TRA+YYT+  D  L LP++AS FI+ H+++NLPP+D ++V VKR+SW K+AK LKHF
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 286 EAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRT-VSDKASTGSKNSSTTQ-------S 337
           E +G L LKGK +  T+V  N+  + LK+F PY+  V++ A    +N+++ +       S
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 338 LEIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDT 397
           L +   +   + L+ + N   +      +++DIR  + QY++ +  VD  DK  + +DD 
Sbjct: 361 LTLYKPFNLAKDLVKEAN---LPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDL 417

Query: 398 LAQLLH-KNVNADTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPPIKV 454
           L  +++ K  + D  R +PR + L  LL+ +F+E++ + + D  L    P KG  P IK+
Sbjct: 418 LYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKI 477

Query: 455 TNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEA 514
             E KI +KV+TKVSNFE   +DPE LAA+LR  CSGSTTI +    K+ EVQVQGPH  
Sbjct: 478 ITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQ 537

Query: 515 TIVSILNKHGIPSKYITLD 533
            I+  LNK G+P+K+I  +
Sbjct: 538 LIIDHLNKSGVPNKWIDFE 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  415 bits (1066), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 222/549 (40%), Positives = 317/549 (57%), Gaps = 18/549 (3%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP++   SN KNSERK+L  S +EQ     Y FS++ +K   +K Q + GTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           NN+P+WF+ KH +   PTVYSCW  P+LLP+V TH+ V+E +L  GA+LML GT+PPF  
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
                +V GIAS   P V+ A+G+ +++L              +V+H + DGLC+ FK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 REAPEASEAKXXXXXXXXXXXXXX---------XXXXXXXLAEELERLTMEDVDHLLTRA 231
            E    S                                 +A+ L+ L++EDVDH  TRA
Sbjct: 181 IEPAVLSSEPVEEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDELSVEDVDHFFTRA 240

Query: 232 VYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQGLL 291
           +YYT   D  L +P+ AS FI+ H+L NLPP+D SQV +K++SW K AK LKHFE  G L
Sbjct: 241 LYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEKVGFL 300

Query: 292 TLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYH---YVPNR 348
            LKGK +   +V VN   + LK+F PY+T    AS   KNS+   S  ++Y    Y P  
Sbjct: 301 QLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTAS--KKNSNKDSSPGMMYSEKLYKPIN 358

Query: 349 TLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH-KNVN 407
                +    +   +  +  +++D + QY+ A+K VD  +K M+ LDD L  + + K   
Sbjct: 359 LGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDMFYRKKKT 418

Query: 408 ADTPRSLPRPEALAALLSRSFSEYFVVMRG-DAPLSK-PQKGRAPPIKVTNERKIYKKVV 465
            +TPR + R + +   ++ +F+E++ + +  D PL K P +G  P +K+  E KI +KVV
Sbjct: 419 QETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKIGRKVV 478

Query: 466 TKVSNFEVYGVDPEELAAELRVRCSGSTTITD-VPNTKAVEVQVQGPHEATIVSILNKHG 524
           T+VS+FE + +DPE+LAA LR  CSGSTTI + V + K  EVQVQG H   I+  LNK G
Sbjct: 479 TRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDYLNKQG 538

Query: 525 IPSKYITLD 533
           IP+K+I  +
Sbjct: 539 IPTKWIDFE 547

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  414 bits (1064), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 219/563 (38%), Positives = 326/563 (57%), Gaps = 24/563 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP++   SN KNSERK+L  + ++Q   + Y F ++ IK   F +Q +VG VYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           NN P+ F+ KH++   PTVYSCW++P LLP++ TH  V+E  L  GA+LM+ G++PPF  
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
            ++ G + G+AS  AP VV A+GI EMDL              +V+H + DGL +  KV+
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 REAPEASEA------------KXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVDHLL 228
            + P A               +                     LAE L+  ++ DVD+ +
Sbjct: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVDYFI 240

Query: 229 TRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQ 288
           TRA+YYT+  D  L LP++ S FI+ H+++NLPP+D ++V VK++SW K+AK LKHFE +
Sbjct: 241 TRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHFEKE 300

Query: 289 GLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKAS--TGSKNSSTTQSLEIVYH--- 343
           G L LKGK +  T+V      + LK+F PY+  S  ++  +G   +S  ++  ++Y    
Sbjct: 301 GFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMTL 360

Query: 344 YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH 403
           Y P       L    +      +++DIR  L QY++     D  DK  + +DD L  +++
Sbjct: 361 YKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNMVN 420

Query: 404 ---KNVNADTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPPIKVTNER 458
              KN+NA   R +PR + L  LL+ +F+E++ + + D  L    P KG  P IK+T E 
Sbjct: 421 KKKKNLNA--ARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEM 478

Query: 459 KIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIVS 518
           KI +KV+T+VSNFEV+ +DPE LA +LR  CSGSTTI +    K+ EVQVQGPH   I+ 
Sbjct: 479 KIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLIID 538

Query: 519 ILNKHGIPSKYITLDCKVQPKKK 541
            LN  G+P+K+I  + K++ KK+
Sbjct: 539 HLNNLGVPNKWIDFENKLKKKKR 561

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  412 bits (1058), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 220/562 (39%), Positives = 334/562 (59%), Gaps = 32/562 (5%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MF KEP++ P SN KNS+RK+LQ++I+ Q   E Y   +  IK  +F+  +  G++YTD 
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWD-HPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFS 119
           +N P+WF+ K +    PT++S W+    LLP++ TH+ V+E  + GGA LMLPGTVPPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 SGTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKV 179
           S  +RG +VGIAST+ P +VKA+GI EMDL              RV+H   DGL + FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 QREAP----------------EASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMED 223
           + E P                + S+                       +A+ELE +++ED
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239

Query: 224 VDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLK 283
           VDH+L RAV Y+IK D ++ LP+ AS FI+ HV+KNLP +D + V +K+SSW KA KLLK
Sbjct: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299

Query: 284 HFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVS--------DKASTGSKNSSTT 335
           + E +G L LKGK +S TV+S+N  H+ L + E Y+T++        D  +  +KN  T 
Sbjct: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359

Query: 336 QSLEIVYHYVPNRTLLPQLNGLGISGGDA-LSAKDIRDRLEQYVAARKCVDPYDKSMLRL 394
            S E +Y   P       + G+      +  + ++++  L+ YVA    +DP +KS+++ 
Sbjct: 360 YSGENLYK--PMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKY 417

Query: 395 DDTLAQLLHKNVNADTPRSLPRPEALA-ALLSRSFSEYFVVMR--GDAPLSKPQKGRAPP 451
           DDTL Q+ ++       + + R   ++   LS++F+ Y  + +  G+  L  P+KG  P 
Sbjct: 418 DDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPT 477

Query: 452 IKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGP 511
           +++  E+KI +KV+T+V+NFE + +D EELAA LR +CSGSTTI +  +TK  EVQVQGP
Sbjct: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGP 537

Query: 512 HEATIVSILNKHGIPSKYITLD 533
           H + ++SILN +GIP+K+I+ +
Sbjct: 538 HGSIVISILNDYGIPTKWISFE 559

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  402 bits (1033), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 224/556 (40%), Positives = 322/556 (57%), Gaps = 23/556 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP++   SN KNSERK+L  +  +Q   E Y F ++ IK   F  Q +VGTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           NNIP+ F+ KH +   PTVYSCW +P LLP+V TH  V+E  L  GA+LM+ G++PPF S
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
               G + G+A  ++P VV A+G+ E+DL              +V+H + DGL + FKV+
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 REAP---------------EASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVD 225
            E P               +    +                     +AE L+ LT+ DVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHF 285
           + +TRA+YY++  D  L LP++ASKFI+ H+++NLPP+D ++V VK+SSW K+AK LKHF
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 286 EAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQS-----LEI 340
           E +G+L LKGK +  T+V  N+  + LK+F PY+      S GS  ++T++      +  
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 341 VYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQ 400
           +  Y P       L    +      +++D+R+ + +Y++ +   D  DK  + +DD L  
Sbjct: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLFN 420

Query: 401 LLHKNVNA-DTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPPIKVTNE 457
           +++K     DT R + R E L  LLS +F+E++ + R D  L    P KG  P IK+  E
Sbjct: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480

Query: 458 RKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIV 517
            KI +KV+TKVSNFEV+ +DPE LAA+LR  CSGSTTI +    K+ EVQVQGPH   I+
Sbjct: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540

Query: 518 SILNKHGIPSKYITLD 533
             LNK GIPSK+I  +
Sbjct: 541 DYLNKSGIPSKWIDFE 556

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  395 bits (1015), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 215/572 (37%), Positives = 321/572 (56%), Gaps = 34/572 (5%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKK PN+  +SN KNSERK+L  S +EQ     Y F S+ IK   +K Q++ GTVYTD 
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
            N+P+WF+ KH     P+VY+CW +P LLP++ T+ +V+E K+  GA+LM+ GT+ PF  
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
               G + GIAS + P VV A+GI ++DL+              VLH  GDGL   FK+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 REAPEA--------------SEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVDH 226
            E PE                +                       LAE LE L ++ +D 
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD 240

Query: 227 LLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFE 286
            +T+++YY++  D +L+ P++AS FI+ +++ NLPP+D   V +K+SSW K AK L+HFE
Sbjct: 241 FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE 300

Query: 287 AQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVS--------DKASTGSKNSSTTQSL 338
            +G + LKGK +   +   N     LKSF PYRT +        DK +  S N    QS 
Sbjct: 301 KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMMQS- 359

Query: 339 EIVYHYVPNRTLLPQLNGLGISGGDAL-SAKDIRDRLEQYVAARKCVDPYDKSMLRLDDT 397
             V +Y P  +L   L    ++   +L +A ++RD + +Y+  +  VD  +K M+ +DD 
Sbjct: 360 --VSYYKP-ISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDL 416

Query: 398 LAQLLHKNVNADTPRSLPRPEALAALLSRSFSEYF-VVMRGD----APL-SKPQKGRAPP 451
           +  L++K  N+  PR + R + +  +   +F+E+F +  +GD     PL  KP +G  P 
Sbjct: 417 MYSLVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPK 476

Query: 452 IKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITD-VPNTKAVEVQVQG 510
           +++  E KI +KV+T+VSNFEV+ +D E LAA+LR  C+G+TTI + + + K  EVQVQG
Sbjct: 477 VEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQG 536

Query: 511 PHEATIVSILNKHGIPSKYITLDCKVQPKKKK 542
           PH   I+  LN   IP+K+I     V+PK+KK
Sbjct: 537 PHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  393 bits (1009), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 201/566 (35%), Positives = 319/566 (56%), Gaps = 28/566 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKK   +   SN KNSE + ++ + R+      Y+F  +++K  TF++    G +YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           NN+P+WF+ K+  T +PTVY+ W++P+ +P++ TH+ ++E+K+  GA+LM+PGTV P   
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
             + G++ GIAST+ PG + A+G+C  D+               VLH Y D L  +FK++
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 REAP---------------------EASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERL 219
              P                     E SEA+                     LAE LE+L
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADD--LAETLEQL 238

Query: 220 TMEDVDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAA 279
            +ED+D+ LT+++YYTI  +  LQLP+ +S F++ +++KNLP +D +QV +K+SSW K A
Sbjct: 239 RVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTA 298

Query: 280 KLLKHFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQS-L 338
           K LKHFE +G L LKGK +  T+   N     LK+F PYR      +  SK+    ++ L
Sbjct: 299 KFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFL 358

Query: 339 EIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTL 398
           ++V  Y P +        LG++     ++ +I   ++ Y+A +   +P DK+ + +DD L
Sbjct: 359 KVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVL 418

Query: 399 AQLLHKNVNADTPRSLPRPEALAALLSRSFSEYFVVMRGD-APLSK-PQKGRAPPIKVTN 456
             L+  N  A+  R++ R + +  +L  +F  Y  +   D   LSK P+KG  P +K+  
Sbjct: 419 FDLVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVT 478

Query: 457 ERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATI 516
           E+    KV+T+VSNFEV+ +D ++++ EL+V CSGST+I ++PN    EVQVQGPH   +
Sbjct: 479 EKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPN--GSEVQVQGPHGDIV 536

Query: 517 VSILNKHGIPSKYITLDCKVQPKKKK 542
           +    KHGIP K+     KV+PKK++
Sbjct: 537 MEYFEKHGIPRKWFDYTNKVKPKKRR 562

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  390 bits (1003), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/564 (39%), Positives = 313/564 (55%), Gaps = 40/564 (7%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKK+P++   SN KNSE K+L A+ R Q   + Y F +  IK   F+ QS +GTVYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
           +N P+WF+ KH     PTV++CW HP LLPVV TH  VVE +L  GA+LML GTV PF S
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
             + G V GIAS  AP VV AVG+ ++DL              +++H   DGL +VFKV 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 REAP-------------EASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVDHL 227
            E P             E    +                     +AE L+   +EDVD  
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLEDVDQF 240

Query: 228 LTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEA 287
           LTRA+YYT+  D +L+LP++AS FI+ H+  NLP +D  +V VK+SSW K AK LK+FE 
Sbjct: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNFEK 300

Query: 288 QGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGS-------KNSSTTQSLEI 340
           +G L LKGK +  T++ +N     L++F+PY+        G+       K+ S     E 
Sbjct: 301 EGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLRCET 360

Query: 341 VY-------HYVPNRTLLPQLNGLGISGGDAL-SAKDIRDRLEQYVAARKCVDPYDKSML 392
           +Y        ++    L PQ         D L +A+++++ L  Y+A+    D  +K M+
Sbjct: 361 LYKPINLAKDFIQQTDLNPQ---------DILYTAQELKNALNDYIASNNLADSKNKKMV 411

Query: 393 RLDDTLAQLLHKNVNADT-PRSLPRPEALAALLSRSFSEYFVVMRGDAPLSK-PQKGRAP 450
            LDD L  L++K     T PR + R   +  LL+ SF+ +F + +GD PL K P +G  P
Sbjct: 412 ILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLP 471

Query: 451 PIKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITD-VPNTKAVEVQVQ 509
            I++  E KI +KV+T+VS FE++ +D +ELAA LR  CSGSTTI + + + K  EV VQ
Sbjct: 472 NIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQ 531

Query: 510 GPHEATIVSILNKHGIPSKYITLD 533
           GPH   I+  LN  GIP+K+I  D
Sbjct: 532 GPHGPLIIDHLNSLGIPTKWIKFD 555

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  389 bits (998), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 213/553 (38%), Positives = 313/553 (56%), Gaps = 24/553 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MF+KEP++   SN KNS+RK+L  +I  Q   + Y   S  +K   F+T +T+GT+YTD 
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPSI-VKQTNFQTPTTIGTIYTDE 59

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
            NIP+WF+ KHD     TVY+CW+  DLLP+  +H+ V++ KL  GA+LM+ GT+PPF  
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 GTRRGRVVGIASTRAPG-VVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKV 179
             + G + G+AS + PG VV A+GI  MDL              +++H + D L + FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 QREAPEASEAKXXXXXXX---------------XXXXXXXXXXXXXXLAEELERLTMEDV 224
             + P     K                                    LAE L+ L+++DV
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 225 DHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKH 284
           D+ +TRA+YYTI  D +L LP++AS FI++H+ KNLP +D ++V +K+SSW K AK LKH
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299

Query: 285 FEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRT-VSDKASTGSKNSSTTQS--LEIV 341
           FE +G L LKGK +  TVV +N   + LK+F PY+   S+  + G+K    +QS  +  +
Sbjct: 300 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQSGMMYSI 359

Query: 342 YHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQL 401
             Y P       +   G+   +     +IRD +  Y+  +  VD  +K M+ LDD L  +
Sbjct: 360 TFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLFGM 419

Query: 402 LHKN-VNADTPRSLPRPEALAALLSRSFSEYFVVM--RGDAPLSKPQKGRAPPIKVTNER 458
           ++K   +    RS+ R + L   L  +F+E+F +   +G      P +G  P IK+  E 
Sbjct: 420 VNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILTEM 479

Query: 459 KIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQVQGPHEATIV 517
           KI +KV+TKVSNFE +G++PE LAA+LR  CSGSTTI +   + K  EVQVQGPH   I+
Sbjct: 480 KIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQIII 539

Query: 518 SILNKHGIPSKYI 530
             LNK G+P+K+I
Sbjct: 540 DHLNKLGVPTKWI 552

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  382 bits (982), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/559 (38%), Positives = 311/559 (55%), Gaps = 26/559 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKKEP++   SN KNSERK+LQ   R Q   E Y F S  IK   FK  +T+GT+YTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
            N P+WF+ KHD+   PTV +CW  P+L+PVV TH  V+E  +  GA+LM+ GT+PPF  
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
               G V GIA  R P ++ AVGI +M+L              +++H   D L +VFKV+
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 REAP---------------EASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMEDVD 225
            E P                 ++                       +AE L+ L +ED+D
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240

Query: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPP-MDLSQVTVKRSSWGKAAKLLKH 284
           + +TRA+YYTI  D +L+ P +AS F++ H+  NLP   +L++V +K+SSW K AK LKH
Sbjct: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300

Query: 285 FEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKAS-TGSKNSSTTQSLEIVYH 343
           FE +G L LKG  +  T+V VN   + +K F PY  + ++ S TGS+  +   +++IV  
Sbjct: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIKIVTL 360

Query: 344 YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH 403
           Y P       ++   +         +I++ + +Y+  +  VD  DK  + +DD L  +++
Sbjct: 361 YKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDMLMTMIY 420

Query: 404 KNV--NADTPRSLPRPEALAALLSRSFSEYFVVMR----GDAPLSK-PQKGRAPPIKVTN 456
           K     A   R +PR   L  +L  +F++ + + R       PL+K P KG  P I +  
Sbjct: 421 KKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKINIVT 480

Query: 457 ERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT--KAVEVQVQGPHEA 514
           E KI +KV+TKVSNFEV+ +DPEE AA++R +CSGSTTI +  ++  K  EVQVQGPH  
Sbjct: 481 EMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQGPHGQ 540

Query: 515 TIVSILNKHGIPSKYITLD 533
            I+S LN  GIP+K+I  +
Sbjct: 541 LIMSYLNDLGIPNKWIDFE 559

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  381 bits (979), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/553 (38%), Positives = 306/553 (55%), Gaps = 21/553 (3%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEY-ESYQFSSTEIKHGTFKTQSTVGTVYTD 59
           MFKKEP +   S  KNS+RK+L  S++ Q +  E    +   I    F + +  GT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  PNNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFS 119
            N+IP+ F+ KH  T  PT +  W +  LL  V TH  VVE+ +  GADLM+ GTVPPF 
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 SGTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKV 179
           S    G +  +A+  AP V  AVGI +++L               +LH + D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 QREAPEASEAKXXXXXXXXXXXXXXXXXXXXX-------------LAEELERLTMEDVDH 226
           + E P + ++                                   +AE L+ LT+EDVD+
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240

Query: 227 LLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFE 286
            + RA+Y+T+  D  L LPV AS F++ H+++NLP +D  +V +KR+SW K AK LK+FE
Sbjct: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYFE 300

Query: 287 AQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSST-TQSLEI--VYH 343
            +G L LKGK +   +V +N   + LK+F PY+  +      SK+ ST TQ + +  V  
Sbjct: 301 KEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGVSVSSVNL 360

Query: 344 YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLH 403
           Y P       +    ISGG   ++ +IR+ +  Y+  +  VD  DK M+ LDD L  +++
Sbjct: 361 YKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFAMVN 420

Query: 404 KNV-NADTPRSLPRPEALAALLSRSFSEYFVVMRGD-APLSK-PQKGRAPPIKVTNERKI 460
           + + N   PR +PR   L  L++ +F+EYF + +GD  PL K P KG+ P I +  E KI
Sbjct: 421 RKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTEMKI 480

Query: 461 YKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIVSIL 520
            +KVVT+VSNFE + + PEELAA+LR  CSGSTTI++ P  K  EVQVQGPH   I+   
Sbjct: 481 GRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQGPHGQLIIDHF 539

Query: 521 NKHGIPSKYITLD 533
           NK GIPSK+I  +
Sbjct: 540 NKSGIPSKFIQFE 552

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  365 bits (938), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/563 (36%), Positives = 315/563 (55%), Gaps = 23/563 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKK P++   SN KNSERK+L  S + Q     Y F ++ IK   F  Q++VG +YTD 
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120
              PLWF+ KH +   PTVY+CW+ P LLP+V TH+ V+   +  GA+LM+ GT+PPF S
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRVFKVQ 180
                 + GIA+   P  + AVG+ ++D+               VLH +GDG+   FK++
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 REAPEASEAKXXXXXXXXXXXX----------------XXXXXXXXXLAEELERLTMEDV 224
           R+ P     K                                     LA+E   LT+ED+
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 225 DHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKH 284
           DH +TR++YYT+  D +L  P+ +S FI+ H+++NLPP+D + V +K++SW K++K LKH
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300

Query: 285 FEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSK-NSSTTQSLEIVY- 342
           FE +G + LKGK E  T+V  N   E LK FEPYR  +  +++G K NS+  +S  ++Y 
Sbjct: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMMYS 360

Query: 343 --HYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQ 400
              Y P  +    +    +   +  +A ++++ + +Y+  ++ VD  +  M  LDD L  
Sbjct: 361 LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD 420

Query: 401 LLHKNVNADTPRSLPRPEALAALLSRSFSEYFVVMRG-DAPLSK-PQKGRAPPIKVTNER 458
           + +   + + PR + R   + +  + +F+E + + +  D PL+K P +G  P IK+  E 
Sbjct: 421 MCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTEM 480

Query: 459 KIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQVQGPHEATIV 517
           KI +K+VT+VSNFE +G+D + LA +LR  CSGSTTI +   + K  EVQVQGPH   I+
Sbjct: 481 KIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSKIII 540

Query: 518 SILNKHGIPSKYITLDCKVQPKK 540
             LN   IP+K+I  + K++PKK
Sbjct: 541 DHLNSLSIPTKWIDFENKLKPKK 563

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  360 bits (924), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/575 (35%), Positives = 322/575 (56%), Gaps = 54/575 (9%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEI-KHGTFKTQS--TVGTVY 57
           MFKKEP++   SN KNS+RK+L  +I+ Q   E+Y F+++ I K   F+T +  ++GT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDPNNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPP 117
           T+ +NIP+WF+ KH+    PTV++CW++ D+LP + +H+ V++ KL  GA+LM+ GT+PP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FSSGTRRGRVVGIASTRAPG-VVKAVGICEMDLEXXXXXXXXXXXXXRVLHTYGDGLCRV 176
           F S    G + GIAS + P  +V A+G+ +M++               V+H + D L ++
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FK-------------VQREAPEASEAKXXXXXXXXXXXXXXXXXXXXXLAEELERLTMED 223
           FK             +  E P+ ++                         E L+    ED
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPD----FEVLDHFKTED 236

Query: 224 VDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLK 283
           VD+ +TR++YYTI  D +++LP++AS FI++H+ KNLP +  ++V +K++SW K AK LK
Sbjct: 237 VDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLK 296

Query: 284 HFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYH 343
           HFE +G L LKGK +  TVV +N   + LK+F PY+       + S +S  T        
Sbjct: 297 HFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKG 356

Query: 344 YVPNRTLLPQLNGLGISGGDALSA------------KDIRDRLEQYVAARKCVDPYDKSM 391
            + + T    +N       D L A            ++IRD +  Y+ ++  +D  +K M
Sbjct: 357 MMYSETFYKPIN----HAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKM 412

Query: 392 LRLDDTLAQLLHK---NVNADTPRSLPRPEALAALLSRSFSEYFVVMR-----GD----- 438
           + LDD L  ++HK     NA  PR++ R   L  +L+ +F+E++ + R     G+     
Sbjct: 413 ILLDDLLFNMVHKRQSEANA-APRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDV 471

Query: 439 APLSK-PQKGRAPPIKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITD 497
            PL K PQ+G  P I +  E KI +KV+TKVSNFE++G+  + LAA+LR  CSGSTTI +
Sbjct: 472 EPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGE 531

Query: 498 VPNT-KAVEVQVQGPHEATIVSILN-KHGIPSKYI 530
              + K  EVQVQGPH   I+  LN K G+P+K+I
Sbjct: 532 TMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWI 566

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  344 bits (882), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/554 (36%), Positives = 306/554 (55%), Gaps = 24/554 (4%)

Query: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60
           MFKK P++ P SN KNSE+++LQ  +++Q+  + + FS   +K   F++ ++VGT+Y + 
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  NNI--PLWFRGKHDQTYI-PTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPP 117
             I  PL+F+ KH    + P+VY+CW HP LLP++ TH  V+E  L  GA+LM+ GT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FS-SGTRRGRVVGIASTRAPGVVKAVGICEMDLE--XXXXXXXXXXXXXRVLHTYGDGLC 174
           F  +   +GR  GIA+ ++P V+ AVG  +MDLE                V H + DGL 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 RVFKVQREAPEASEAKXXXXXX------XXXXXXXXXXXXXXXLAEELERLTMEDVDHLL 228
             F+++ + P+  E+                            LAE LE L++EDVD+ +
Sbjct: 181 DAFRLKLDIPDKLESATTQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLETLSVEDVDYFM 240

Query: 229 TRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPP-MDLSQVTVKRSSWGKAAKLLKHFEA 287
           TRA+YYT+  + +L LP+ AS F++ H++K LP  +D ++V VK+SSW K AK LKHFE 
Sbjct: 241 TRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKYLKHFEK 300

Query: 288 QGLLTLKGKPESFTVVSVNSA--HEALKSFEPYRTVSDKASTGSKNSSTTQSLEI-VYHY 344
           +GLL LKGK +   VV    +  H  LK F PY   +  A +G K+ +T   +   V  +
Sbjct: 301 EGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNGPVMFAVTSF 360

Query: 345 VPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHK 404
            P+ T       L + G    S  +IR+ L +Y+ A K   P +  M+ L+DTL  ++ K
Sbjct: 361 QPDST---AQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGMVTK 417

Query: 405 NVNAD--TPRSLPRPEALAALLSRSFSEYFVVMRG-DAPLSK-PQKGRAPPIKVTNERKI 460
                  T R + RPE L  ++   F   + + +  D PL+K PQKG  P + +  E KI
Sbjct: 418 GNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITEMKI 477

Query: 461 YKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAV-EVQVQGPHEATIVSI 519
            +KVVT+V NF+   +   E AA+LR  CS STTI    +T  V E+QVQG H   I+  
Sbjct: 478 GRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGAHGPLIIDH 537

Query: 520 LNKHGIPSKYITLD 533
           L + G+PS ++  +
Sbjct: 538 LRELGVPSSWVVFE 551

>Smik_4.822 Chr4 complement(1441244..1442278) [1035 bp, 344 aa] {ON}
           YDR541C (REAL)
          Length = 344

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 248 ASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQGLLTLKGKPE 298
           AS FIA H+L  L   D   +   RS   K AKLL+ F+    LTL+  P+
Sbjct: 10  ASGFIALHILSQLLKQDYKVIGTVRSH-EKEAKLLRQFQHNPNLTLEIVPD 59

>YDR541C Chr4 complement(1519664..1520698) [1035 bp, 344 aa] {ON}
           Putative dihydrokaempferol 4-reductase
          Length = 344

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 248 ASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEAQGLLTLKGKPE 298
           AS FIA H+L  L   D   +   RS   K AKLL+ F+    LTL+  P+
Sbjct: 10  ASGFIALHILSQLLKQDYKVIGTVRSH-EKEAKLLRQFQHNPNLTLEIVPD 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,414,096
Number of extensions: 2088085
Number of successful extensions: 6220
Number of sequences better than 10.0: 26
Number of HSP's gapped: 6329
Number of HSP's successfully gapped: 38
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)