Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR078C8.270ON71571537730.0
Ecym_43008.270ON71572925550.0
SAKL0H16852g8.270ON6445495282e-57
Kwal_56.237668.270ON7405224334e-44
KLTH0G13508g8.270ON6455093836e-38
KLLA0F19316g8.270ON6715153421e-32
TDEL0F039708.270ON6194381734e-12
Smik_4.3628.270ON6483861682e-11
TBLA0C045708.270ON6083321654e-11
YDR118W (APC4)8.270ON6523671638e-11
Skud_4.3788.270ON6523871531e-09
CAGL0B01859g8.270ON6223801521e-09
KAFR0B054608.270ON6103801493e-09
KNAG0H031908.270ON6224121476e-09
ZYRO0C01474g8.270ON5993471466e-09
Suva_2.2778.270ON6493801468e-09
NDAI0J012708.270ON7354071010.002
NCAS0B037908.270ON612343930.017
TPHA0C028008.181ON229111880.032
Kpol_392.18.270ON424118800.45
AFR492W4.100ON691158781.0
KNAG0D026608.72ON54792733.5
KAFR0B057408.326ON619109734.2
Smik_4.6255.417ON98290716.1
Kpol_1036.708.326ON674126709.7
NOTE: 1 genes in the same pillar as AGR078C were not hit in these BLAST results
LIST: TPHA0J00790

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR078C
         (715 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...  1457   0.0  
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...   988   0.0  
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   207   2e-57
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   171   4e-44
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   152   6e-38
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...   136   1e-32
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...    71   4e-12
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...    69   2e-11
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...    68   4e-11
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...    67   8e-11
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...    64   1e-09
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...    63   1e-09
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...    62   3e-09
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...    61   6e-09
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...    61   6e-09
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...    61   8e-09
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....    44   0.002
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...    40   0.017
TPHA0C02800 Chr3 (611168..611857) [690 bp, 229 aa] {ON} Anc_8.18...    39   0.032
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...    35   0.45 
AFR492W Chr6 (1323730..1325805) [2076 bp, 691 aa] {ON} Syntenic ...    35   1.0  
KNAG0D02660 Chr4 (475678..477321) [1644 bp, 547 aa] {ON} Anc_8.7...    33   3.5  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    33   4.2  
Smik_4.625 Chr4 complement(1118384..1121332) [2949 bp, 982 aa] {...    32   6.1  
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    32   9.7  

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 1457 bits (3773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/715 (98%), Positives = 703/715 (98%)

Query: 1   MTQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL 60
           MTQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL
Sbjct: 1   MTQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL 60

Query: 61  RCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVW 120
           RCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVW
Sbjct: 61  RCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVW 120

Query: 121 NRIKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNM 180
           NRIKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNM
Sbjct: 121 NRIKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNM 180

Query: 181 FLTFDNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE 240
           FLTFDNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE
Sbjct: 181 FLTFDNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE 240

Query: 241 FTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLK 300
           FTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLK
Sbjct: 241 FTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLK 300

Query: 301 DVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360
           DVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK
Sbjct: 301 DVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360

Query: 361 RLLGLVKSLKLNVFGLDDDNELTAVEVQDXXXXXXXXXXXXVEQVEQFHVGENVSKDGLA 420
           RLLGLVKSLKLNVFGLDDDNELTAVEVQD            VEQVEQFHVGENVSKDGLA
Sbjct: 361 RLLGLVKSLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLA 420

Query: 421 WIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSW 480
           WIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSW
Sbjct: 421 WIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSW 480

Query: 481 IKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVGHRLEDALVDGETIY 540
           IKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVGHRLEDALVDGETIY
Sbjct: 481 IKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVGHRLEDALVDGETIY 540

Query: 541 MICSKRSPKRPDLDEEVECSPSRESELQQSMGKLSEETPVDGYSRIFTLVQYDVSSKELT 600
           MICSKRSPKRPDLDEEVECSPSRESELQQSMGKLSEETPVDGYSRIFTLVQYDVSSKELT
Sbjct: 541 MICSKRSPKRPDLDEEVECSPSRESELQQSMGKLSEETPVDGYSRIFTLVQYDVSSKELT 600

Query: 601 RQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLVGYSGATDVKNSARITIYNDF 660
           RQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLVGYSGATDVKNSARITIYNDF
Sbjct: 601 RQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLVGYSGATDVKNSARITIYNDF 660

Query: 661 KVIMEPTALDITNKKYCKNQMIVHSDMAVTILSPIPVEAPADANSGHCQLVVQIM 715
           KVIMEPTALDITNKKYCKNQMIVHSDMAVTILSPIPVEAPADANSGHCQLVVQIM
Sbjct: 661 KVIMEPTALDITNKKYCKNQMIVHSDMAVTILSPIPVEAPADANSGHCQLVVQIM 715

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/729 (63%), Positives = 578/729 (79%), Gaps = 28/729 (3%)

Query: 1   MTQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL 60
           MTQWKVKLTKQWDG ++PFWNDRLSLWG+ EK  ++IFRYIDGR++G+IPLRL+ NEE+L
Sbjct: 1   MTQWKVKLTKQWDGLVDPFWNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEIL 60

Query: 61  RCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVW 120
            CQ EP+DG+LFAV LRSGSVK+Y+GR D + ++ ++GA++VGT+VLGRG+ F MEQFVW
Sbjct: 61  TCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVW 120

Query: 121 NRIKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNM 180
           NRIKW+ R  F G+FD+ L QWLP+LTEM++S QGKL CTPL +EGPEWNA L+ +ESNM
Sbjct: 121 NRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNM 180

Query: 181 FLTFDNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE 240
           FLT+DN TRKV++SIDGTFNFRYGEK+KFPTKVT+IL GN N+YVF+NDEDWQLQ+I+LE
Sbjct: 181 FLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE 240

Query: 241 FTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLK 300
           FTE HQ+HELMKCCS IQFL+KY+RDNH++IG KLMEPHATF  SLFP+EQ ++ +KGLK
Sbjct: 241 FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLK 300

Query: 301 DVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360
           DVFYLGYS +K +ENWFTLKLGRHG +IWKQRNHLFWSSSQG+LVTCMIPACERLIV+ K
Sbjct: 301 DVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVK 360

Query: 361 RLLGLVKSLKLNVFGLDDDNELTAVEVQDXXXXXXXXXXXXVEQVEQFHVGENVSKDGLA 420
           RL GL+KSLKLN+FGLDDD EL A EV +            V+QVE+FH+GEN+S DGL 
Sbjct: 361 RLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLT 420

Query: 421 WIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSW 480
           WIEYM+DSLL  E++D +N NGQD   S+D+D  + YPKEHYS QLFLN +++P + Y W
Sbjct: 421 WIEYMIDSLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKW 480

Query: 481 IKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVGHRLEDALVDGETIY 540
           IK+DFP++LE L+RQFDLVQKNYTAKWIKK+IKV GP+RKL+S+ G RL+DA++DG+ IY
Sbjct: 481 IKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSITGQRLKDAIMDGDVIY 540

Query: 541 MICSKRSPKRPDLDEEVECSPSRESELQQSMGKLSEETPVDGYSRI-------------F 587
           MICSK S            + S+ ++  QS  ++ E+   D +  +             F
Sbjct: 541 MICSKSS-----------STTSQGTDQDQSREQIQEQ---DDHQEVDQEQDQLQDQDEEF 586

Query: 588 TLVQYDVSSKELTRQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLVGYSGATD 647
           T++QYD +SKELT+Q IP P   + I SIKFVPGE  RFLMLTEDG +RRYLV YS +  
Sbjct: 587 TIIQYDSTSKELTKQLIPLPETLSSIVSIKFVPGEPGRFLMLTEDGYLRRYLVNYSSSLG 646

Query: 648 VKNSARITIYNDFKVIMEPTALDITNKKYCKNQMIVHSDMAVTILSPIPVEAPA-DANSG 706
           +K+ +RITIYND K++MEP+ L++ NK   +N+MIVHSDMAVTILS    E    + ++ 
Sbjct: 647 IKDPSRITIYNDLKILMEPSTLELLNKNAAENRMIVHSDMAVTILSSFTNEQGVLEPHTS 706

Query: 707 HCQLVVQIM 715
           +CQL V +M
Sbjct: 707 YCQLAVHLM 715

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  207 bits (528), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 144/549 (26%), Positives = 265/549 (48%), Gaps = 49/549 (8%)

Query: 1   MTQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL 60
           M +W+V   K + G+    WN  LSL+ V   + +++ R +DG+R+  + ++   +  ++
Sbjct: 1   MVKWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVK--DHGTIV 58

Query: 61  RCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVW 120
             QWE  +G +FAV   +G +++Y         + S   + VG+V+LG  D   + +F W
Sbjct: 59  DYQWEQSEGRIFAVCHSNGIIRLY---------DSSLAGKSVGSVILGDSDC-DVLKFCW 108

Query: 121 NRIKWRVREPFCGEFDSPLVQWLPRLTE-MSISAQGKLLCTPLGYEGPEWNAGLAADESN 179
           ++  W     F   FD  +   +PRL + +  S Q  +L T +G   P W + L  ++S 
Sbjct: 109 SQDSWTFGSKFSNVFDHEITSLMPRLVKFVKDSRQLTMLPTDVGDGVPRW-SKLDGNKSF 167

Query: 180 MFLTFDNNTRKVVLSIDGTFNF------------RYGEKSKFPTKVTSILPGNENHYVFI 227
           +FL +D+  +K++++IDG F              R  E    P  V  IL  +   Y+ I
Sbjct: 168 IFLGYDSKRQKILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVI 227

Query: 228 NDEDWQLQVIRLEFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLF 287
            D DW +Q I+ +F   +   E++ CC+ I+ L K + ++  L+ T+L+EP+  F   + 
Sbjct: 228 TD-DWYIQKIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVL 286

Query: 288 PEEQFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTC 347
              +    +  L ++ + G S    +E+W +  +G      WK+ + + + ++  ++V  
Sbjct: 287 GAYE-GDLIGDLTELLFTG-SVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLT 344

Query: 348 MIPACERLIVSAKRLLGLVKSLKLNVFGLDD-DNELTAVEVQDXXXXXXXXXXXXVEQVE 406
           M+P CERLI+  +RL G++K LKL   GL + ++ L  +E Q             +  ++
Sbjct: 345 MVPVCERLILCGERLHGIIKGLKL--IGLKELEDNLEVLEAQKLVCLSQEALENIIVSIK 402

Query: 407 QFHVGENVSKDGLAWIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQL 466
           Q +V  N+ +   A+I++  D ++   DED           S + DP          +Q 
Sbjct: 403 QINVDSNLHE---AFIDWFHDMVMEAVDEDYKRKT------SYNCDP--------LKIQQ 445

Query: 467 FLNEYIIPKKPYSWIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVG 526
           F++  +     Y W +  FP+    L +QF+ V++ Y A W+ + +K   P+   K L  
Sbjct: 446 FMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQLYVANWVVQRVKFGEPICIKKGLEK 505

Query: 527 HRLEDALVD 535
            R++D  VD
Sbjct: 506 TRVKDVGVD 514

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  171 bits (433), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 136/522 (26%), Positives = 235/522 (45%), Gaps = 47/522 (9%)

Query: 2   TQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLR 61
           + WK+K         +  WN RLSL+ VL  + +++ R IDG+++ A+   LR   E++ 
Sbjct: 3   SNWKLKGVVTLPKGHKVVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAV--NLRDEHEIVG 60

Query: 62  CQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWN 121
            QWE ++ +LFAV   +G V+IY      + + G    E+V  V  G+    +++  VW 
Sbjct: 61  IQWEKNESKLFAVFQSNGVVRIY------DCSIGGSLREMVNLVEEGQAAEVKVDAVVWM 114

Query: 122 RIKW-RVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNM 180
            ++W +  E + G  D  +   +P +  + +    +L   PL      W  G   D + +
Sbjct: 115 TVEWAKFPESYRG-LDFDITTLMPGMVRL-VRDSKQLSLAPLDLGKLSWLDGKYGDAA-I 171

Query: 181 FLTFDNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE 240
           FL  D  + + +++IDG  + R+    +    V  ILP   +       +D  LQ + L+
Sbjct: 172 FLAHDCESTEYMVAIDGQLSLRFPSGIR---NVHKILPQGGSGSFLAVGKDGTLQWVTLK 228

Query: 241 FTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLK 300
           F E   + EL+K    I+FL +Y+ +N  L  T+L+EP+  F   L    +       L+
Sbjct: 229 FLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLR 288

Query: 301 DVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360
           D+   GY  D  +E W    +G      WKQ +   +     VL   ++PACERLI++A+
Sbjct: 289 DILLTGYIPDD-LEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAE 347

Query: 361 RLLGLVKSLKLNVFGLDDDNELTAVEVQDXXXXXXXXXXXXVEQVEQFHVGENVSKDGLA 420
           R+ G+ KSLKL  F  D   ELT VE+Q             +  + + +    + +    
Sbjct: 348 RMQGIHKSLKLQRFCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQ---V 404

Query: 421 WIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSW 480
           + E+  D ++   DED +    +DG+           P + Y +  +L+        Y W
Sbjct: 405 FAEWFYDVVMETVDED-YKRPSRDGI-----------PLDSYGLDQYLS--------YCW 444

Query: 481 IKSDFPSQLEVLMRQF--------DLVQKNYTAKWIKKLIKV 514
             S+   + E  + +          L+ + YT +W+   I V
Sbjct: 445 QSSETIQRFETSLPELAARPGVSAALLDRKYTREWLLADIHV 486

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  152 bits (383), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 131/509 (25%), Positives = 225/509 (44%), Gaps = 42/509 (8%)

Query: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSG 79
           WN RLSL+ VL  + +S+ R IDG+R+ A+   LR + +L+  QWE  +G+LFA+   +G
Sbjct: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAV--NLRGDGQLIGAQWELAEGKLFALFFGNG 78

Query: 80  SVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKW-RVREPFCGEFDSP 138
           +V+IY      +   G    E+V  V  G+     ++  VW+  +W + R+ + G  +  
Sbjct: 79  AVRIY------DCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKG-LNIE 131

Query: 139 LVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNMFLTFDNNTRKVVLSIDGT 198
           + + LP +  +   A+ +L   PL      W A    D + +FL  D  +   ++++DG 
Sbjct: 132 ITKQLPGMVRLVRDAK-QLSVVPLETGKLRWLADPGKDAA-IFLGHDEKSGDYLMTVDGL 189

Query: 199 FNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQVHELMKCCSHIQ 258
            + R     K   K+  IL   E+        D  +Q + L F     + EL++    I+
Sbjct: 190 LSVRVPSGIK---KMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIRYSGQIR 246

Query: 259 FLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWFT 318
           FL  Y+ +N  +  T L+EP+  F   +    +  +     +D+   GY  +  +E+W  
Sbjct: 247 FLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPED-LEDWLC 305

Query: 319 LKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFGLDD 378
             +G      WKQ +   +     VL   +IPACERLI++A++L G+ K LKL  FGL  
Sbjct: 306 NSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLAS 365

Query: 379 DNELTAVEVQDXXXXXXXXXXXXVEQVEQFHVGENVSKDGLAWIEYMMDSLLHNEDEDAH 438
             E  + EV +            +E V   +    +      + ++  D ++   DED  
Sbjct: 366 PQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHA---IFADWFYDVVMETVDEDYK 422

Query: 439 NLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSWIKSDFPSQLEVLMRQFDL 498
               +D          + Y        L L++YI     + W  S+  ++ E L+ Q   
Sbjct: 423 RPQNRDS-------HQDCYGDR----ALALDQYI----SHCWENSEVWTRFERLLPQLAA 467

Query: 499 --------VQKNYTAKWIKKLIKVPGPVR 519
                   +   YT  W+ + + V  PVR
Sbjct: 468 DADISATKLDHIYTRAWVLEQVHVTSPVR 496

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 128/515 (24%), Positives = 227/515 (44%), Gaps = 70/515 (13%)

Query: 24  LSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKI 83
           + LW V     + I+R   G  +  +   + QN  L+   W  +D  LF     SG+V I
Sbjct: 29  VCLWNVHNN--IEIYRTNGGYLINRLNDEI-QNHRLIDVVWHGND--LFC-CYNSGTVSI 82

Query: 84  YRGRLDPEGTEGSEGAELVGTVVL----GRGDAFQMEQFVWNRIKWRVREPFCGEFDSPL 139
           YR           EG ELV  +       +      +  V +  ++ +        D  L
Sbjct: 83  YR-----------EGRELVKQLTFIPKGAKTKCILCDNLVPSDDRYSLS-------DGNL 124

Query: 140 VQWLPRLTEMSISAQGK----LLCTPLGYEGPEWNAGLAADESNMFLTFDNNTRKVVLSI 195
           +  +P+L +  +         +L + LG + P           ++F+  D+ T K++LSI
Sbjct: 125 LNSMPKLNKWDMIKNELDNELILNSELGKKKP----------IDIFMAIDSKTNKLILSI 174

Query: 196 DGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQVHELMKCCS 255
           +GT N + GEK K P  +  I+  +   Y+ +  +DW  QV+ L F +   +++L+K   
Sbjct: 175 EGTLNIKVGEKLKLPKDIKRIIKVSSGKYMCLG-KDWSYQVLDLTFLQDPNIYKLIKTTQ 233

Query: 256 HIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVEN 315
               LL+Y++  HR +  KL EP+  F  +L  EE        L+++FY+G +  + +E 
Sbjct: 234 EYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH----KNALQELFYIGVTKLEVMEE 289

Query: 316 WFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFG 375
              ++L       W   ++   S+S G++V C IP  ER+IV A  +  L +++    F 
Sbjct: 290 LHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFP 349

Query: 376 LDDDNEL-TAVEVQDXXXXXXXXXXXXVEQVEQFHVGENVSKDGLAWIEYMMDSLL---H 431
               NE+    ++++              Q +     +   + GL WI  + DSL     
Sbjct: 350 ----NEIWVGSKLRERTVETLKSVR---SQTDSIMKNKKTQELGLMWIRSLSDSLSKMER 402

Query: 432 NEDE----DAHNLNGQD--GLFSSDL-----DPHEVYPKEHY-SVQLFLNEYIIPKKPYS 479
           N D+    +    NG +    F S       D   +  +    +V+ FL + ++P+K Y 
Sbjct: 403 NRDQISPPEPETTNGSNNFSFFGSSTGITGEDSKTLQKRADINTVEKFLAKDLLPEKQYE 462

Query: 480 WIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKV 514
           W+K+ FP+ +     +FD + K+YT KW+K+ + V
Sbjct: 463 WVKTSFPNLILETQAEFDKIIKDYTLKWLKRQMSV 497

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 90/438 (20%), Positives = 174/438 (39%), Gaps = 59/438 (13%)

Query: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSG 79
           +N   SL+     + LSI R  D  ++  + +R      L + QW+P  G+   V  + G
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVR--DLNVLAQFQWDPITGKRMTVFYKDG 68

Query: 80  SVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGEFDSPL 139
           + +IY         +  +  +L+  + + +    +++  +W+RI+   R+    +FD  +
Sbjct: 69  NARIY---------DAFQAGKLLALLRISKT---RVDGAIWDRIELS-RQEVTFKFDHFV 115

Query: 140 VQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESN------------MFLTFDNN 187
           +  +P++   +   +   +   L YE P     LA +E +            +    DN 
Sbjct: 116 LNSMPKMIRFARDTRQIFI---LPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNG 172

Query: 188 TRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQV 247
              +VL +DG F  R       P     ++     ++ F   ED  ++ + L+       
Sbjct: 173 ---LVLMLDGDFILRLAAGPSGPALKDIVVADRGLYHCFY--EDATVESLSLD------- 220

Query: 248 HELMKCCSHIQF---------LLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKG 298
            +L++C + IQ          L  Y++D+  LI   L+ P+  F   +       + +  
Sbjct: 221 -QLIQCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHE 279

Query: 299 LKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVS 358
             +   LG      +ENWF   +G      WK+     +  +  +L    IPACER+I+ 
Sbjct: 280 ELESLLLGGGLSVELENWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILL 339

Query: 359 AKRLLGLVKSLKLNVFGLDDDNELTAVEVQDXXXXXXXXXXXXVEQVEQFHVGENVSKDG 418
           ++R    +K+L+L    ++      + E  +            VE ++     E + +  
Sbjct: 340 SERCRACLKALQL----IESSTTTDSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTF 395

Query: 419 LAWIEYMMDSLLHNEDED 436
           L W +   D L    DED
Sbjct: 396 LQWFD---DRLHEALDED 410

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/386 (20%), Positives = 164/386 (42%), Gaps = 47/386 (12%)

Query: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL-RCQWEPDDGELFAVALRS 78
           +N R  ++     + L+I R  D  R+ AIP+R   N  L+    W+   G+  ++  + 
Sbjct: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIR---NINLVANYNWDTVTGKFLSIFFKD 68

Query: 79  GSVKIYR----GRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGE 134
           G+++I+     GRL                V   R  + ++ +  W+RI     E   G 
Sbjct: 69  GTIRIHDIFKDGRL----------------VSFLRIPSTKISKGTWDRIPLE-SESGNGN 111

Query: 135 FDSPLVQWLPRLTEMSISAQGKLLCTPLG-----YEGPEWNAGLAADESNMFLTFDNNTR 189
               ++ +LP+L    +    ++   P       + GP+ +     ++ ++ + F+    
Sbjct: 112 LAYNIIDYLPKLIRY-VKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHD 170

Query: 190 KVVLSIDGTFNFRY----GEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRL-EFTEY 244
           K+ +  +G +         E  +F   +  I  G  + +     +D  ++ + L      
Sbjct: 171 KITVFFNGDYAIFVPVGADENERFVKSIVKIQDGFYHCFY----DDGTVRTLNLGPLLRS 226

Query: 245 HQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ-FTKFMKGLKDVF 303
                ++K    I+ L+ Y+ ++   I  +L+ P+  F   L  E   + K +  L+ +F
Sbjct: 227 EPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLF 286

Query: 304 YLG-YSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRL 362
            LG  S D  +E+W    +G      WK      +  +  +L    +PACER+I+  ++L
Sbjct: 287 LLGEVSCD--LEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKL 344

Query: 363 LGLVKSLKL-NVFGLDDDNELTAVEV 387
            G++++  + N F  +D ++LTAV+ 
Sbjct: 345 RGILEAFSIQNKF--NDSSDLTAVDT 368

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 140/332 (42%), Gaps = 38/332 (11%)

Query: 49  IPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLG 108
           I  ++R   +++  QWE + G   A+  + G+V IY         +G + + L+  +  G
Sbjct: 39  INYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVMIY---------DGIKTSRLLAMLNGG 89

Query: 109 RGDAFQMEQFVWNRIKWRVREPFCGE---FDSPLVQWLPRLTEMSISAQGKLLCTPLGYE 165
           + +   ++  +W+R  +    P   E   FDS +  ++P L ++    + K    P  Y 
Sbjct: 90  KPN---VDAGIWDRYYF----PNDNEKDIFDSDITLYMPTLIQI---IRDKEKICPGTYF 139

Query: 166 GPE--WNAGLAADESNMFLTFDNNTRKVVLSIDGTFNFRY-GE-KSKFPTKVTS-----I 216
            P   W A       N FL    +   +  S+D +F F   GE K  FP+  TS     I
Sbjct: 140 PPHSTWRAKKEESLKNEFL----DIHLLHHSVDDSFTFILNGELKLPFPSNSTSGRAIGI 195

Query: 217 LPGNENHYVFINDEDWQLQVIRL-EFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKL 275
           + G  N ++    +D  +++I   +  +      L+     I  LLKY++++   I   +
Sbjct: 196 IKGENNCFICFY-QDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNM 254

Query: 276 MEPHATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHL 335
             P   F  S+  E      M+ L  +   GY   + +E W    +G      W     +
Sbjct: 255 STPFNEFLTSVKGEATQEMMMENLITMLVSGYISTE-LEEWIRNTIGIKNLTRWATLGGI 313

Query: 336 FWSSSQGVLVTCMIPACERLIVSAKRLLGLVK 367
           F+     ++   +IPACER ++   RL GL++
Sbjct: 314 FYEKGVDIITLMVIPACERFMILVARLQGLIE 345

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 80/367 (21%), Positives = 157/367 (42%), Gaps = 39/367 (10%)

Query: 35  LSIFRYIDGRRVGAIPLRLRQNEELL-RCQWEPDDGELFAVALRSGSVKIYR----GRLD 89
           L+I+R  D  R+  IP+R   N  L+    W+   G+  ++  + G+++I+     GRL 
Sbjct: 27  LAIYRVSDHARLAVIPIR---NINLVANYDWDTTTGKFLSIFFKDGTIRIHDIFKDGRL- 82

Query: 90  PEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGEFDSPLVQWLPRLTEM 149
                          V   R  + ++ + +W+RI  R  EP   +F   ++  LP+L   
Sbjct: 83  ---------------VSFLRIPSTKISKGIWDRIPLRY-EPNNRDFACNIIDDLPKLIRF 126

Query: 150 SISAQGKLLCTPLG-----YEGPEWNAGLAADESNMFLTFDNNTRKVVLSIDGTFN-FRY 203
            +    ++   P       + GP+ +   + ++ ++ + F+    K+ +  +G +  F  
Sbjct: 127 -VKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLS 185

Query: 204 GEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRL-EFTEYHQVHELMKCCSHIQFLLK 262
            +  +    + SI+   +  Y     ED  +Q + L    +      L+     I+ L+ 
Sbjct: 186 VDNIENENSLKSIIKVQDGFYQCFY-EDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIG 244

Query: 263 YIRDNHRLIGTKLMEPHATFTGSLFPEEQ-FTKFMKGLKDVFYLG-YSDDKTVENWFTLK 320
           Y+  +   I  +L  P+  F   L  E   + K    L+ +F LG  S D  +E+W    
Sbjct: 245 YMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCD--LEDWLCNS 302

Query: 321 LGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFGLDDDN 380
           +G      WK      +  +  +L    +PACER+I+  ++L  ++++  +    L   +
Sbjct: 303 VGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQN-KLSYTS 361

Query: 381 ELTAVEV 387
           +LTAVEV
Sbjct: 362 DLTAVEV 368

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/387 (20%), Positives = 160/387 (41%), Gaps = 49/387 (12%)

Query: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL-RCQWEPDDGELFAVALRS 78
           +N R  ++     + L+I R  D  R+  IP+R   N  L+    W+   G+  ++  + 
Sbjct: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVR---NIALVANYSWDRTSGKFLSIFFKD 68

Query: 79  GSVKIYR----GRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGE 134
           G+V+I+     GRL                V   R  + ++ + +W+RI  + RE     
Sbjct: 69  GTVRIHDIFKDGRL----------------VSFLRVPSTKISRGIWDRIPLK-REYDSET 111

Query: 135 FDSPLVQWLPRLTEMSISAQGKLLCTPLG-----YEGPEWNAGLAADESNMFLTFDNNTR 189
           F   ++  LP+L    +    ++   P       + GP+ +   + +  ++ + F+    
Sbjct: 112 FAYNVIDILPKLIRF-VKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGND 170

Query: 190 KVVLSIDGTFNFRYG----EKSKFPTKVTSILPGNENHYVFIND---EDWQLQVIRLEFT 242
           K+ +  +G +         E  +    V  +  G   ++ F ND       LQ +     
Sbjct: 171 KITIFFNGDYTILLPMDDIENERILESVVKVQDGF--YHCFYNDGSVRTLNLQPLLRSKP 228

Query: 243 EYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ-FTKFMKGLKD 301
               +H +M     I +LL ++     LI  +L+ P+  F   +  E   + K    L+ 
Sbjct: 229 SVDLLHYIMVIKELIGYLLAHVE----LINRELITPYLDFVKRICDEAYGYNKLKSELEC 284

Query: 302 VFYLG-YSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360
           +F LG  S D  +E+W    +G      WK      +  +  +L    +P CER+I+  +
Sbjct: 285 LFLLGEVSCD--LEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVE 342

Query: 361 RLLGLVKSLKLNVFGLDDDNELTAVEV 387
           +L G +++  +     ++ ++LTAVE+
Sbjct: 343 KLRGTLEAFSVQNKS-NNTSDLTAVEL 368

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 165/380 (43%), Gaps = 60/380 (15%)

Query: 20  WNDRLSLWGVLE-KEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRS 78
           +N +  L+G+ E    L I R  D   VG + + +R    LL   W+P DG+  A+ L+ 
Sbjct: 13  YNPKYGLFGMNEDNHSLVIRRTSDN--VGIVKINVRNIVLLLDYFWDPIDGKYLALFLKD 70

Query: 79  GSVKIYRGRLDPEGTEGSEGAELVG-----TVVLGRGDAFQMEQFVWNRI------KWRV 127
           GSV+IY         +   G +L+       VVLG      ++  +W+RI         +
Sbjct: 71  GSVRIY---------DIFNGGKLISFLRVLPVVLGSNKP-SLDCCLWDRIIIPKSGSSEL 120

Query: 128 REPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADES---NMFLTF 184
           R P     ++ L + +P L +    A+ ++   P       W + +  +E    ++ L +
Sbjct: 121 RIP-----NNDLTESMPTLVKFVQDAK-QIDIIPNRSITKLWRS-IGNNEKKVVDVHLGY 173

Query: 185 DNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEY 244
             ++ +V + I+G +     EKS     V+ I    +   + +N +++   +  + F +Y
Sbjct: 174 SCSSAQVTILINGEY---LIEKS-----VSDINQIQKKIPISLNKKEFCEAIYEIHFDDY 225

Query: 245 HQVH-------------ELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ 291
            ++              +L++    +      I+D+  LI   ++ P+  F  S+     
Sbjct: 226 SRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGIND 285

Query: 292 FTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPA 351
               +  L+ +F +G  D K + NWF   +       W +  + F+S+ + VL+   +P 
Sbjct: 286 ----LDVLERLFLIGELDTK-LGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPI 340

Query: 352 CERLIVSAKRLLGLVKSLKL 371
           CERL+V   R+ G++K + L
Sbjct: 341 CERLMVLTNRINGMIKGIDL 360

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/380 (19%), Positives = 153/380 (40%), Gaps = 44/380 (11%)

Query: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSG 79
           +N +L L+     + L ++R  D   +    ++  + E +    W+   G+  ++  R G
Sbjct: 14  YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIK--KWELVAGIYWDKISGKYLSIFFRDG 71

Query: 80  SVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQF------VWNRIKWRVREPFCG 133
           S++I     D                  G+  AF   QF       W+RI+ +       
Sbjct: 72  SIRIIDVFKD------------------GKLVAFLRTQFKNVDCTYWDRIEEQTTNEM-K 112

Query: 134 EFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESN----MFLTFDNNTR 189
           +F+  +V  +P L +  +S+  KL   P       W    A  + N    M     + T 
Sbjct: 113 QFNKNIVDLMPSLIQF-VSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETD 171

Query: 190 KVVLSIDGTFNFRYGE-KSKFPTKV--TSILPGNENHYVFINDEDWQLQVIRLEFTEYHQ 246
             ++ ++G +       ++    KV   S++    + Y  I  +    ++    F     
Sbjct: 172 SFLMVLNGDYYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKS 231

Query: 247 VHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSL----FPEEQFTKFMKGLKDV 302
             +L++C   ++ + KY R++  L+   +++P+  F   +    F  E   K +  LK  
Sbjct: 232 CIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGRE---KLINELKIT 288

Query: 303 FYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRL 362
           F LG   D+ +++W    +G      W+   H  +  +  +    ++ ACER+I+ ++R 
Sbjct: 289 FLLGTISDE-LQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERC 347

Query: 363 LGLVKSLKLNVFGLDDDNEL 382
            GL+ + +    G DD++ L
Sbjct: 348 FGLIMAFQFES-GADDNSRL 366

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 92/412 (22%), Positives = 170/412 (41%), Gaps = 31/412 (7%)

Query: 53  LRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDA 112
           +R   +++  QW+   GE+ +V  + GS++I     D         A+LV    L R   
Sbjct: 46  IRDPSQVVSYQWDTIGGEIISVMFQDGSIRINDVMYD---------AKLVA---LLRTQR 93

Query: 113 FQMEQFVWNRIKWRVREPFCGEFDSPLV-QWLPRLTEMSISAQGKLLCTPLGYEGPEW-- 169
             ++  +W+RI+   R     E+D  ++ Q LPRL +  + +      +P       W  
Sbjct: 94  TGLDCVLWDRIRLPSRAQ-SMEWDPDIITQSLPRLVKF-MGSDASPSMSPYLPTNHSWRF 151

Query: 170 -NAGLAADESNMFLTFDNNTRKVVLSIDGTFNFR----YGEKSKFPTKVTSILPGNENHY 224
            N+G A    ++          +V  ++G +  +    + E      K+ +      + Y
Sbjct: 152 PNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVY 211

Query: 225 VFINDEDWQLQVIRLEFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTG 284
                     QV    F E     +L++     Q  L Y   +   I T+ +EP+  F  
Sbjct: 212 NCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIE 271

Query: 285 SLFPEEQF--TKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQG 342
            L  E+ F   K  + L D F +G S D+ + +W    LG      WK   +  +  +  
Sbjct: 272 RLC-EDAFGKEKLQESLTDHFLVG-SMDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQ 329

Query: 343 VLVTCMIPACERLIVSAKRLLGLVKSLKLNVFGLDDDNELTAVEVQDXXXXXXXXXXXXV 402
           V++ C++P  ERLI+  ++L  LV + +L+   + D  E++  E  D            +
Sbjct: 330 VVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEIS--EFTDLLENCQELLQLVL 387

Query: 403 EQVEQFHVGENVSKDGLAWIEYMMDSLLHNEDEDAHNLN--GQDG-LFSSDL 451
           + V+Q        K  L W+E ++ + ++ +     N++  G+ G LF+S L
Sbjct: 388 QTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSECGKFGFLFTSGL 439

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 75/347 (21%), Positives = 137/347 (39%), Gaps = 47/347 (13%)

Query: 35  LSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTE 94
            S+ R  D  R+  I +R     ++   QW+P  G+  ++  + G+V+IY         +
Sbjct: 23  FSVHRMADDARIATIIVR--DMSQVAGYQWDPITGKFLSIFYKDGTVRIY---------D 71

Query: 95  GSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGE--FDSPLVQWLPRLTEMSIS 152
           G     LV    L R  +      +W+RI+    E    +   D  + + +P++ + +  
Sbjct: 72  GFRSGRLVS---LLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVKFARD 128

Query: 153 AQGKLLCTPLGYEGPEWNAGLAADESNMFLTFDNNTRKVVLSI--DGTFNFRYGEKSKFP 210
           ++ +L   P       W    AAD++N  L          LS+  DG F     + +  P
Sbjct: 129 SR-QLCVVPYTLPSDVWRPQ-AADDTNALLDAHVIRCHDSLSVMFDGEFTISI-QLAAIP 185

Query: 211 TKVTSILPGNENHYVFIND---EDWQL-QVIRLEFTEYHQVHELMKCCSHIQFLLKYIRD 266
           + +   +     +  F  D   E + L  +++  F+       L+K    ++ L +Y++D
Sbjct: 186 SPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFS-----LRLLKNVITMRQLHRYLQD 240

Query: 267 NHRLIGTKLMEPH---------ATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWF 317
           +  LI   L++P+           F G     EQ    M  + DV          +E+W 
Sbjct: 241 HIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLML-VGDV-------TPELEDWL 292

Query: 318 TLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLG 364
              +G      W++     +  +  VL    +PACERLI   +R  G
Sbjct: 293 VNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG 339

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 74/380 (19%), Positives = 157/380 (41%), Gaps = 35/380 (9%)

Query: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL-RCQWEPDDGELFAVALRS 78
           +N R  ++ +   + L+I R  D  R+  IP+R   N  L+    W+   G+  ++  + 
Sbjct: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVR---NIALVANYNWDVSTGKFLSIFFKD 64

Query: 79  GSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGEFDSP 138
           G+++I+         +  +   LV  + + R    ++ + +W+RI  +  E     F + 
Sbjct: 65  GTIRIH---------DIFKDGRLVSFLRIPRT---KISRGIWDRIPLKY-ESSNRNFANN 111

Query: 139 LVQWLPRLTEMSISAQGKLLCTPLG-----YEGPEWNAGLAADESNMFLTFDNNTRKVVL 193
           ++  LP+L    +    ++   P       + GP+ +     +  ++ + F+    K+ +
Sbjct: 112 VIDVLPKLIRF-VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITV 170

Query: 194 SIDGTFNFRYG----EKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE-FTEYHQVH 248
             +G +         E  K    V  +  G   ++ F ND    +    LE   +     
Sbjct: 171 FFNGDYAILLPVSDIENEKILKSVVKVQNGF--YHCFYND--GTVSTFNLERLLQSEPSV 226

Query: 249 ELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ-FTKFMKGLKDVFYLGY 307
           +L++    I+ L+ Y+  +   I  +L  P+  F   +  E   ++K    LK +F LG 
Sbjct: 227 DLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLG- 285

Query: 308 SDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVK 367
                +++W    +G      WK      +  +  V     +P CER+I+  ++L G+++
Sbjct: 286 EVPSDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILE 345

Query: 368 SLKLNVFGLDDDNELTAVEV 387
           +  +         +LTAVE+
Sbjct: 346 AFSIQX-XXXXXXDLTAVEL 364

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/407 (18%), Positives = 161/407 (39%), Gaps = 64/407 (15%)

Query: 10  KQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDG 69
           +QW+     + N    L+       +   R +DG ++  I +R  QN  ++   W+   G
Sbjct: 17  EQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQN--VIAIDWDSKTG 74

Query: 70  ELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTV-----VLGRGDAFQMEQFVWNR-- 122
           +   +    G+ +IY         +  +  +L+  V     +L      +++  +W+R  
Sbjct: 75  KYLTINFDDGTFRIY---------DIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLI 125

Query: 123 IKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPE--WN--------AG 172
           I   ++E    EF+  + + +P L +  +     +   P  +   +  W           
Sbjct: 126 ILNSIQEL---EFNHDITKLMPTLIKF-VKDSTNIYIVPYSHNEKQNIWREFQPVSSYKP 181

Query: 173 LAADESNMFLTFDNNTRK-----------------VVLSIDGTFNFRYGEKSKFPT---K 212
           ++ +   + +T +    K                   ++I+GT+      K+   T   K
Sbjct: 182 ISTNMDAIDMTTNQEVEKSMRYLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNK 241

Query: 213 VTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQVH-ELMKCCSHIQFLLKYIRDNHRLI 271
           +  IL    +       E+  ++ +         +H EL++    I  ++KY + +  LI
Sbjct: 242 IVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLI 301

Query: 272 GTKLMEPHATFTGSLFP----EEQF---TKFMKGLKDVFYLGYSDDKTVENWFTLKLGRH 324
              L++   TFT  L+P    E+Q       ++ LK     G   ++ +E W TL +G  
Sbjct: 302 NKHLLK---TFTDFLYPTIFEEKQNGGGNSMLQQLKLSLLSGEMSEELIE-WLTLSIGEK 357

Query: 325 GTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKL 371
               WK+ +   +S S  +    +IPACE  ++ +++ L ++ ++++
Sbjct: 358 NLKKWKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLAILNAIEI 404

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 65/343 (18%), Positives = 133/343 (38%), Gaps = 37/343 (10%)

Query: 49  IPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIY----RGRLDPEGTEGSEGAELVGT 104
           + + +R  + ++   W         V    GS +I+     G+L                
Sbjct: 38  VKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSARIHDIFREGKL---------------M 82

Query: 105 VVLGRGDAFQ--MEQFVWNRIKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPL 162
            +L   D FQ  M+  +W++++ R ++P  GEFD  +   +P   +  ++  G+L   P 
Sbjct: 83  TLLRLQDGFQKCMDTGIWSKLEVR-QKPNEGEFDRDISGLMPSPIKF-VNNAGQLEVVPY 140

Query: 163 GYEGPEWNAGLAADESN----MFLTFDNNTRKVVLSIDGTFNFRYGEKS---KFPTKVTS 215
                +W       E N    + +  ++NT + +L I+G +       S       ++  
Sbjct: 141 VVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQPNSTDENASNQLHK 200

Query: 216 ILPGNENHYVFINDEDWQLQVIRLEFTEYHQVH-ELMKCCSHIQFLLKYIRDNHRLIGTK 274
           I+   +        +D +   I L        H  L+   + ++ L +YI D+  +I   
Sbjct: 201 IIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDND 260

Query: 275 LMEPHATF--TGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQR 332
           L +P   F    ++   +  +K +K     F L     K++ +W    +G      WK+ 
Sbjct: 261 LKKPLDDFLEVTNILNIKDLSKSLKS----FILYGLMAKSLNHWLCNVVGEKNLKKWKRL 316

Query: 333 NHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFG 375
           +   +     ++   ++PA E+L + + R   LV ++ L   G
Sbjct: 317 SETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPASG 359

>TPHA0C02800 Chr3 (611168..611857) [690 bp, 229 aa] {ON} Anc_8.181
           YER139C
          Length = 229

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 416 KDGLAWIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPK 475
           +D L ++  ++   L+N+  D  NLN + G    D  P  +  ++ +S+     +++   
Sbjct: 45  EDSLKYLSRLLTPELYNDLIDERNLNKKCGYPLCDKSPERI--RDPFSINYVTKKFLWEN 102

Query: 476 KPYSWIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVG 526
            PY+++ S + S+      QF + Q +  A + +  + +  PV KL S VG
Sbjct: 103 NPYAYL-STYCSKFHFKCSQFYMTQLSEDALFARTGVHLYSPVTKLSSEVG 152

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 53/118 (44%), Gaps = 4/118 (3%)

Query: 250 LMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ---FTKFMKGLKDVFYLG 306
           L+     I+ L +Y+ D+  LI  +L+ P++ F   +  +      TK    L+ +   G
Sbjct: 241 LLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTG 300

Query: 307 YSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLG 364
             +++  ++W    +G      W++     +     +L   +IP+CER ++  +R  G
Sbjct: 301 EINNE-FKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDG 357

>AFR492W Chr6 (1323730..1325805) [2076 bp, 691 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL009W and YGL021W
           (ALK1)
          Length = 691

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 66/158 (41%), Gaps = 11/158 (6%)

Query: 220 NENHYVFINDEDWQLQVIRLEFTEYHQVHELM-KCCS--HI-----QFLLKYIRDNHRLI 271
           +E+ YV ++ ++    + +L+   + QVH+++ +CC   H+     QF  +Y+  +H L+
Sbjct: 511 DESQYVVLHMKNHGTPLSKLKSLTFKQVHDIVTQCCRTLHVGEKKFQFEHRYLTTDHILV 570

Query: 272 GTKLMEPHATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQ 331
             +       +  +    +    F +    +F+ G  D   V  W    L      +   
Sbjct: 571 DKQSNVTICDYRLARASNDTSCWFTRLDHPLFFQGRKDYNYVLQWMRYSLNSKNWHLHHP 630

Query: 332 RNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSL 369
           R +L+W      ++  M+  C  L     +LL L  SL
Sbjct: 631 RTNLYW---LYYIIDRMLSLCTELTPERSKLLKLHSSL 665

>KNAG0D02660 Chr4 (475678..477321) [1644 bp, 547 aa] {ON} Anc_8.72
           YPL020C
          Length = 547

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 48/92 (52%), Gaps = 9/92 (9%)

Query: 465 QLFLNEYIIPKKPYSWIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSL 524
           ++F  EY IPK     I  +   QL++L R   +++ + T+KW   ++ +   +R +  L
Sbjct: 196 EIFNGEYCIPK----VIADERKHQLQLLNRDKQVMEPSSTSKWRNSVVMLTEKIRNILLL 251

Query: 525 VGHRLEDALVDGETIYMICSKRSPKRPDLDEE 556
            GH  +++  D + +++    +  K P L+E+
Sbjct: 252 EGHTSKES-QDNDVVFV----KEKKIPSLEEK 278

>KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa]
           {ON} Anc_8.326 YLR131C
          Length = 619

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 46/109 (42%), Gaps = 18/109 (16%)

Query: 459 KEHYSVQLFLNEYIIPKKPYSWIKSDFPSQLEVLMRQFDLV-------QKNYTAKWIKKL 511
           K  Y+++  +  ++   +PY     DFP   +  +R  DLV       +KNY     KK 
Sbjct: 480 KRRYNIRSHIQTHL-EDRPYPC---DFPGCDKAFVRNHDLVRHKKSHFEKNYACPCGKKF 535

Query: 512 IKVPGPVRKLKSLVGHRLEDALVDGETIYMICSKRSPKRPDLDEEVECS 560
                   +  +L+ HR     + G+    I  KRSP++     + ECS
Sbjct: 536 -------NREDALIVHRCRMICIGGKKYDNIVIKRSPRKRGRPRKNECS 577

>Smik_4.625 Chr4 complement(1118384..1121332) [2949 bp, 982 aa] {ON}
           YDR359C (REAL)
          Length = 982

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 18/90 (20%)

Query: 624 SRFLMLTEDGQVRRYLVGYSGATDVKNSARI--TIYNDF-KVIMEPTALDITNKKYCKNQ 680
           S+ L LT++ ++RR + G+   TD++   R   T+   F +  M PTA     KK  K+ 
Sbjct: 50  SQLLELTDESKLRREIDGFLKKTDIRRGIRFDDTLLPKFLQTAMTPTA-----KKKSKD- 103

Query: 681 MIVHSDMAVTILSPIPVEAPADANSGHCQL 710
                    T L  +P +A  D+  GH  L
Sbjct: 104 ---------TSLMKVPNQASTDSKMGHESL 124

>Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa]
           {ON} complement(192400..194424) [2025 nt, 675 aa]
          Length = 674

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 23/126 (18%)

Query: 459 KEHYSVQLFLNEYIIPKKPYSWIKSDFPSQLEVLMRQFDLV-------QKNYTAKWIKKL 511
           K  Y+++  +  ++   +PY   K DF    +  +R  DL+       +K+Y     KK 
Sbjct: 498 KRRYNIRSHIQTHL-EDRPY---KCDFEGCDKAFVRNHDLIRHKKSHAEKSYACPCGKKF 553

Query: 512 IKVPGPVRKLKSLVGHRLEDALVDGETIYMICSKRSPK-----RPDLDEEVECSPSRESE 566
                   +  +L+ HR       G+    +  KRSP+     R D  + V CSP +ES 
Sbjct: 554 -------NREDALIVHRSRMICSGGKKYENVVIKRSPRKRGRPRKDGSDSVNCSPVKESV 606

Query: 567 LQQSMG 572
              S G
Sbjct: 607 KNDSNG 612

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,591,189
Number of extensions: 3540469
Number of successful extensions: 8148
Number of sequences better than 10.0: 29
Number of HSP's gapped: 8319
Number of HSP's successfully gapped: 30
Length of query: 715
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 598
Effective length of database: 40,065,477
Effective search space: 23959155246
Effective search space used: 23959155246
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)