Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR077C8.271ON84884843610.0
SAKL0H16830g8.271ON86283825100.0
KLLA0F19338g8.271ON89187024850.0
Skud_2.424na 1ON86385124180.0
NCAS0B050508.271ON92391124030.0
Suva_4.554na 1ON85085623940.0
YBR294W (SUL1)na 1ON85985223850.0
NDAI0B020208.271ON90588423830.0
KNAG0G020708.271ON89990423800.0
Ecym_42998.271ON87484723540.0
Smik_2.435na 1ON86379623520.0
TDEL0F039808.271ON86786623500.0
Smik_12.1518.271ON89386723330.0
KLTH0G13486g8.271ON90288323290.0
YLR092W (SUL2)8.271ON89389823250.0
Suva_10.1768.271ON89390223200.0
KAFR0B027508.271ON83483323130.0
Skud_12.1608.271ON89387323190.0
Kpol_543.438.271ON86679922840.0
Kwal_56.237598.271ON86185922450.0
CAGL0L12342g8.271ON89189122090.0
TPHA0J008008.271ON91791122010.0
ZYRO0C01452g8.271ON90687221840.0
TPHA0A017608.271ON89389221600.0
TBLA0F030508.271ON89752812431e-157
YPR003C8.99ON7544033201e-29
Suva_16.3228.99ON7424003084e-28
NCAS0B048008.99ON7243963075e-28
NDAI0B022108.99ON7064582994e-27
ZYRO0F04796g8.99ON7354162951e-26
Skud_16.2868.99ON7454592923e-26
Smik_16.2418.99ON7444002906e-26
KNAG0D023908.99ON7163952728e-24
CAGL0L09207g8.99ON7254022656e-23
TBLA0C052708.99ON7764022656e-23
TPHA0H007208.99ON7874072603e-22
TDEL0C012808.99ON7274022568e-22
AGR213Cna 2ON6894052504e-21
Kpol_467.118.99ON7444062442e-20
Ecym_7084na 2ON6894482406e-20
SAKL0H08800gna 2ON6203892227e-18
KLTH0G16764g8.99ON7103972211e-17
SAKL0B03124g8.99ON7443952202e-17
Kwal_27.110398.99ON7263972183e-17
KLLA0E14059g8.99ON7064091906e-14
AFR304W3.485ON1015305830.33
SAKL0D00836gna 3ON601143781.0
NCAS0A116303.455ON1201102743.4
CAGL0H04587g7.420ON44559734.8
KLLA0E04731g3.485ON1060131735.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR077C
         (848 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...  1684   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...   971   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   961   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...   936   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271    930   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...   926   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...   923   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271    922   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...   921   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   911   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...   910   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...   909   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...   903   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   901   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...   900   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...   898   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...   895   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...   897   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...   884   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   869   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...   855   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....   852   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   845   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   836   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   483   e-157
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   127   1e-29
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   123   4e-28
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   122   5e-28
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   119   4e-27
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   118   1e-26
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   117   3e-26
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   116   6e-26
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   109   8e-24
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   106   6e-23
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   106   6e-23
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   104   3e-22
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...   103   8e-22
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...   100   4e-21
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    99   2e-20
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    97   6e-20
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    90   7e-18
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    90   1e-17
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    89   2e-17
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    89   3e-17
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    78   6e-14
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...    37   0.33 
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...    35   1.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...    33   3.4  
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    33   4.8  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    33   5.1  

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score = 1684 bits (4361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 822/848 (96%), Positives = 822/848 (96%)

Query: 1   MSRQVHTGRSSSDDTGAPQWPSRNSVLNDDIEALQAEYDQLKAGEVHSAQGATHGDIGSR 60
           MSRQVHTGRSSSDDTGAPQWPSRNSVLNDDIEALQAEYDQLKAGEVHSAQGATHGDIGSR
Sbjct: 1   MSRQVHTGRSSSDDTGAPQWPSRNSVLNDDIEALQAEYDQLKAGEVHSAQGATHGDIGSR 60

Query: 61  QYSGSGKPAAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPL 120
           QYSGSGKPAAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPL
Sbjct: 61  QYSGSGKPAAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPL 120

Query: 121 HRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFAT 180
           HRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFAT
Sbjct: 121 HRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFAT 180

Query: 181 SKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGF 240
           SKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGF
Sbjct: 181 SKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGF 240

Query: 241 LVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNA 300
           LVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNA
Sbjct: 241 LVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNA 300

Query: 301 AFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTA 360
           AFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTA
Sbjct: 301 AFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTA 360

Query: 361 ISWGISRHKLEKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIA 420
           ISWGISRHKLEKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIA
Sbjct: 361 ISWGISRHKLEKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIA 420

Query: 421 KSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTG 480
           KSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTG
Sbjct: 421 KSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTG 480

Query: 481 ACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXX 540
           ACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLD          
Sbjct: 481 ACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVII 540

Query: 541 XXXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASID 600
                 EHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASID
Sbjct: 541 TVFSSIEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASID 600

Query: 601 NSATFQQIDKDGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVY 660
           NSATFQQIDKDGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVY
Sbjct: 601 NSATFQQIDKDGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVY 660

Query: 661 RPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXAD 720
           RPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPW          AD
Sbjct: 661 RPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFRRFIAD 720

Query: 721 KRTGSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSP 780
           KRTGSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSP
Sbjct: 721 KRTGSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSP 780

Query: 781 WIKRALVNTGFGIADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPD 840
           WIKRALVNTGFGIADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPD
Sbjct: 781 WIKRALVNTGFGIADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPD 840

Query: 841 FETWRHDA 848
           FETWRHDA
Sbjct: 841 FETWRHDA 848

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/838 (59%), Positives = 602/838 (71%), Gaps = 26/838 (3%)

Query: 30  DIEALQAEYDQLKAGE---------VHSAQGATHGDIGSRQYSGSGKPAAQYLGLNVNSR 80
           +++ L+AEYD  K  E         V +    TH +  ++     G+   +  G   +S 
Sbjct: 26  NLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQN-DAKGLKNDGQTTVELYG-TTSSG 83

Query: 81  EAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI 140
             +P Y E  V+ KDYY+  L   IS ++ R+Y +S+FP+ RWI HYN AWMY D+VAG+
Sbjct: 84  GVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAGV 143

Query: 141 TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI 200
           TVGCVLVPQSMSYAQ+ASL  QYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSLETAKVI
Sbjct: 144 TVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVI 203

Query: 201 ARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALS 260
           ARVTE+LP+DT ITGPIIATAL+LLCGAI + IG+LRLGFLVE IS+ AV GFMTGSA S
Sbjct: 204 ARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFS 263

Query: 261 IISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSL 320
           II+GQ+P+LMGY++KVNTR TTYKV+I +LKHL DT ++A FGL+PL++L+LWK+ C ++
Sbjct: 264 IITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTI 323

Query: 321 GPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKPPISLLGK 380
           GP  VDR +     RA  W + FFY QALRNA +IV+FT I+WGI+RHK +K PISLL  
Sbjct: 324 GPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITRHK-KKHPISLLNT 382

Query: 381 VPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAI 440
           VPSGLKNVG ++ P+ L   L PELPAA IILLLEHIAIAK+FGRIN+YKVVPDQELIAI
Sbjct: 383 VPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDYKVVPDQELIAI 442

Query: 441 GVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKA 500
           GVTNL  TFFNAYPATGSFSRSALKAKCNV+TPLSG+FTGACVLLALYCLTEAFY+IPKA
Sbjct: 443 GVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKA 502

Query: 501 TLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAV 560
           TLSAVIIHAV+DLIASY+ TW FW+ NPLD                E+GIYF+I WSCA+
Sbjct: 503 TLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAI 562

Query: 561 LLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVES 620
           LL K+AFP GKFLG ++V+EVI P     +    D  S + +       K G   +    
Sbjct: 563 LLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSADNSSI 622

Query: 621 VLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILD 680
                  RFH +WIPL++ Y RE N   VV PPPPGVIVYRP++SWTY+NCSR +DII D
Sbjct: 623 STGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIFD 682

Query: 681 HVKEHTRPGQLVNHLSNKERLWCDPGPWX-XXXXXXXXXADKRTGSAVA-----DARPVL 734
            VK  TR G ++ H    +R W DPG W             KR    ++     D RPVL
Sbjct: 683 EVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKKLFKRGKRLEQELSPELGRDERPVL 742

Query: 735 RVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFG-- 792
           ++LAMDWSQV+Q+D+TG+QNLVDLR A+NKYADR VEFHF+GI+SPWIKRALV  GFG  
Sbjct: 743 KILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTV 802

Query: 793 ---IADPPLISSRVSYHLVRL-PADPP-HIVHG-HSVVFALGTNTPFFHLDMPDFETW 844
               AD  LI    SYH+V+  P D   HI  G +++  A GTN PFFH++MPDF  W
Sbjct: 803 NDEFADESLILGHSSYHIVKTRPQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKW 860

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/870 (56%), Positives = 607/870 (69%), Gaps = 63/870 (7%)

Query: 30  DIEALQAEYDQLKAGEV---HSAQG------------------------ATHGDIGSRQY 62
           D + L+ EYD LK  E+   H + G                         THG    +  
Sbjct: 30  DFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSIIDTNTHG--FKKHD 87

Query: 63  SGSGKPAAQYLGLNVNSRE-AVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLH 121
           +G+GK A   +    N     VP YEETVV  K  Y+ KLR +++ +   +Y  S+FPL 
Sbjct: 88  NGNGKFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLL 147

Query: 122 RWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATS 181
           +W+HHYN  W+Y D+VAGITVGCVLVPQSMSYAQ+A+L  QYGLYSSFVGAFIYSFFATS
Sbjct: 148 KWVHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATS 207

Query: 182 KDVCIGPVAVMSLETAKVIARVTENLPEDT-NITGPIIATALTLLCGAIAMVIGILRLGF 240
           KDVCIGPVAVMSLETAKVIARV E + ED   IT PIIAT L+L+CG +A+ +G+LRLGF
Sbjct: 208 KDVCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGF 267

Query: 241 LVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNA 300
           LVEFIS+ AV GFMTGSA++I+SGQVP LMGYSK VNTR +TYKVII +LKHL DT ++A
Sbjct: 268 LVEFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDA 327

Query: 301 AFGLVPLVLLFLWKWICGSLGPRLVDRYL-QFKPSRASRWNAAFFYLQALRNAVIIVVFT 359
            FGL+PL +L+ WK+ CG+LGP+LVDRY+ +    RA+ +    FYLQALRNA +I++FT
Sbjct: 328 VFGLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFT 387

Query: 360 AISWGISRHKL-EKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIA 418
            ISWGI+RHK  E  PISLLG VPSGLKNVG ++LP+GLV  L  ELP+A IIL+LEHIA
Sbjct: 388 LISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIA 447

Query: 419 IAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLF 478
           I+K+FGR+N YKVVPDQELIAIGVTNL +TFFNAYPATGSFSRSALKAKCNVKTPLSG+F
Sbjct: 448 ISKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIF 507

Query: 479 TGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXX 538
           TGACVLL+LYCLT+AFYFIPKA LSA+IIHAV+DL+ASYK TW FW  NPLD        
Sbjct: 508 TGACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTV 567

Query: 539 XXXXXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLAS 598
                   E+GIYF++ WSCA+LL KV FP G+FLGY+++ +V        ++   D   
Sbjct: 568 IITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQV----SNAEVDENIDRIV 623

Query: 599 IDNSATFQQIDKDGGKLNTVESV-------LPDPHTRFHRRWIPLDHAYSRELNPEAVVN 651
           +   +  + I+ +  K NT   V             ++H +W+PL++ Y RELNP+ VV 
Sbjct: 624 LSEDSQPKTIEDNVTKNNTAVKVGVVANESFGHSQLQYHTKWLPLNNHYQRELNPDVVVQ 683

Query: 652 PPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWX-- 709
            PPPGVIVYRP++SWTY+NCSR +D I D VKE TRPG+L+ H+S  +++W DPG W   
Sbjct: 684 APPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPP 743

Query: 710 XXXXXXXXXADKR--TGSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYAD 767
                     +K    G  V D RPVL++LAMDWSQV+Q+DSTG+QNLVDLR A+NKYA+
Sbjct: 744 FLVKKLFKLGNKHDLEGGEVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYAN 803

Query: 768 RPVEFHFAGIVSPWIKRALVNTGFG-----IADPPLISSRVSYHLVRLPAD-------PP 815
           R VEFHF+GI+SPWIKR+L+N GFG      +D  +I    SY LV+   D        P
Sbjct: 804 RQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDPEAALP 863

Query: 816 HIVHGHSVVFALGTNTPFFHLDMPDFETWR 845
             +  H+   ALG N PFFHL+MP+F  W 
Sbjct: 864 EPIALHT---ALGVNLPFFHLEMPEFHKWH 890

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/851 (54%), Positives = 594/851 (69%), Gaps = 43/851 (5%)

Query: 28  NDDIEALQAEYDQLKAGEV-HSAQGATHGDIGSRQYSGSGKPAAQYLGLNVNSREAVPEY 86
           + DIE  ++EY   +  E   +     +GD  S + +G  K       ++  + +++P Y
Sbjct: 20  DTDIEVFESEYRTYRESEAAENRDNFQNGDDQSWKINGKQKYEVTKSEVSDVAYDSIPAY 79

Query: 87  EETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVL 146
           EE+ V++K+YY++ ++  +++ +A DY  S+FP+ +W+ HYN  W YAD+VAGITVGCVL
Sbjct: 80  EESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGYADLVAGITVGCVL 139

Query: 147 VPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEN 206
           VPQSMSYAQ+ASLSP+YGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+TAKVIA V + 
Sbjct: 140 VPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKK 199

Query: 207 LPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQ 265
            PE  T +TGPIIATAL  LCG ++  +G+LRLGFLVE IS+ AV GFMTGSA SII GQ
Sbjct: 200 YPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVELISLNAVAGFMTGSAFSIIWGQ 259

Query: 266 VPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLV 325
           +P+LMGY+  VNTR  TYKV+I +LKHL +T ++A FGL+PLV+L++WKW CG+ G  L 
Sbjct: 260 IPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFGITLA 319

Query: 326 DRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKP-PISLLGKVPSG 384
           DRY + +P  A+R  + +FY QA+RNAV+I+VFTAISW I+R+K  K  PIS+LG VPSG
Sbjct: 320 DRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFTAISWRITRNKSSKERPISILGTVPSG 379

Query: 385 LKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTN 444
           L  VG +++PEGL+  +  ELPA+ I+L+LEHIAI+KSFGRIN+YKV+PDQELIAIGVTN
Sbjct: 380 LNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAIGVTN 439

Query: 445 LFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSA 504
           L  TFF++YPATGSFSRSALKAKCNV+TP SG+FTGACVLLALYCLT AF+FIPKATLSA
Sbjct: 440 LIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVLLALYCLTSAFFFIPKATLSA 499

Query: 505 VIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLLCK 564
           VIIHAV+DL+ SYK TW+FW+TNPLD                E+GIYF++ WSCA+LL K
Sbjct: 500 VIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVFSSIENGIYFAMCWSCAMLLLK 559

Query: 565 VAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVESVLPD 624
            AFP GKFLG ++VAEV+ P     IN+      + N  + Q        + +   VLP 
Sbjct: 560 QAFPAGKFLGRVEVAEVLNPTVQEGINAVTSSNELPNELSKQ--------VKSTVDVLPA 611

Query: 625 PHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKE 684
           P  +F  +WIP DH YSRELN    V PPPPGVIVYR  DS+TY+NCSRH+DII D +KE
Sbjct: 612 PEYKFSVKWIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIKE 671

Query: 685 HTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXADKRTGSAVAD--------------- 729
            TR GQL++     +R W DPG W            KR  SA  D               
Sbjct: 672 ETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFKFKRK-SATTDNELPVSSGRNNQESY 730

Query: 730 ARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNT 789
            +P+L+V+ +D+SQV+QVDST +Q+LVDLR A+NKYADR VEFHFAGI+SPWIKR+L++ 
Sbjct: 731 EKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSV 790

Query: 790 GFGI-----ADPPLISSRVSYHLVRLPADPPHIVHGHS-----------VVFALGTNTPF 833
            FG      +D  +I+   S+H+ ++  D        S           +  A GTN PF
Sbjct: 791 KFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAATGTNLPF 850

Query: 834 FHLDMPDFETW 844
           FH+D+PDF  W
Sbjct: 851 FHIDIPDFSKW 861

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/911 (52%), Positives = 606/911 (66%), Gaps = 76/911 (8%)

Query: 9   RSSSDDTGAPQWPSRNSVLN--------DDIEALQAEYDQLKAGEVHSA----------- 49
           R S +D    Q+   N   N         +++ L+ EYDQ K  E ++            
Sbjct: 12  RESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETNNNDDVINNNNNNN 71

Query: 50  -------QGATHGDIGSRQYSGSGKPAAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLR 102
                  +  T  ++  +  + +     QY  ++  +   +P Y+E  VS+KDYY++ +R
Sbjct: 72  NNNNNIPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIR 131

Query: 103 GFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQ 162
             ++L   RDY LS+FP+ RW+ HYN+ W  +D++AGITVGCVLVPQSMSYAQ+A+L  Q
Sbjct: 132 ENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQ 191

Query: 163 YGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPE-DTNITGPIIATA 221
           YGLYSSF+GAF YS FATSKDVCIGPVAVMSLETAKV+ +V    P+ D  IT PI+ATA
Sbjct: 192 YGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATA 251

Query: 222 LTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRAT 281
           L+LLCG +   +G+LRLGFLVE IS+ AVTGFMTGSAL+I+ GQVP LMGY+ KVNTR  
Sbjct: 252 LSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTA 311

Query: 282 TYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYL-QFKPSRASRWN 340
            YKVIIE+LKHL DT ++A FGL+PL LL+LWKW C ++GP+LVD++  + K  RA+ + 
Sbjct: 312 NYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERANFYF 371

Query: 341 AAF-FYLQALRNAVIIVVFTAISWGISRHKLEKP-PISLLGKVPSGLKNVGPLELPEGLV 398
             F FY QA +NA+II+VFTAISW I+R K +   PIS+LG VP GLK VG ++LP+GL+
Sbjct: 372 KKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLL 431

Query: 399 EKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGS 458
            KL PELPA+ I+LLLEHIAIAKSFGRIN+YKVVPDQELIAIGVTNL  TFFNAYPATGS
Sbjct: 432 SKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGS 491

Query: 459 FSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYK 518
           FSRSALKAKC V+TPLSG+FTGACVLLALYCLT AF++IPKATLSAVII AV+DLIASYK
Sbjct: 492 FSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYK 551

Query: 519 VTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDV 578
           +TW FW+ NPLD                E+GIYF++ WSCA+LL KV FP GKFLG I+V
Sbjct: 552 ITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEV 611

Query: 579 AEVIEPAGPPSINS----------------EADLASIDNSATFQQIDKDGGKLNTVES-V 621
           AEVI+     SI S                E D   I  +++     KD   +    S V
Sbjct: 612 AEVIDGYVDNSIESATTAEYSSASSPSSDNETDTKKIQKTSSI-SFGKDAKAVAVSTSPV 670

Query: 622 LPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDH 681
             +P  R++ +W+P DHAY+RELNP   + PPPPGVIVYR TDS+TY+NCSRH+D+I D 
Sbjct: 671 DCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDE 730

Query: 682 VKEHTRPGQLVNHLSNKERLWCDPGPW-------------XXXXXXXXXXADKRTGSAVA 728
           VK  TR GQL+ H    +R W DPG W                        D    S++ 
Sbjct: 731 VKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIR 790

Query: 729 DARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVN 788
           D RP+L+++ +D+SQV+Q+D++ IQ+LVDLR ++N+YADR VEFHFAGIVSPW+KR L+N
Sbjct: 791 DNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLIN 850

Query: 789 TGFG-----IADPPLISSRVSYHLVRLPADPPHIVHG----------HSVVFALGTNTPF 833
            GFG      +D  +I+   SYHL R   D    +            + V  A GTN PF
Sbjct: 851 RGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPF 910

Query: 834 FHLDMPDFETW 844
           FH+D+PDF  W
Sbjct: 911 FHIDIPDFSKW 921

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/856 (53%), Positives = 594/856 (69%), Gaps = 58/856 (6%)

Query: 28  NDDIEALQAEYDQLKAGEVHSAQGATHGDI-----GSRQYSGSGKPAAQYLGLNVNSREA 82
           N +IE   ++Y   +  E  + +  +H +      G+R++  +   ++        S ++
Sbjct: 12  NLNIEIFDSKYSSYRESEAAANRDDSHNEQSWKVNGNRKFEHTKTESSDV------SYDS 65

Query: 83  VPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITV 142
           +P YEE+ V++K+YY + ++  ++  +A +Y  S+FP+ +W+ HYN  W YAD+VAGITV
Sbjct: 66  IPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGITV 125

Query: 143 GCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIAR 202
           GCVLVPQSMSYAQ+ASLSP+YGLYSSFVGAFIYS FATSKDVCIGPVAVMSL+TAKVIA 
Sbjct: 126 GCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAE 185

Query: 203 VTENLPED-TNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSI 261
           V +  P+D T +TGPIIATAL LLCG +   +G+LRLGFLVE IS+ AV GFMTGSA SI
Sbjct: 186 VLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFSI 245

Query: 262 ISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLG 321
           I GQVP+LMGY+K VNTR +TYKV+I +LKHL +T ++A FGL+PLV+L++WKW CG+ G
Sbjct: 246 IWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTYG 305

Query: 322 PRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKL-EKPPISLLGK 380
             L +R+ Q  P  A+   + +FY QA+RNAV+IVVFTAISW I+R+K  E  PIS+LG 
Sbjct: 306 ITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISILGT 365

Query: 381 VPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAI 440
           VPSGL  VG +++PEGL+  +  ELPA+ I+L+LEHIAI+KSFGRIN+YKVVPDQELIAI
Sbjct: 366 VPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAI 425

Query: 441 GVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKA 500
           GVTNL  TFF++YPATGSFSRSALKAKCNV+TP SGLFTG CVLLALYCLT+AF+FIPKA
Sbjct: 426 GVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFIPKA 485

Query: 501 TLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAV 560
           TLSAVIIHAV+DL+ SY+ TW FW+TNPLD                E+GIYF++ WSCA+
Sbjct: 486 TLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWSCAI 545

Query: 561 LLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVES 620
           LL K AFP G+FLG ++VAE++ P               +N +    +++   ++ T   
Sbjct: 546 LLLKQAFPAGRFLGRVEVAEILNPTLQ------------NNVSAVVSLNESNKQVKTTVD 593

Query: 621 VLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILD 680
           VL     RF  +W+P DH YSRELN  A + PPPPGVIVYR +DS+TY+NCSRH+DII D
Sbjct: 594 VLRSSEYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFTYVNCSRHYDIIFD 653

Query: 681 HVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXADKRTGSAVAD----------- 729
           HVKE TR GQLVN     +R W DPG W            KR      +           
Sbjct: 654 HVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVTENEEPSVSNGSTNR 713

Query: 730 ---ARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRAL 786
               +P+L+V+ +D+SQV+QVDST IQ+LVDLR A+NKYADR VEFHFAGI+SPWIKR+L
Sbjct: 714 GSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSL 773

Query: 787 VNTGFGI-----ADPPLISSRVSYHLVRLPAD-------------PPHIVHGHSVVFALG 828
            +  FG      +D  +I+   S H+ +  +D              P+  +G ++  A G
Sbjct: 774 SSVDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDEESHISAPYSNYG-TLCAATG 832

Query: 829 TNTPFFHLDMPDFETW 844
           TN PFFH+D+PDF  W
Sbjct: 833 TNLPFFHIDIPDFSKW 848

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/852 (53%), Positives = 590/852 (69%), Gaps = 48/852 (5%)

Query: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGSGKPAAQYLGLNVNS-----REAVP 84
           DIE  ++EY   +  E    +   H          S K   Q  G+  N       +++P
Sbjct: 17  DIEVFESEYRTYRESEAAENRDGLHNGDEENWKVNSSK---QKFGVTKNELSDVLYDSIP 73

Query: 85  EYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGC 144
            YEE+ V++K+YY++ ++  ++  +A  Y +S+FP+ +W  HYN  W YAD+VAGITVGC
Sbjct: 74  AYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGITVGC 133

Query: 145 VLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVT 204
           VLVPQSMSYAQ+ASLSP+YGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+TAKVIA V 
Sbjct: 134 VLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVL 193

Query: 205 ENLPED-TNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIIS 263
           +  PED T +T PIIAT L LLCG +A  +GILRLGFLVE IS+ AV GFMTGSA +II 
Sbjct: 194 KKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNIIW 253

Query: 264 GQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPR 323
           GQ+P+LMGY+  VNTR  TYKV+I +LKHL +T ++A FGL+PLV+L++WKW CG+ G  
Sbjct: 254 GQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFGIT 313

Query: 324 LVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKP-PISLLGKVP 382
           L DRY + +P  A+R  + +FY QA+RNAV+IVVFTAISW I+R+K  K  PIS+LG VP
Sbjct: 314 LADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPISILGTVP 373

Query: 383 SGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGV 442
           SGL  VG +++P+GL+  +  E+PA+ I+L+LEHIAI+KSFGRIN+YKVVPDQELIAIGV
Sbjct: 374 SGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIGV 433

Query: 443 TNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATL 502
           TNL  TFF++YPATGSFSRSALKAKCNV+TP SG+FTG CVLLALYCLT+AF+FIPKATL
Sbjct: 434 TNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKATL 493

Query: 503 SAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLL 562
           SAVIIHAV+DL+ SYK TW FW+TNPLD                E+GIYF++ WSCA+LL
Sbjct: 494 SAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSCAMLL 553

Query: 563 CKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVESVL 622
            K AFP GKFLG ++VAEV+ P     I+     A I ++    +++K   ++ +   VL
Sbjct: 554 LKQAFPAGKFLGRVEVAEVLNPTVQEDID-----AVISSNELPNELNK---QVKSTVEVL 605

Query: 623 PDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHV 682
           P P  +F  +W+P DH YSRELN    V PPPPGVIVYR  DS+TY+NCSRH+DII D +
Sbjct: 606 PAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGVIVYRLGDSFTYVNCSRHYDIIFDRI 665

Query: 683 KEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXADKR------------TGSAVADA 730
           KE TR GQL+      +R W DPG W            KR             GS+  + 
Sbjct: 666 KEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLFKFKRHSATTNSDLPISNGSSNGET 725

Query: 731 --RPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVN 788
             +P+L+V+ +D+SQV+QVDST +Q+LVDLR A+N+YADR VEFHFAGI+SPWIKR+L++
Sbjct: 726 YEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNRYADRQVEFHFAGIISPWIKRSLLS 785

Query: 789 TGFGI-----ADPPLISSRVSYHLVRLPADPPHIVHGHS-----------VVFALGTNTP 832
             FG      +D  +I+   S+H+ ++  D        S           +  A GTN P
Sbjct: 786 VKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTDEDSRISTSYSNYETLCAATGTNLP 845

Query: 833 FFHLDMPDFETW 844
           FFH+D+PDF  W
Sbjct: 846 FFHIDIPDFSKW 857

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/884 (53%), Positives = 605/884 (68%), Gaps = 61/884 (6%)

Query: 18  PQWPSRNSVLNDDIEALQAEYDQLKAGEVHSAQGATHG-DIGSR----QYS-----GSGK 67
           P +P+ ++  + ++  L+ EYDQ KA E ++   + HG D+ +     Q+S     G  K
Sbjct: 24  PSFPNSDTS-SQNLADLELEYDQYKASETNNK--SNHGPDLETNNLDVQFSNTYNTGDKK 80

Query: 68  PAAQYLGLNVNSREA----VPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRW 123
            + +   + +N+  A    +P +EE  +S KDYY + L+   SL + ++YALS+FP+ RW
Sbjct: 81  NSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRW 140

Query: 124 IHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKD 183
           + HYN+AW  +D++AGITVGCVLVPQSMSYAQ+A+L PQYGLYSSF+GAF YS FATSKD
Sbjct: 141 LPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKD 200

Query: 184 VCIGPVAVMSLETAKVIARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLV 242
           VCIGPVAVMSLET KVI +V    PE D NIT P+IAT L  LCG I   IG LRLGFLV
Sbjct: 201 VCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLV 260

Query: 243 EFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAF 302
           E IS+ AVTGFMTGSAL+I+ GQ+P+LMGY  KVNTR +TYKVIIESLKHL DT ++A F
Sbjct: 261 ELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVF 320

Query: 303 GLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAIS 362
           GL+PL +L+LWKW CG++GPR+ D++              +FY QA +NAVII+VFTAI+
Sbjct: 321 GLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIA 380

Query: 363 WGISRHKL-EKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAK 421
           W I++ K  ++ PIS+LG VP GLK VG ++LP+GL  K+ PELPA+ I+LLLEHIAIAK
Sbjct: 381 WSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAK 440

Query: 422 SFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGA 481
           SFGRIN+YKVVPDQELIAIGVTNL  TFFNAYPATGSFSRSALKAKC V+TPLSGLFTG+
Sbjct: 441 SFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGS 500

Query: 482 CVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXX 541
           CVLLALYCLT  F +IPKATLSAVIIHAV+DLIASY  TW FW+ NPLD           
Sbjct: 501 CVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFIT 560

Query: 542 XXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSIN---------- 591
                E+GIYF++ WSCA+L+ KVAFP GKFLG +++AEV+      S            
Sbjct: 561 VFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNL 620

Query: 592 -SEADLASIDNSATFQQID-----KDGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELN 645
              AD  + +       I      KD    + + S+      R++ +W+P DHAY++ELN
Sbjct: 621 SLSADTINHNKKLKILHIPLLKTLKD-QLFSDISSIQGKSKIRYYTKWLPFDHAYTKELN 679

Query: 646 PEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDP 705
           P  ++ PPPPGVIVYR TDS+TY+NCS+H+D+I + +K+ T+ GQL+ H    +R W DP
Sbjct: 680 PNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDP 739

Query: 706 GPWXXXXXXX--XXXADKRTGS--------------AVADARPVLRVLAMDWSQVSQVDS 749
           G W            + +R  +              +  D RP+L+VL +D+SQV+QVD+
Sbjct: 740 GEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDA 799

Query: 750 TGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVS 804
           T +Q+LVDLR A+NKYADR VEFHFAGIVSPWIK+ L+N GFG      +D  +I+   S
Sbjct: 800 TALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTS 859

Query: 805 YHLVRLPADP---PHIVHGHSVVF-ALGTNTPFFHLDMPDFETW 844
           YHL R+P D    P +  G+  V+ A GTN PFFH+D+PDF  W
Sbjct: 860 YHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQW 903

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/904 (53%), Positives = 607/904 (67%), Gaps = 67/904 (7%)

Query: 1   MSRQVHTGRSSSDDTGAP-----QWPSRNSVLND-DIEALQAEYDQLKAGEVH------S 48
           M+ + H+ R    D   P     ++ + N V +  D++ L+ EYDQ KA E+H      S
Sbjct: 1   MTERRHSFRQEDSDNSFPNEYGAEYNNANEVSSTPDLDNLELEYDQYKADELHPQRTILS 60

Query: 49  AQGATHGD------IGSRQYSGSGKPAA-----QYLGLNVNSREAVPEYEETVVSVKDYY 97
            Q  T  +      +  +    S  P+A     QY     +  + +P Y E  V+  +++
Sbjct: 61  NQADTDREKIANVFVEEQSVRDSNIPSASIEELQYFAHESDGAKVIPSYVEGNVTELEFF 120

Query: 98  NYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLA 157
           N+ LR   +LN A++Y LS+FP+  W+ HYNV W   D++AGITVGCVLVPQSMSYAQ+A
Sbjct: 121 NHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIA 180

Query: 158 SLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPI 217
           +L PQYGLYSSF+GAFIYS FATSKDVCIGPVAVMSLETAK+IARV +  P D ++ GPI
Sbjct: 181 TLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPI 240

Query: 218 IATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVN 277
           IAT   LLCG IA  +G LRLGFLVE IS+ AV GFMTGSAL+IISGQVP+LMGY K VN
Sbjct: 241 IATTTALLCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVN 300

Query: 278 TRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRAS 337
           TR  TYKVI+ +LKHL DT ++A FGL+PL +L+ W+W C   GP+L DRY   K SR +
Sbjct: 301 TRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYP-KGSRGN 359

Query: 338 -RWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKP-PISLLGKVPSGLKNVGPLELPE 395
             W   +FY QA R+ +II+VFTAISW I+RH   K   IS+LG VP GLK+VG +++P 
Sbjct: 360 FLWKKFYFYAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPP 419

Query: 396 GLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPA 455
            L  K+ PELPAA I+LLLEHIAI+KSFGRIN+YKVVPDQELIAIGVTNL  TFF+AYP 
Sbjct: 420 ELPAKIAPELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPT 479

Query: 456 TGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIA 515
           TGSFSRSALKAKCNVKTPLSGLFTG+CVLLALYCLT AF++IPKATLSAVIIH+V+DL+A
Sbjct: 480 TGSFSRSALKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVA 539

Query: 516 SYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGY 575
           SY  TW F++ NPLD                E+GIYF+I WSCA+LL KVAFP GKFLG 
Sbjct: 540 SYHTTWNFYKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGR 599

Query: 576 IDVAEVIEPAGPPSINSEADLASIDNSAT-------FQQIDKDGGKLNTV---------- 618
           +++AEV++      IN  + + + D+  +       F + DK  GK + +          
Sbjct: 600 VEIAEVVDGE---IINDNSVVMTTDDCVSEFGGNKEFSK-DKLNGKSDFIVKDKLDSTAS 655

Query: 619 ESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDII 678
            S + +   +++ +W+P DHAY+RELNP+  + PPPPGVIVYR +DS+TY+N S H+DII
Sbjct: 656 SSSIAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDII 715

Query: 679 LDHVKEHTRPGQLVNHLSNKERLWCDPGPWX-----------XXXXXXXXXADKRT--GS 725
           +D +K  TR GQL+ H    +R W DPG W                     AD  +    
Sbjct: 716 IDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLETG 775

Query: 726 AVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRA 785
            V D RPVL+VL +D+SQV+QVDST +Q+LVDLR A+N YADR VEFHFAGI+SPWIKR 
Sbjct: 776 IVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRG 835

Query: 786 LVNTGFG-----IADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPD 840
           LV  GFG      +D  +I+   SYHLV+       I +G+ V  A GTN PFFH+D+PD
Sbjct: 836 LVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIG--DIENGYQVKTATGTNLPFFHIDIPD 893

Query: 841 FETW 844
           F+ W
Sbjct: 894 FKKW 897

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/847 (55%), Positives = 583/847 (68%), Gaps = 47/847 (5%)

Query: 31  IEALQAEYDQLKAGEVHSAQGATHGD---IGSRQYSGSGKPAAQYLGLNVNSREAVPEYE 87
           ++ L+ +Y + K  E  +       +   I      GS    A+Y G N       P Y 
Sbjct: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQFAKYDG-NALPDFKAPPYY 98

Query: 88  ETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLV 147
           ET V+  +YY+  +R  +  +  R Y LS+FP+ +WIHHYN AWMY+D +AGITVGCVLV
Sbjct: 99  ETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLV 158

Query: 148 PQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENL 207
           PQSMSYAQLA L P+YGLYSSF+GAFIYSFFATSKDVCIGPVAVMS++ +KVI+ V + L
Sbjct: 159 PQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQL 218

Query: 208 PEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVP 267
           PE T IT P++A+AL L    + + IG+LRLGF++E IS+TAV GFMTGSALSI++ Q+P
Sbjct: 219 PEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLP 278

Query: 268 SLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDR 327
           SL+G  +K+NTR  TY+V+I +LKHL  +++NAAFGL+ L LLF WKW CG LGP+L+ +
Sbjct: 279 SLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISK 337

Query: 328 YLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISW-GISRHKLEKPPISLLGKVPSGLK 386
           YL+    +A  W + FFY QALRNA ++ + T +SW  I RHK +K  IS+LG VPSGLK
Sbjct: 338 YLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHK-KKTSISVLGTVPSGLK 396

Query: 387 NVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLF 446
           +VG   +P GLV KL+P+LP A IILLLEHI IAKSFGRINNYK+VPDQELIAIGVTNL 
Sbjct: 397 HVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLI 456

Query: 447 ATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVI 506
            +FFNAYPATGSFSRSALKAKCNVKTPLSGLF+GACVLLALY LT AFY+IPKA LSAVI
Sbjct: 457 GSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVI 516

Query: 507 IHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLLCKVA 566
           IHAV DLIASYK+++  W TNP D                E+GIYF++++S A LL K A
Sbjct: 517 IHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNA 576

Query: 567 FPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNS--ATFQQIDKDGGKLNTVESVLPD 624
           FP GKFLGY+ + EV       ++N   DL SI N+     Q+I KD           PD
Sbjct: 577 FPSGKFLGYVKITEV------SNLNVFEDLDSIGNNDPELPQEISKDSKLAKD-----PD 625

Query: 625 PH-----------TRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSR 673
            H            RFH +W+PLD+ YSRELNPE  V+ PPPGVIVYRPT+SW YLNCSR
Sbjct: 626 VHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSR 685

Query: 674 HFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXADKRTGSA------V 727
            FDII+D VK  TRPG+LVNHL   E+LWC+PG W             R  +A       
Sbjct: 686 QFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQ 745

Query: 728 ADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALV 787
            D RPVL++LAMDW+QV+ VDST IQ+L+DLR  +N+YADR V FHF+GIVSPWIKRALV
Sbjct: 746 VDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALV 805

Query: 788 NTGFGI-----ADPPLISSRVSYHLVR--LPADPPHIVHGH---SVVFALGTNTPFFHLD 837
           + GFG      ++ PL+    +YH+V+  L AD  +  +     S+  A GTN PFFH+D
Sbjct: 806 HAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISASLDVASGTNFPFFHID 865

Query: 838 MPDFETW 844
           MPDF  W
Sbjct: 866 MPDFTKW 872

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/796 (56%), Positives = 576/796 (72%), Gaps = 40/796 (5%)

Query: 81  EAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI 140
           +++P YEE  V++KDYY++ ++  ++L +A  Y  S+FP+ +W+ HYN  W YAD+VAGI
Sbjct: 74  DSIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGI 133

Query: 141 TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI 200
           TVGCVLVPQSMSYAQ+ASLSP+YGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+TAKVI
Sbjct: 134 TVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVI 193

Query: 201 ARVTENLPED-TNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSAL 259
           A V +  PED   +TGPIIAT L LLCG +A  +G+LRLGFLVE IS+ AV GFMTGSA 
Sbjct: 194 AEVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAF 253

Query: 260 SIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGS 319
           SII GQ+P+LMGY+K VNTR  TYKV+I +LKHL +T ++A FGL+PLV+L+LWKW CGS
Sbjct: 254 SIIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGS 313

Query: 320 LGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHK-LEKPPISLL 378
            G +LVDR+   +P  A+R  + +FY QA+RNAV+I+VFTAIS+ I+R+K  EK PIS+L
Sbjct: 314 FGIKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPISIL 373

Query: 379 GKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELI 438
           G VPSGL  VG +++P+GL+  +  ELPA+ I+L+LEHIAI+KSFGRIN+YKV+PDQELI
Sbjct: 374 GTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELI 433

Query: 439 AIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIP 498
           AIGVTNL  TFF++YPATGSFSRSALKAKCNV+TP SG+FTGACVLLALYCLT AF++IP
Sbjct: 434 AIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYIP 493

Query: 499 KATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSC 558
           KATLSAVIIHAV+DL+ASY+ TW FW+ NPLD                E+GIYF++ WSC
Sbjct: 494 KATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWSC 553

Query: 559 AVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTV 618
           A+LL K AFP GKFLG ++VAEV+ P     I+S   + S + S      ++   ++ + 
Sbjct: 554 AMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDS---IVSPNESP-----NEFSKQVKSS 605

Query: 619 ESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDII 678
              LP    +F  +W+P DHAY+RELN    V PPPPGVIVYR +DS+TY+NCSRH+D+I
Sbjct: 606 VDALPSSEYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSDSFTYVNCSRHYDVI 665

Query: 679 LDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXADKRTGS-------AVAD-- 729
            D +KE TR GQLV+     +R W DPG W            KR  +       AV D  
Sbjct: 666 FDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRVKRGLATKNSELPAVNDNT 725

Query: 730 -----ARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKR 784
                 +P+L+V+ +D+SQV+QVDST +Q+LVDLR A+NKYADR VEFHFAGI+SPWIKR
Sbjct: 726 NSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKR 785

Query: 785 ALVNTGFG-----IADPPLISSRVSYHLVRLPADPPHIVHGHS-----------VVFALG 828
           +L++  FG      +D  +I+   S+H+ ++  D        S           +  A G
Sbjct: 786 SLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDEDSPISVTCSNYDTLCAATG 845

Query: 829 TNTPFFHLDMPDFETW 844
           TN PFFH+D+PDF  W
Sbjct: 846 TNLPFFHIDIPDFSKW 861

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/866 (54%), Positives = 600/866 (69%), Gaps = 69/866 (7%)

Query: 31  IEALQAEYDQLKAGEVHSAQGAT----HGDIGSRQ-----------YSGSGKPAAQYLGL 75
           ++ L+AEYD  KA E       T      D G+++           Y GS  P A  +G 
Sbjct: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEA--IGG 74

Query: 76  NVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYAD 135
           N+      P +EE+ VSVKDYYN  +R  ++LN+A  Y  S+FP+ +W  HYN+ W YAD
Sbjct: 75  NI------PGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYAD 128

Query: 136 MVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLE 195
           +VAGITVGCVLVPQSMSYAQ+ASL PQYGLYSSF+GAFIYS FATSKDVCIGPVAVMSL+
Sbjct: 129 LVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQ 188

Query: 196 TAKVIARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFM 254
           TAKVIA+V+   PE D  +T P+IATAL+LLCG +A+ +G+LRLGFLVE IS+ AV GFM
Sbjct: 189 TAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFM 248

Query: 255 TGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWK 314
           TGSA +I+ GQVP+LMGYS KVNTRA+TYKV+I+SLKHL DT ++A FGLVPL LL+LWK
Sbjct: 249 TGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWK 308

Query: 315 WICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHK-LEKP 373
           W CG+ GP+L DR L   P +       +FY  A+RNAVII+VFTAISW I+++K  E  
Sbjct: 309 WWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHR 368

Query: 374 PISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVP 433
           PI +LG VPSGL++VG  ++PEGL+ K+ P++PA+ I+LLLEHIAI+KSFGRIN+YKVVP
Sbjct: 369 PIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVP 428

Query: 434 DQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEA 493
           DQELIAIG TNL  TFFNAYPATGSFSRSALKAKC V+TP SG+FTG CVL+A+YCLT+A
Sbjct: 429 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDA 488

Query: 494 FYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFS 553
           F+FIP ATLSAVIIHAV+DL+ASYK TW FW+ NPLD                E+GIYF+
Sbjct: 489 FFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFA 548

Query: 554 ISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGG 613
           + WSCA+LL K AFP G+FLG ++VAEVI     P++  + +  SI++     QI+   G
Sbjct: 549 MCWSCAMLLLKHAFPAGQFLGRVEVAEVIN----PTVVEDVEAISIND-----QIEGSVG 599

Query: 614 KLNTVE------SVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWT 667
           K  +++      S     + +FH +W+   +AY+RELNP+  + PPPPGV+VYR +DS+T
Sbjct: 600 KSKSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFT 659

Query: 668 YLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXX-XXXXXXXADKRTGSA 726
           Y+NCSRH+D I DH+K+HTR GQL++     +R W DPG W             K+  + 
Sbjct: 660 YINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQND 719

Query: 727 VA------------DARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHF 774
           +             D RP+L+++ +D+SQV QVDST IQ+LVDLR A++KYADR VEFHF
Sbjct: 720 IESQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHF 779

Query: 775 AGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLP---ADP--------PHIV 818
            GI+S W+KR+L++ GFG      +D  +I+   SYH+ +     AD           + 
Sbjct: 780 TGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDSSGSSQLQ 839

Query: 819 HGHSVVFALGTNTPFFHLDMPDFETW 844
               +  A GTN PFFHLD+PDF  W
Sbjct: 840 QSQEIYAATGTNMPFFHLDIPDFSKW 865

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/867 (53%), Positives = 585/867 (67%), Gaps = 53/867 (6%)

Query: 30  DIEALQAEYDQLKAGEVHSA---QGATHGDIGSRQYSGSGKPAA----QYLGLNVNS--R 80
           D++ L+ EYDQ K  E + A          +      G+GK A     +Y   +  S   
Sbjct: 26  DLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYD 85

Query: 81  EAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI 140
            +V ++EE+ VS+K+YY++ +R  ++L  ARDY  SVFP+  W+ HYN  W  AD++AGI
Sbjct: 86  NSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGI 145

Query: 141 TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI 200
           T+GCVLVPQSMSYAQ+A+L  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TAKVI
Sbjct: 146 TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVI 205

Query: 201 ARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSAL 259
           A VT   P+ D  ITGP+IAT L LLCG I+  IG LRLGFLVE IS+ AV GFMTGSA 
Sbjct: 206 ADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAF 265

Query: 260 SIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGS 319
           +I+ GQVP+LMGY+  VNTRA TYKV+IE+LKHL DT ++A FGL+PL LL++WKW CG+
Sbjct: 266 NILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325

Query: 320 LGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLE-KPPISLL 378
            GP L DRY    P         +FY QA RN VIIVVFT I W I+R K + + PIS+L
Sbjct: 326 YGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISIL 385

Query: 379 GKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELI 438
           G VPSGLK VG   +P GL+ KL P LPA+ I+LLLEHIAI+KSFGRIN+YKVVPDQELI
Sbjct: 386 GSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 445

Query: 439 AIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIP 498
           AIGV+NL  TFFNAYPATGSFSRSALKAKCNV+TPLSGLF+G+CVLLALYCLT AF++IP
Sbjct: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505

Query: 499 KATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSC 558
           KATLSAVIIHAV+DL+ASY+ TW FW+ NPLD                E GIYF++ WSC
Sbjct: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSC 565

Query: 559 AVLLCKVAFPDGKFLGYIDVAEVIEP-----AGPPSINSE-----------------ADL 596
           A+LL K+AFP GKFLG +++AEV +      +   S  SE                 +  
Sbjct: 566 AMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSST 625

Query: 597 ASIDNSATFQQIDKDGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPG 656
             I NS+   + +      ++  S++  P  ++H +W+P DH Y+RELNP+  + PPP G
Sbjct: 626 KYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEG 685

Query: 657 VIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXX 716
           V+VYR ++S+TYLNCSRH++II + VKE TR GQL+ H    +R W DPGPW        
Sbjct: 686 VLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKN 745

Query: 717 XXADKRTGS--------------AVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNAL 762
               K+  S                 D RP+L++L +D+SQV+Q D+T +Q+LVDLR  +
Sbjct: 746 LKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVI 805

Query: 763 NKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLPADPPHI 817
           N+YADR VEFHF GI+SPW+KR LV+ GFG      +D  +++   SYH+ R+P    + 
Sbjct: 806 NQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSKEN- 864

Query: 818 VHGHSVVFALGTNTPFFHLDMPDFETW 844
              +SV  A GTN PFFH+D+PDF  W
Sbjct: 865 SDKYSVYTASGTNLPFFHIDIPDFAKW 891

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/883 (54%), Positives = 583/883 (66%), Gaps = 77/883 (8%)

Query: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGS---------------------GKP 68
           D++ L AEY Q K  E HS   AT G   + +Y                         KP
Sbjct: 29  DLDDLDAEYGQFKNAE-HS--DATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPEAKP 85

Query: 69  AAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYN 128
            A     NV S  A+ E+ E  V+V ++Y+  LR   +L T  +Y  S+ P+ RW+ HYN
Sbjct: 86  VAPAAPGNVPS--ALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYN 143

Query: 129 VAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGP 188
             W+Y D+VAGITVGCVLVPQSMSYAQ+A+LSPQYGLYSSFVGAFIYSFFATSKDVCIGP
Sbjct: 144 ARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGP 203

Query: 189 VAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISIT 248
           VAVMSL+TAK I+ V  +LPEDT IT P+IATAL LLCG I++ +G+LRLGFLVE IS T
Sbjct: 204 VAVMSLQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISLGLGVLRLGFLVELISST 263

Query: 249 AVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLV 308
           AV GFMTGSAL+II+GQVP+LMGY+K VNTR +TYKVII SL+HL DT ++A FGLVPLV
Sbjct: 264 AVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLV 323

Query: 309 LLFLWKWICGSLGPRLVDRYLQFKPSRASR-WNAAFFYLQALRNAVIIVVFTAISWGISR 367
           +L++WKW C + GPRLV RY     SR SR W+  F Y QALRNAV+IVVFTAI+WG+S 
Sbjct: 324 ILYVWKWGCSTGGPRLVQRY----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSH 379

Query: 368 HKLEK---PPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFG 424
             L++     ISLLG VPSGLK+VG +++P GL+ K+ PELPA+ I+L+LEHIAI+K+FG
Sbjct: 380 RALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFG 439

Query: 425 RINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVL 484
           R+N+Y+VVPDQELIAIG TNL  TFFNAYPATGSFSRSALKAKCNV TPLSGLF+GACVL
Sbjct: 440 RVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVL 499

Query: 485 LALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXX 544
           LA+YCLT AF FIPKATLSAVIIHAV+DLIASYK TW FWR +P D              
Sbjct: 500 LAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFS 559

Query: 545 XXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVI-------EPAGPPSINSEADLA 597
             E+GIYF++ WS AVLL + AFP GKFLG + +AE            G  S NS     
Sbjct: 560 SIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAV 619

Query: 598 S--IDNSATFQQIDKDG-------------------GKLNTVESVLPDPHT----RFHRR 632
           +   +   TF  +                        KL  VE  + D  +    RFH +
Sbjct: 620 NREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTK 679

Query: 633 WIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLV 692
           W+P D  Y+RELNPE  V PPPPGVIV+RP++SWTY+NCSR +D I D V   TR G+  
Sbjct: 680 WVPFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQ 738

Query: 693 NHLSNKERLWCDPGPW----XXXXXXXXXXADKRTGSAVADARPVLRVLAMDWSQVSQVD 748
               +  R W DPG W               D    +   D RPVLRV+AMDWSQV+QVD
Sbjct: 739 IVAKSSSRPWNDPGEWHPPKFLRKLFKSSSEDLENRAVARDERPVLRVIAMDWSQVAQVD 798

Query: 749 STGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFG-----IADPPLISSRV 803
           STG+Q L DLR A+NKYADR VEFHFAGI+ PW+KR L+N+GFG      AD  L+    
Sbjct: 799 STGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHK 858

Query: 804 SYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPDFETWRH 846
           S H+ R  A+P           A GTN PFFHL++PDF  W +
Sbjct: 859 SCHIAR-SAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWDY 900

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/898 (51%), Positives = 597/898 (66%), Gaps = 61/898 (6%)

Query: 1   MSRQVHTGRSSSDDTGAPQWPSRNSVLNDDIEALQAEYDQLKAGE---------VHSAQG 51
           MSR+   G  + ++   P +   N+ +  D++ L+ EYDQ K  E         + S   
Sbjct: 1   MSRE---GYPNFEEVEIPDFQETNNTV-PDLDDLELEYDQYKNNENNDTFNDKDLESNSV 56

Query: 52  ATHGDIGSRQYSGSGKPAAQYLGLNVNS--REAVPEYEETVVSVKDYYNYKLRGFISLNT 109
           A H  + S +  G       Y   +  S    +V ++EET VS+K+YY++ +R  +++  
Sbjct: 57  AKHNAVNSSK--GVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKG 114

Query: 110 ARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSF 169
           A  Y  SVFP+  W+ HYN +W  AD++AGIT+GCVLVPQSMSYAQ+A+L  QYGLYSSF
Sbjct: 115 ACSYLKSVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSF 174

Query: 170 VGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPE-DTNITGPIIATALTLLCGA 228
           +GA+ YSFFATSKDVCIGPVAVMSL+TAKVIA VT   P+ D+ ITGP+IAT L LLCG 
Sbjct: 175 IGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGI 234

Query: 229 IAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIE 288
           I+  +G LRLGFLVE IS+ AV GFMTGSA +I+ GQVP+LMGY+  VNTRA TYKV+IE
Sbjct: 235 ISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIE 294

Query: 289 SLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQA 348
           +LKHL DT ++A FGL+PL LL++WKW CG+ GPRL DRY    P         +FY QA
Sbjct: 295 TLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQA 354

Query: 349 LRNAVIIVVFTAISWGISRHKLE-KPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPA 407
            RN +II+VFT I W I+R K + + PIS+LG VPSGLK VG   +P GL+ KL P LPA
Sbjct: 355 SRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPA 414

Query: 408 ATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAK 467
           + I+LLLEHIAI+KSFGRIN+YKVVPDQELIAIGV+NL  TFFNAYPATGSFSRSALKAK
Sbjct: 415 SIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAK 474

Query: 468 CNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTN 527
           CNV+TPLSGLF+G+CVLLALYCLT AF++IPKATLSAVIIHAV+DL+ASY+ TW FW+ N
Sbjct: 475 CNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMN 534

Query: 528 PLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGP 587
           PLD                E GIYF++ WSCA+L+ KVAFP GKFLG ++VAEV +    
Sbjct: 535 PLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVR 594

Query: 588 PS-------------INSEADLASIDNSATFQQIDKDGGKLNTV---------ESVLPDP 625
           P              I++  D    D  ++ + +     K+ T           S +  P
Sbjct: 595 PDSDVVSYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQP 654

Query: 626 HTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEH 685
             ++H +WIP DH Y+RELNP+  + PPP GV+VYR ++S+TYLNCSRH++II + VK+ 
Sbjct: 655 RIKYHTKWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKV 714

Query: 686 TRPGQLVNHLSNKERLWCDPGPWXXXXX--------------XXXXXADKRTGSAVADAR 731
           TR GQL+ H    +R W DPGPW                        A   +     D R
Sbjct: 715 TRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDR 774

Query: 732 PVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGF 791
           P+L++L +D+SQV+Q D+T +Q+LVDLR A+N+YADR VEFHF GI+SPW+KR L++ GF
Sbjct: 775 PLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGF 834

Query: 792 GI-----ADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPDFETW 844
           G      +D  +++   SYH+ R+P    +    +SV  A GTN PFFH+D+PDF  W
Sbjct: 835 GTLNEEYSDESIVAGHTSYHVARVPQGEEN-PEKYSVYTASGTNLPFFHIDIPDFAKW 891

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/902 (50%), Positives = 602/902 (66%), Gaps = 69/902 (7%)

Query: 1   MSRQVHTGRSSSDDTGAPQWPSRNSVLNDDIEALQAEYDQLKAGEVHSAQGATHGDIGSR 60
           MSR+ H+  +  +    P +    +V   D++ L+ EYDQ K  E + A      +  S 
Sbjct: 1   MSRETHS--NIEEVVEIPDFQDSTTV--PDLDDLELEYDQYKNNENNGAFNDNDLESNSL 56

Query: 61  QYSGSGKPAAQYLGLNV---NSRE------AVPEYEETVVSVKDYYNYKLRGFISLNTAR 111
               +   A    G  V   N+ +      +V +++E  VS K+YY++ +R  ++L  A 
Sbjct: 57  TNHNTASEAKGVKGSKVEYFNTSDISLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAG 116

Query: 112 DYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVG 171
           +Y  SVFP+  W+ HYNV W  AD++AGIT+GCVLVPQSMSYAQ+A+L  QYGLYSSF+G
Sbjct: 117 NYLKSVFPIIYWLPHYNVNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIG 176

Query: 172 AFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPE-DTNITGPIIATALTLLCGAIA 230
           A+ YSFFATSKDVCIGPVAVMSL+TAKVIA VT   P+ DT ITGPIIAT L LLCG I+
Sbjct: 177 AYAYSFFATSKDVCIGPVAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIIS 236

Query: 231 MVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESL 290
             +G LRLGFLVE IS+ AV GFMTGSA +I+ GQVP+LMGY+K VNTR  TYK++I+SL
Sbjct: 237 AAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSL 296

Query: 291 KHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPS--RASRWNAAFFYLQA 348
           KHL DT ++AAFGL+PL +L+ WKW CG+ GPRL DR+   KP   +  +W    FY QA
Sbjct: 297 KHLPDTTLDAAFGLIPLFILYTWKWWCGTYGPRLNDRFNSKKPRLHKIVKWTC--FYAQA 354

Query: 349 LRNAVIIVVFTAISWGISRHKLEKP-PISLLGKVPSGLKNVGPLELPEGLVEKLLPELPA 407
            RN +II+VFT I+W I+R K     PIS+LG VPSGLK VG   +P GL+ KL P LPA
Sbjct: 355 SRNGIIIIVFTCIAWAITRGKSSADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPA 414

Query: 408 ATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAK 467
           + I+LLLEHIAI+KSFGR+N+YKVVPDQELIAIGV+NL  TFFNAYPATGSFSRSALKAK
Sbjct: 415 SIIVLLLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAK 474

Query: 468 CNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTN 527
           CNV+TPLSGLF+G+CVLLALYCLT AF++IPKATLSAVIIHAV+DL+ASY+ TW FW+ N
Sbjct: 475 CNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMN 534

Query: 528 PLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGP 587
           PLD                E+GIYF++ WSCA+ + KVAFP GKFLG +++AEV +    
Sbjct: 535 PLDFICFIVTVLITVFSSIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAY-- 592

Query: 588 PSINSEADLASI--DNSATFQQIDKDG---------------GKLNTV---------ESV 621
             + +++D  S   +N+     +++DG                KL T           + 
Sbjct: 593 --VRADSDSVSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSAS 650

Query: 622 LPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDH 681
           +  P  ++H +W+P DH Y++ELNP+  + PPP GV+VYR ++S+TY+NCSRH+++I D 
Sbjct: 651 IGQPRIKYHTKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDE 710

Query: 682 VKEHTRPGQLVNHLSNKERLWCDPGPW--------------XXXXXXXXXXADKRTGSAV 727
           +K+ TR GQL+ H    +R W DPGPW                        A      AV
Sbjct: 711 IKKVTRRGQLIRHRKKSDRPWNDPGPWEPPTFFKNLKFWKKKETDIESSENAVNNPTDAV 770

Query: 728 ADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALV 787
            D RP+L++L +D+SQV+Q D+T +Q+LVDLR A+N+YADR VEFHF GI+SPW+KR L+
Sbjct: 771 RDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLI 830

Query: 788 NTGFGI-----ADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPDFE 842
           + GFG      +D  +++   SYH+ R+P +       +SV  A GTN PFFH+D+PDF 
Sbjct: 831 SRGFGTLNEEYSDESIVAGHTSYHVARVPQN-EETPDKYSVYTASGTNLPFFHIDIPDFA 889

Query: 843 TW 844
            W
Sbjct: 890 KW 891

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/833 (53%), Positives = 577/833 (69%), Gaps = 32/833 (3%)

Query: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGSGK--PAAQYLGL-NVNSREAVPEY 86
           +++ L+ E++Q K  E+  +    + ++ S++   S K   ++ +  + ++  ++ VP Y
Sbjct: 14  NLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQQVPTY 73

Query: 87  EETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVL 146
           EE  +++ DYY Y LR + +  T  DY  S+FP+  W+ HYN+ W  +D++AGITVGCVL
Sbjct: 74  EENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVL 133

Query: 147 VPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEN 206
           VPQSMSYAQ+A+LSPQ+GLYSSF+GAF YS FATSKDVCIGPVAVMSL+TAKVIARV + 
Sbjct: 134 VPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDK 193

Query: 207 LPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQV 266
           LP DT+IT   IAT L LLCG IA  +G+LRLGFLVE IS+ AV GFMTGSAL+IISGQV
Sbjct: 194 LPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQV 253

Query: 267 PSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVD 326
           P LMGY+ +VNTR +TYKVII++LKHL DT ++A FGL+PL LLF WKW+C  LGPRL +
Sbjct: 254 PGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPRLNE 313

Query: 327 RYL-QFKPSRASRWNAAF-FYLQALRNAVIIVVFTAISWGISRHKL-EKPPISLLGKVPS 383
           R+    K  RA R    F FY Q  +NA+II+VFT ISW I+R K  E  PIS+LG VP 
Sbjct: 314 RHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPK 373

Query: 384 GLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVT 443
           GLK+V    +P GL+ KL PELPA+ I+LLLEHIAIAKSFGRIN+YK+VPDQE++AIG+T
Sbjct: 374 GLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGIT 433

Query: 444 NLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLS 503
           NL  TFF+AYPATGSFSRSALKAKCNV+TPLSGLF+GACVLLALYCLT AF++IPKATL 
Sbjct: 434 NLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLC 493

Query: 504 AVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVLLC 563
           AVIIHAV++LIASYK T  FW+ NPLD                E GIYF++ WS AVLL 
Sbjct: 494 AVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSVAVLLF 553

Query: 564 KVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVESVLP 623
           KVAFP GKFLG I++ EV++      +   + L S D ++      K G  +  V +   
Sbjct: 554 KVAFPPGKFLGQIEITEVLDGK---LVGDSSVLTSSDENSEILPTTKAGYSVEVVSN--H 608

Query: 624 DPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVK 683
           + +T ++ +W+P D +Y++ELNP+A + PPPPGVIVYR  DS+TY+NCSRHFDI+ D +K
Sbjct: 609 NENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIK 668

Query: 684 EHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXADKR-------TGSAVADARPVLRV 736
             T+ G+L   +   +R W DPG W            +            V D RP L++
Sbjct: 669 RSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVIDDRPFLKI 728

Query: 737 LAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI--- 793
           + +D+SQVSQ+D+T IQ L DLR ++NKYADR VEFHF GI+SPWIK++L N GFG    
Sbjct: 729 ICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINN 788

Query: 794 --ADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPDFETW 844
             +D  +I    SYHL +             +  A GTN PFFH+D+P+F  W
Sbjct: 789 EYSDESIIMGHSSYHLTK---------DVDGIKAATGTNLPFFHIDIPNFNKW 832

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/873 (52%), Positives = 589/873 (67%), Gaps = 65/873 (7%)

Query: 30  DIEALQAEYDQLKAGE---VHSAQGATHGDIGSRQYSGSGKPAA----QYLGLNVNS--R 80
           +++ L+ EYDQ K  E   V S        + +R      K       +Y   +  S   
Sbjct: 26  NLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYD 85

Query: 81  EAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI 140
            +V ++EE+ VS+K+YYN+ +R  ++L  A DY  SVFP+  W+ HYN  W  AD++AGI
Sbjct: 86  NSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGI 145

Query: 141 TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI 200
           T+GCVLVPQSMSYAQ+A+L  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TAKVI
Sbjct: 146 TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI 205

Query: 201 ARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSAL 259
           A V    P+ DT ITGP+IAT L LLCG I+  +G LRLGFLVE IS+ AV GFMTGSA 
Sbjct: 206 AEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAF 265

Query: 260 SIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGS 319
           +I+ GQVP+LMGY+K VNTRA TYKV+IE+LKHL DT ++A FGL+PL LL++WKW CG+
Sbjct: 266 NILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325

Query: 320 LGPRLVDRY--LQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLE-KPPIS 376
            GPRL DRY     +  +  +W   +FY QA RN +II+VFT I W I+R K   + PIS
Sbjct: 326 YGPRLNDRYNSKNARLHKIVKW--TYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPIS 383

Query: 377 LLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQE 436
           +LG VPSGLK VG   +P GL+ KL P LP++ I+LLLEHIAI+KSFGRIN+YKVVPDQE
Sbjct: 384 ILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKVVPDQE 443

Query: 437 LIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYF 496
           LIAIGV+NL  TFFNAYPATGSFSRSALKAKCNV+TPLSGLF+G+CVLLALYCLT AF++
Sbjct: 444 LIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFY 503

Query: 497 IPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISW 556
           IPKATLSAVIIHAV+DL+ASY+ TW FW+ NPLD                E GIYF++ W
Sbjct: 504 IPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCW 563

Query: 557 SCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASI--DNSATFQQIDKDGGK 614
           SCA+LL KVAFP GKFLG +++AEV +      + +++D  S   +N+     ++++G  
Sbjct: 564 SCAMLLLKVAFPAGKFLGRVEIAEVTDAY----VKADSDAVSYVSENNNRISTLEENGED 619

Query: 615 LNTV------------------------ESVLPDPHTRFHRRWIPLDHAYSRELNPEAVV 650
              +                         S +  P  ++H +W+P DH Y+RELNP+  +
Sbjct: 620 EKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVHI 679

Query: 651 NPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXX 710
            PPP  V+VYR ++S+TYLNCSRH++II+D VK  TR GQ++ H    +R W DPGPW  
Sbjct: 680 LPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEA 739

Query: 711 XXXXXXXXADKRTGS--------------AVADARPVLRVLAMDWSQVSQVDSTGIQNLV 756
                     K+  S              A  D RP+L++L +D+SQV+Q D+T +Q+LV
Sbjct: 740 PAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLV 799

Query: 757 DLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLP 811
           DLR A+N+YADR VEFHF GI+SPW+KR L++ GFG      +D  +++   SYH+ R+P
Sbjct: 800 DLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVARVP 859

Query: 812 ADPPHIVHGHSVVFALGTNTPFFHLDMPDFETW 844
            +  +    +SV  A GTN PFFH+D+PDF  W
Sbjct: 860 RNKEN-PDKYSVYTASGTNLPFFHIDIPDFAKW 891

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/799 (54%), Positives = 576/799 (72%), Gaps = 35/799 (4%)

Query: 77  VNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADM 136
           +NS E VP Y E  V++K+YYN+ +R +++  +  +Y +S+FP+ +W+  YN  W+ +D+
Sbjct: 72  LNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDL 131

Query: 137 VAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLET 196
           +AGIT+GCVLVPQSMSYAQ+A+L PQYGLYSSFVGA+ YS FATSKDVCIGPVAVMSL+T
Sbjct: 132 IAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQT 191

Query: 197 AKVIARVTENLPED--TNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFM 254
           AKVI  V  +L E+  T IT P+IAT L LLCG I+  +G+LRLGFLVE IS+ AVTGFM
Sbjct: 192 AKVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFM 251

Query: 255 TGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWK 314
           TGSAL+IISGQVP+LMGY+ +VNTR  TYKVII +LKHL DT ++A FGL+PLV+L+ WK
Sbjct: 252 TGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWK 311

Query: 315 WICGSLGPRLVDRYLQFKPSRASRWNAAF-FYLQALRNAVIIVVFTAISWGISRHKLE-K 372
           W   S+GP+LVDRY  +  S+  ++  AF FY  A+R+ +II+V T+ISW ++R K + +
Sbjct: 312 WWFSSMGPKLVDRY--YPNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSE 369

Query: 373 PPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVV 432
            PIS+LG VPSGL+ VG    P GL+ K+ PELP++ I+LLLEHIAIAKSFGR+N+YKVV
Sbjct: 370 RPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVV 429

Query: 433 PDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTE 492
           PDQELIAIG++NL  TFFN+YP TGSFSRSALKAKCNVKTPLSG+FTG+CVLLALYCLT 
Sbjct: 430 PDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTG 489

Query: 493 AFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYF 552
           AF++IPKATLSAVIIHAV+DL+ASYK TW FW+ NPLD                E GIYF
Sbjct: 490 AFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYF 549

Query: 553 SISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQI--DK 610
           ++ WS A+LL KVAFP GKFLGY+ +AE++ P     ++S+  +   + S  +  +  + 
Sbjct: 550 TMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPE---IVDSDYLVEKAETSVQYSTVLMNP 606

Query: 611 DGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLN 670
           + G+L+ + S   +   ++H +WIP DHAY++E+NP   V PPP GVIVYR T+S+TY+N
Sbjct: 607 EKGELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYIN 666

Query: 671 CSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXADKRT------- 723
           CSR+++ + D VKE TRPGQL+ H+   +R W DPG W            ++        
Sbjct: 667 CSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLKNIINWRKNKNKDDEP 726

Query: 724 ---GSAVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSP 780
               + V D RP+L+++ +D+SQV+Q DST +Q+L+DLR A+NKYADR VEFHF+GI+SP
Sbjct: 727 TTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSP 786

Query: 781 WIKRALVNTGFGI-----ADPPLISSRVSYHLVR---LPADP------PHIVHGHSVVFA 826
           W+K+ LVN GFG      +D  +I    SYH+V+   L  +P      P+    + +   
Sbjct: 787 WVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYYIHAG 846

Query: 827 LGTNTPFFHLDMPDFETWR 845
            GTN PFFH+++PDF  W 
Sbjct: 847 TGTNFPFFHIEIPDFSKWN 865

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/859 (55%), Positives = 579/859 (67%), Gaps = 56/859 (6%)

Query: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGSGKPAAQYLGLNVNSREAV------ 83
           D++ L AEY   K  E HS  G   G   S   +  G  A+  LG + N  ++       
Sbjct: 11  DLDDLDAEYGHFKNTE-HSEIG---GGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGN 66

Query: 84  -----------PE-YEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAW 131
                      PE Y E  V+ ++YY+  +R  ++ +  R Y   + P+  W+ HYN  W
Sbjct: 67  GANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRW 126

Query: 132 MYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAV 191
            Y DMVAGITVGCVLVPQSMSYA +A+L PQ+GLYSSFVGA IYSFFATSKDVCIGPVAV
Sbjct: 127 FYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAV 186

Query: 192 MSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVT 251
           MSL+TAK +++V   LP DT+IT P++ATAL  LCG I++ +G+LRLGFLVE IS TAV 
Sbjct: 187 MSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVA 246

Query: 252 GFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLF 311
           GFMTGSAL+IISGQ+P+LMGY+K VNTR +TYKVIIE+LKHL DT ++A FGL+PLV+L+
Sbjct: 247 GFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLY 306

Query: 312 LWKWICGSLGPRLVDRYLQFKPSRASR-WNAAFFYLQALRNAVIIVVFTAISWGISRHKL 370
            WKW+C S GPRLV+RY   + SR  R W+A  FY QALRNAVII+VFTAI+W IS HK 
Sbjct: 307 TWKWLCNSGGPRLVERY-TVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHK- 364

Query: 371 EKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYK 430
           +K PISLLG VPSGLK+VG ++LP+GL  K+ PELPA+ I+LLLEHIAIAK+FGR+N+Y+
Sbjct: 365 KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424

Query: 431 VVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCL 490
           VVPDQELIAIG TNL  TFFNAYPATGSFSRSALKAKCNV TPLSG+F+GACVLLA+YCL
Sbjct: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484

Query: 491 TEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGI 550
           T AF +IPKATLSAVIIHAV+DLIASYK TW  WR NPLD                E+GI
Sbjct: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544

Query: 551 YFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAG--------PPSINSE----ADLAS 598
           YF++ WS AVLL KVAFP  +FLG +++AE+    G        P S + E       AS
Sbjct: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEKGKGVSYAS 604

Query: 599 IDNSATFQQIDKDG--GKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPG 656
              S+      K G  G    V          FH +W+P +  Y+RELNP+  V  PPPG
Sbjct: 605 GSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNPQVPVAQPPPG 663

Query: 657 VIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXX 716
           VIV+RP++SWTY+NC+R ++ I D V   TR G+ V   S   R W DPG W        
Sbjct: 664 VIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWHPPKFLRK 722

Query: 717 XXADKRTGS----AVADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEF 772
               K + S     V+D RPVLRV+AMDWSQV+QVDSTG+Q L DLR A++KYADR VEF
Sbjct: 723 WFGKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEF 782

Query: 773 HFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLPA--DPPHIVHGHSVVF 825
           HF+GI+SPWIKR L+NTGFG      AD  L+    +Y + R  A  D   ++       
Sbjct: 783 HFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGATGDEEALLPQP---- 838

Query: 826 ALGTNTPFFHLDMPDFETW 844
           A G N PFFH +MPDF  W
Sbjct: 839 ATGVNMPFFHAEMPDFSKW 857

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/891 (49%), Positives = 570/891 (63%), Gaps = 78/891 (8%)

Query: 29  DDIEALQAEYDQLKAGEVHSAQGA---THGDIGSRQYSGSGKPAAQYLGLNVNSREAVPE 85
           ++++ L+ EY+Q K  E  S   A       + +++Y           G       ++P 
Sbjct: 2   EELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDNSTYG---KKSYSIPS 58

Query: 86  YEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCV 145
           YEE  +++KDYY+  LR + +  +  DY  S+FP+  W+  YN  W  +D++AGITVG V
Sbjct: 59  YEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTV 118

Query: 146 LVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTE 205
           LVPQSMSYAQ+A+L P+YGLYSSF+GA +YSFFATSKDVCIGPVAVMSL+TAKVIARV E
Sbjct: 119 LVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKE 178

Query: 206 NLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISG 264
             P+ D +ITGPIIAT L  +CG IA  +G+LRLGFLVE IS+ AV GFMTGSA +II G
Sbjct: 179 KHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWG 238

Query: 265 QVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRL 324
           Q+P LMGYSKKVNTR +TY V+I+SLKHL DT ++AAFGL+PL  LF WKW C S+GP+L
Sbjct: 239 QIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKL 298

Query: 325 VDRYL--QFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRH-KLEKPPISLLGKV 381
            DRY     +P     W A +FYLQA RN +II++FTA+S+GI++    +K  IS+LG V
Sbjct: 299 TDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTV 358

Query: 382 PSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIG 441
           P GL++ G ++LP G++  +  E+P++ I+LLLEHIAI+KSFGR+N+YK+ P+QE+IAIG
Sbjct: 359 PKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIG 418

Query: 442 VTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKAT 501
           V+NL  TFFNAYPATGSFSRSALKAKCNV TPLSG+F+ ACVLLA+YCLT AF++IPKAT
Sbjct: 419 VSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKAT 478

Query: 502 LSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSCAVL 561
           LSAVIIHAV DLIASY  TW  W+ N  D                E+GIYF++ WSCA+L
Sbjct: 479 LSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAIL 538

Query: 562 LCKVAFPDGKFLGYIDVAEVIEP--AGPPSINSEADLASIDNSATF--QQIDKD------ 611
           L   AFP GKFLG I++AEV+ P        + E    S D+   +    + +D      
Sbjct: 539 LYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSS 598

Query: 612 --------GGKLNTVESVLPDPHT----RFHRRWIPLDHAYSRELNPEAVVNPPPPGVIV 659
                   G K  ++   L +  T    R++ +W+P DHAYS+ELNP   + PPPPGVIV
Sbjct: 599 NDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIV 658

Query: 660 YRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXXXXXA 719
           YR +DS+TY+NCSRH+D+I D +K  TR GQL+ H    +R W DPG W           
Sbjct: 659 YRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLKKFFNV 718

Query: 720 D------KRTGSAV----------------------ADARPVLRVLAMDWSQVSQVDSTG 751
                  KR  + V                       D RP+LRV+ +D+SQV+  D+T 
Sbjct: 719 KKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATA 778

Query: 752 IQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYH 806
           +Q+L DLR A+NKYADR VEFHF GI SPWIKR L N GFG      +D  +I+   SYH
Sbjct: 779 LQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYH 838

Query: 807 LVRLPADPP-------------HIVHGHSVVFALGTNTPFFHLDMPDFETW 844
           L R                   +I     V+ A GTN PFFH+D+PDF  W
Sbjct: 839 LSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKW 889

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/911 (48%), Positives = 584/911 (64%), Gaps = 91/911 (9%)

Query: 13  DDTGAPQWPSRNSVLNDDIEALQAEYDQLKAGE-VHSAQGATHGDIGSRQYSGSGKPA-A 70
           D+     + + N+V   D+EAL+ EYDQ K  E +    G       ++  + +  P   
Sbjct: 17  DNIELSSYSNSNTV---DLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKYE 73

Query: 71  QYLGLN-------------VNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSV 117
           +Y  L              +++   +P + E +++ K+YYN+ L+ + + N A++YALS+
Sbjct: 74  EYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSI 133

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSF 177
           FP+  W+  YN  W  +D++AGIT+GCVLVPQSMSYAQ+A+L PQYGLYSSF+GAF+Y+ 
Sbjct: 134 FPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYAL 193

Query: 178 FATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILR 237
           FATSKDVCIGPVAVMSLETAKVIA V+ +   D ++TGPIIAT L LLCG IA  +G LR
Sbjct: 194 FATSKDVCIGPVAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLALLCGGIAAAVGFLR 253

Query: 238 LGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTN 297
           LGFLVE IS+ AVTGFMTGSA +I+ GQVP LMGYSK VNTR  TYKV+I++LKHL DT 
Sbjct: 254 LGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTK 313

Query: 298 MNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRW--NAAFFYLQALRNAVII 355
           ++A FGL+PL +L++ KW C + G +L ++  QF  +   R+     +FY  A+RNAV+I
Sbjct: 314 LDAVFGLIPLFILYVVKWWCTNYGLQLAEK--QFSSNERYRFYLKKFYFYTNAMRNAVVI 371

Query: 356 VVFTAISWGISRHK-LEKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLL 414
           ++FTAISW I+R+K   + PI++LG VPSGLK++G  +    +V+K+ P+LPA+ I+LLL
Sbjct: 372 IIFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLL 431

Query: 415 EHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPL 474
           EHIAIAKSFGRIN+YK+VPDQELIAIG++NL  TFF+AYPATGSFSRSAL AKCNVKTPL
Sbjct: 432 EHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPL 491

Query: 475 SGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXX 534
           SG+FTG CVLLALYCLT AF++IPKATLSAVIIHAV+DLIASY+ T  FW  NPLD    
Sbjct: 492 SGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCF 551

Query: 535 XXXXXXXXXXXXEHGIYFSISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEA 594
                       E+GIYF++ +SCA+ + + AFP GKFLG I++AEVI  A P       
Sbjct: 552 LVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVIN-ATP------K 604

Query: 595 DLASIDNSATFQQ-------IDKDGGKL-----NTVESVLPDPHTRFHRRWIPLDHAYSR 642
           D   +DN   F+         D+  GK      NT +   P     F+ +W+P DH Y++
Sbjct: 605 DDFQMDNFNGFETSEYNNFPADQSYGKFDIANKNTHKYNSPHCSKNFYTKWVPFDHTYTK 664

Query: 643 ELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLW 702
           ELN +  +  PPPGVIVYR +DS+ YLNCSRHFD I D VK  T+ G+ + ++   +R W
Sbjct: 665 ELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPW 724

Query: 703 CDPGPWXXXXXXXXXXAD----KRTGSAVA---------------------DARPVLRVL 737
            DPG W          +     KR   A +                     D RPVL+V+
Sbjct: 725 NDPGEWEAPTWMTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVLQVI 784

Query: 738 AMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI---- 793
            +D+SQVSQ D+T +Q+L DLR ++N YADR VEFHF GI+SPW+KR L+  GFG     
Sbjct: 785 CLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEA 844

Query: 794 -ADPPLISSRVSYHLVRLPADPPHIVHGH-------------------SVVFALGTNTPF 833
            +D   I   VSYH+V+ P         H                   S+  A GTN PF
Sbjct: 845 YSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPF 904

Query: 834 FHLDMPDFETW 844
           FH+D+P+F  W
Sbjct: 905 FHIDIPNFSKW 915

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/872 (51%), Positives = 575/872 (65%), Gaps = 59/872 (6%)

Query: 30  DIEALQAEYDQLKAGEVHS---AQGATHGDIGSRQYSGSGKPAAQYLGLNVNS------- 79
           +++ L+ EYDQ KA E       +G    D   R+     K        + N        
Sbjct: 35  NLDDLEQEYDQYKAAEDRERVVGRGDDEYDDDLRKGKVDYKETELEYWNSTNGTTNLLAP 94

Query: 80  REAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAG 139
           +  VP YEE  V   D + + L+  ++L   + Y  S FP+ +W+  YN  W YAD+VAG
Sbjct: 95  KATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYADLVAG 154

Query: 140 ITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKV 199
           ITVGCVLVPQSMSYAQ+A+L PQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKV
Sbjct: 155 ITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKV 214

Query: 200 IARVTENLP-EDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSA 258
           I    E  P ED  +TGP+IATAL LLCG +AM  G+LRLGFLVE IS+ AV GFMTGS+
Sbjct: 215 IQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFMTGSS 274

Query: 259 LSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICG 318
           L+IISGQVP+LMG+ K V+TR +TYK+II SLK+LK T ++A FGL+PLVLL+ WKW C 
Sbjct: 275 LNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWWCS 334

Query: 319 SLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKPPISLL 378
           S GP+L DR+ +  P +       +FY QA+R+AVII+VFTAIS+GI++ + + P IS+L
Sbjct: 335 SYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAISYGITKGR-KTPRISVL 393

Query: 379 GKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELI 438
           GKVP GLK+V  + +PEGL+ K+   +P+A IILLLEHI+IAKSFGR+NNYKVVPDQELI
Sbjct: 394 GKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRVNNYKVVPDQELI 453

Query: 439 AIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIP 498
           AIG TNL  TFFNAYPATGSFSRSALKAKCNV+TPLSG+F+GACVLLALYCLT+ FY+IP
Sbjct: 454 AIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLALYCLTQTFYYIP 513

Query: 499 KATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSISWSC 558
            ATLSAVIIHAV+DL ASYK +W F++ NP D                ++GIYF++ WS 
Sbjct: 514 SATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSIDYGIYFAMCWSA 573

Query: 559 AVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLA-----------SIDNSA-TFQ 606
           A+ L K  F  G+FLG ++VAEV+     P++ S ++ A           SI++S+    
Sbjct: 574 AMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHLDGFQAQSSIESSSKKLD 633

Query: 607 QIDK-----------DGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPP 655
            +DK           D G  N + + +      +H +WI  D +YSRE NPE  + PPPP
Sbjct: 634 PLDKSAVHSNYLNGGDDGSDNNINNQIGQKLV-YHTKWISYDRSYSREFNPEVPIQPPPP 692

Query: 656 GVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXXX 715
           GVIVYR  DS+TYLNCSRH+DII D V+  TR GQ+++ +   +R W DPG W       
Sbjct: 693 GVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWNDPGEWEAPRWFK 752

Query: 716 XXXADKRTGSAVA---------------DARPVLRVLAMDWSQVSQVDSTGIQNLVDLRN 760
              + K+T    A               D RP+L+++ +D+SQ SQ D+T IQNL DLR 
Sbjct: 753 KLTSKKKTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQTDATAIQNLTDLRK 812

Query: 761 ALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLPA--- 812
            +N+YADR VEFH  G+ +PW+KRALVN GFG      +D  L++   SYH+ R P    
Sbjct: 813 QVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLAGHRSYHVARAPTSLE 872

Query: 813 DPPHIVHGHSVVFALGTNTPFFHLDMPDFETW 844
           D       +SV  A GTN PFFH+++PDF  W
Sbjct: 873 DGLGSPAQYSVYPASGTNLPFFHVEIPDFSKW 904

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/892 (49%), Positives = 574/892 (64%), Gaps = 85/892 (9%)

Query: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQ-YSGSGKPAA-----QYLG-LNVNSREA 82
           D+E  + EYD  K G+       TH  + +R  YS             Y G L+VNS  +
Sbjct: 10  DLERFELEYDHGKRGD------DTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNSSLS 63

Query: 83  VPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITV 142
           +P Y E  V++KD+Y  K+  + S+     Y  S+FPL +W+ HYN+ W+  D++AGITV
Sbjct: 64  IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITV 123

Query: 143 GCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIAR 202
           GCVLVPQSMSYAQ+A+L+PQYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSL+TAKVI R
Sbjct: 124 GCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIER 183

Query: 203 VTENLP--EDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALS 260
           VT  L   E T  T PIIATAL LLCG I+  IG LRLGFL+EFIS+ AV GFMTGSA +
Sbjct: 184 VTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFN 243

Query: 261 IISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSL 320
           II GQVP+LMGY+KKVNTRA+TY+V+I +LKHL DT ++A FGL+PL +L+L KW   SL
Sbjct: 244 IICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSL 303

Query: 321 GPRLVD-----RYLQFKPSRASRW-NAAFFYLQALRNAVIIVVFTAISWGISRHKLEKP- 373
           GP+ ++     R L  +  +  ++    FFY  A+RN V+I+VFTAISW I+R K     
Sbjct: 304 GPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSV 363

Query: 374 PISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVP 433
           PIS+LG VP GLK V   ++P GL EKL P+LP++ IILLLEHIAI+KSFGR+N+YK+VP
Sbjct: 364 PISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIVP 423

Query: 434 DQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEA 493
           DQELIAIGVTNL  TFF AYPATGSFSRSALKAKC+VKTPLSGLF+GACVLLALYCLT A
Sbjct: 424 DQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGA 483

Query: 494 FYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFS 553
           FY+IPKATLSAVIIHAV+DL+ASYK T  F++ NPLD                E+GIYF+
Sbjct: 484 FYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFA 543

Query: 554 ISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPA-----------------GPPSINSEADL 596
           I +SCA L+ K  FP G FLGYI +AEV+ P                  G  +   ++  
Sbjct: 544 ICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVK 603

Query: 597 ASIDNSATFQQIDKDGGKLNTVE--SVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPP 654
             +D +   +  +K+  +  + E  S     +  ++ RW+P+ + Y RE+NP   + PPP
Sbjct: 604 NRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPPP 663

Query: 655 PGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWXXXXXX 714
           PG+IVYR  DS+TYLNCSRH+DII D VK++TR G    +   ++R W D G W      
Sbjct: 664 PGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKSL 723

Query: 715 XXXX------------ADKRTGSAV--------ADARPVLRVLAMDWSQVSQVDSTGIQN 754
                            DK    A+         D +P L+++  D+SQV Q D+T IQ+
Sbjct: 724 KNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQS 783

Query: 755 LVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVR 809
           L DLR A+N+Y+++ +E+HF+GI+S W+K++L+  GFG      +D  +I    SYH+ +
Sbjct: 784 LNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSK 843

Query: 810 ----------------LPADPPHIVHGHSVVFALGTNTPFFHLDMPDFETWR 845
                           L  D  +I H  +V    GTN PFFH+D+PDF  W 
Sbjct: 844 INNQEDGLENQINEKYLQPDGSYIYHIQTVT---GTNYPFFHIDIPDFSNWE 892

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  483 bits (1243), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 251/528 (47%), Positives = 347/528 (65%), Gaps = 40/528 (7%)

Query: 86  YEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCV 145
           Y E  V++ + +N+++    +  + + Y LS+ P+ +WI HYN+ W  +D++AGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 146 LVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTE 205
           LVPQSMSYAQ+A+L PQYGLYSS +G FIY+ FATSKD+CIGPVA+MSL+TAK IA V +
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 206 NLPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQ 265
             P+   I   IIA+ + ++CGAI M IG+LRLGF ++ I +TAV GF +GSA +I+ GQ
Sbjct: 123 KHPD---IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWGQ 179

Query: 266 VPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWIC------GS 319
           +P LMGYSK VNTR  TYKV++++LK L  TN+NA  GL+PL  LF+WK+ C      G+
Sbjct: 180 IPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCDYALRRGN 239

Query: 320 LGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKPPISLLG 379
           L P          P R        FYL +LR  ++I++ +A ++G      + P + +LG
Sbjct: 240 LKPW---------PKR------IVFYLLSLRVTIVIIICSAAAYG-----AKNPSLKVLG 279

Query: 380 KVPSGLKNVGPLEL---PEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQE 436
           K+P G        L   P  LV  +  E+PA+ I+L+LEH++IAKSF R+NNY+V  DQE
Sbjct: 280 KIPKGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQE 339

Query: 437 LIAIGVTNLF-ATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFY 495
           L AIGV+N+  A    AYP TGSFSR+ALKA+C V+TPL  +F+G CV++A+  LT A  
Sbjct: 340 LTAIGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALA 399

Query: 496 FIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDXXXXXXXXXXXXXXXXEHGIYFSIS 555
           +IPKATLSAVIIHAV+ LI+SYKVT   ++  PLD                E G+YF++ 
Sbjct: 400 WIPKATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVC 459

Query: 556 WSCAVLLCKVAFPDGKFLGYIDVAEV-------IEPAGPPSINSEADL 596
           W+C +L+ ++AFP G FLGY+ V E+       IEP    S N + ++
Sbjct: 460 WACFLLMIRIAFPYGAFLGYVRVREISRSSITMIEPMDYESGNDKENI 507

 Score =  181 bits (459), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 145/254 (57%), Gaps = 22/254 (8%)

Query: 597 ASIDNSATFQQIDK---DGGKLNTVESVLPDPHTRFHRR---------WIPLDHAYSREL 644
            ++DNS   +Q+D+   D  + N +   L       H           WIP  H ++REL
Sbjct: 640 GNLDNSQDLEQLDQSSVDENQDNIINKRLTRQLVYDHELEHDTPTEIIWIPYSHRFTREL 699

Query: 645 NPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNK--ERLW 702
           NP   ++PPPPGV+VYR +DS TY+NCSR++D I+D++K++T+PG+ ++ LS+    + W
Sbjct: 700 NPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGE-IDVLSDALYVKPW 758

Query: 703 CDPGPWXXXXXXXXXXADKRTGSA--VADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRN 760
            +PGPW          AD        +AD RP LR+L +D+SQV+Q+DST +Q L+DLR+
Sbjct: 759 NNPGPWEKPKLKFWEHADPEIARKKRMADKRPTLRILCLDFSQVAQIDSTALQALIDLRH 818

Query: 761 ALNKYADRPVEFHFAGIVSPWIKRALVNTGFGIADPPLISSRVSYHLVRLPADPPHIVHG 820
            +N Y    VE+HF GI+SPW++R L+  GFG  +            V + +D  +  +G
Sbjct: 819 EVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKEFFPKVNDSSTVEVISDLEY--NG 876

Query: 821 HSVVFALGTNTPFF 834
                ALG N PFF
Sbjct: 877 E---LALGENVPFF 887

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 104/403 (25%), Positives = 186/403 (46%), Gaps = 43/403 (10%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+  Y    ++ D++AGI+V    +P ++SY   +A + P  GLYS  +  F+Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
              +   + +GP + +SL   + +  +T +     N++   I+T +T + G I +  GI 
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITLH---KENVSLIDISTVITFVSGTILLFSGIS 221

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDT 296
           R GFL   +S   + GF++   L +I   + S +   K + +    Y    E +  L D 
Sbjct: 222 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 281

Query: 297 NM------NAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALR 350
                    A F    L++LFL          RL+ R L        +++ +  +   + 
Sbjct: 282 APAQYHIPTAIFSGCCLIVLFL---------TRLLKRKLM-------KYHKSAIFFPDIL 325

Query: 351 NAVIIVVFTAISWGISRHKLEKPPISLLGKVP----SGLKNVGPLELPEGLVEKLLPELP 406
             VI+ +  ++ + + +H+     IS++G         LKN  PL  P     KL+P+L 
Sbjct: 326 LVVIVTILISMKFNL-KHRY---GISIIGDFSMDNFDELKN--PLTRPR---RKLIPDLF 376

Query: 407 AATIIL----LLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRS 462
           +A++I+      E    +KS G   N  V  ++EL+A+G  N+  + F A PA G + RS
Sbjct: 377 SASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRS 436

Query: 463 ALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
            + A    ++ +SG+F G   L+ +  L +  ++IP   LS +
Sbjct: 437 KINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVI 479

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 101/400 (25%), Positives = 184/400 (46%), Gaps = 37/400 (9%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+  Y    ++ D++AGI++    +P ++SY   +A + P  GLYS  +  F+Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
              +   + +GP + +SL   + +  +T  L +D N++   I+  +T + GAI +  GI 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESIT--LHKD-NVSLIDISIVITFVSGAILLFSGIS 211

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDT 296
           R GFL   +S   + GF++   L +I   + S +   K + +    Y    E +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLIDY 271

Query: 297 ------NMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALR 350
                    A F     ++L + + +               K     R  +A F+   L 
Sbjct: 272 APAQYHKPTAIFSGCCFIILIVMRLL---------------KKKLMKRHKSAVFFPDIL- 315

Query: 351 NAVIIVVFTAISWGISRHKLEKPPISLLGKVPSGLKNVGPLELP-EGLVEKLLPELPAAT 409
             ++++V   IS  +S    ++  IS++G     + N   L+ P      KL+P+L +A+
Sbjct: 316 --LVVIVTILISMKLSLK--QRYGISIVGDF--SMDNFDKLKNPLTHSRRKLMPDLFSAS 369

Query: 410 IIL----LLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALK 465
           +I+      E    +KS G   N  V  ++EL+A+G  N+F + F A P+ G + RS + 
Sbjct: 370 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSKIN 429

Query: 466 AKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           A    ++ +SG+F G   L+ +  L +  ++IP   LS +
Sbjct: 430 ALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVI 469

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  122 bits (307), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 183/396 (46%), Gaps = 29/396 (7%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+  Y +     DM+AGIT+    +P ++SYA  LA + P  GLYS  +  F+Y 
Sbjct: 81  LPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITPFVYC 140

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPI-IATALTLLCGAIAMVIGI 235
            F +   + +GP + +SL    V+ +  E L       G I I+  +T L GAI ++ GI
Sbjct: 141 VFGSVPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSGAILLIFGI 196

Query: 236 LRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKD 295
            RLGFL   +S   + GF++   L ++   + + +  +K + T    Y    E ++ L  
Sbjct: 197 TRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQFLFK 256

Query: 296 ---TNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNA 352
               N++      P  +L L  +I       +  R+L+ K  +  R+ +  F+ +     
Sbjct: 257 YGPENLHK-----PTAILSLCSFII-----LMTLRFLKKKLMK--RYKSVIFFPE----- 299

Query: 353 VIIVVFTAISWGISRHKLEKPPISLLGKVP-SGLKNVG-PL-ELPEGLVEKLLPELPAAT 409
           ++++V +++   ++ +  +   IS+LG    SG   +  PL +    L  +LL       
Sbjct: 300 ILLIVISSLIISVNFNLKKDFDISMLGDFSTSGFDKLNNPLGKDNRSLCHELLSVGLMCA 359

Query: 410 IILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCN 469
           I+   E    +KS G I +  +  ++EL+A+G  NL  + F A P+ G + RS + A   
Sbjct: 360 ILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGGYGRSKINALSG 419

Query: 470 VKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
            +T +SG   G   L  +  L    ++ P   LS +
Sbjct: 420 AQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVI 455

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  119 bits (299), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 111/458 (24%), Positives = 197/458 (43%), Gaps = 44/458 (9%)

Query: 67  KPAAQYLGLN--VNSREAVPEYEETVV-----SVKDYYNYKLRGFISLNTARDYALSVFP 119
           +P+ ++   N   +S EA+ ++ E  +      V+D      R  ++ +   DY    FP
Sbjct: 2   QPSRRFCDTNGSSDSAEAISQHNEDGLVYNQEDVQDRIAINNRSILTTSNIWDYLAYYFP 61

Query: 120 LHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYSFF 178
              W+ +Y +     D+ AG++V    +P ++SYA  LA + P  GLYS  +  FIY+ F
Sbjct: 62  CFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAITPFIYAIF 121

Query: 179 ATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILRL 238
            +   + +GP + +SL   + +  +  +   D  I+   I+  +T + G+  + +GI RL
Sbjct: 122 GSVPQMIVGPESAISLVVGQAVEPMVNH---DERISTISISIVVTFISGSFLLFLGIFRL 178

Query: 239 GFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNM 298
           GFL   +S   + GF+      +I   + S +   K + T    Y    E +  L     
Sbjct: 179 GFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEKILFLIKYGQ 238

Query: 299 N------AAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNA 352
           +      A   L   ++L L K +   L  R   +++ F P                   
Sbjct: 239 HNYHAPTAILSLYSFIILMLMKVMKKRLMKRF--KWVIFVPE------------------ 278

Query: 353 VIIVVFTAISWGISRHKLEKPPISLLGKVP-SGLKNV-GPLELPEGLVEKLLPELPAATI 410
           ++IV+   I +        K  IS++G    +G  ++  PL+    L+ K  P L A  +
Sbjct: 279 ILIVIVGTIMFSFHFDIKHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLK--PLLDAGIV 336

Query: 411 ILLL---EHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAK 467
             +L   E    +K+ G   +  V  ++EL+A+G  N+  + F A PA G + RS + A 
Sbjct: 337 CAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKINAL 396

Query: 468 CNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
              +T +SG+  G+  L  +       +  P   LS V
Sbjct: 397 SGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVV 434

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  118 bits (295), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 102/416 (24%), Positives = 177/416 (42%), Gaps = 33/416 (7%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+ +YN++    D++AG+++    +P ++S+A  +A + P  GLYS     FIY+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
              +   + +GP + +SL   + + ++  + P+   +    ++  +T + G      G+ 
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMISHNPDLHTLQ---LSAVITFISGGFLFFFGLC 206

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDT 296
           RLGFL   +S   + GF++   L +I   + S     K +      Y    E +  L   
Sbjct: 207 RLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEKILFLVTY 266

Query: 297 NMN------AAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALR 350
             N       A  L    +L + K I   L PR   R++ F P                 
Sbjct: 267 APNNYHGPTTALSLSCFFILIMTKIIKKKLMPRC--RWIVFVPD---------------- 308

Query: 351 NAVIIVVFTAISWGISRHKLEKPPISLLGKVPS-GL-KNVGPLELP-EGLVEKLLPELPA 407
             +++++   I   I         IS +G   + GL K + PL     GL+ +LL     
Sbjct: 309 --ILLLIIGTIFLSIKYRFKHNYSISTVGDFNTKGLDKLLNPLSAENRGLIPQLLSAGFI 366

Query: 408 ATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAK 467
             ++   E    +KS G   +  +  ++EL+A+G  NLF++   + PA G + RS + A 
Sbjct: 367 TAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFGGYGRSKINAF 426

Query: 468 CNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVADLIASYKVTWMF 523
              +T +SG F G  VLL +  L    ++IP   LS V       L+       MF
Sbjct: 427 SGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLEEAPADLMF 482

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  117 bits (292), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 112/459 (24%), Positives = 204/459 (44%), Gaps = 49/459 (10%)

Query: 59  SRQYSGSGKPAAQYLGLNVNSREAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVF 118
           SR + G+   A++   +NV+  E+         SV D            NT  +      
Sbjct: 48  SRTHVGTSNSASEVFPVNVSRFESFNSMSNND-SVYDN-----------NTIFETVPYYL 95

Query: 119 PLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYSF 177
           P   W+  Y    ++ D++AGI++    +P ++SY   +A + P  GLYS  +  F+Y  
Sbjct: 96  PCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGI 155

Query: 178 FATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILR 237
             +   + +GP + +SL   + +  +T  L +D N++   I+  +T + GAI +  GI R
Sbjct: 156 LGSVPQMIVGPESAISLVVGQAVESIT--LHKD-NVSLIDISVVITFVSGAILLFSGISR 212

Query: 238 LGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDT- 296
            GFL   +S   + GF++   L +I   + S +   K + +    Y    E +  L D  
Sbjct: 213 FGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLIDYA 272

Query: 297 -----NMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRN 351
                   A F    L++LF  + +               K        +A F+   L  
Sbjct: 273 PAQYHKPTAIFSGCCLIVLFSMRLL---------------KKKLVKHHKSAIFFPDILL- 316

Query: 352 AVIIVVFTAISWGISRHKLEKPPISLLGKVPSGLKNVGPLELP-EGLVEKLLPELPAATI 410
            VI+ +F ++ + + +H+     I+++G     + N   L+ P      KL+P+L +A++
Sbjct: 317 VVIVAIFISMKFSL-KHRY---GITIIGDF--SMDNFDKLKNPFTHSRRKLIPDLFSASL 370

Query: 411 IL----LLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKA 466
           I+      E    +KS G   N  V  ++EL+A+G  N+  + F A P+ G + RS + A
Sbjct: 371 IVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINA 430

Query: 467 KCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
               ++ +SG+F G   L+ +  L +  ++IP   LS +
Sbjct: 431 LSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVI 469

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  116 bits (290), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 98/400 (24%), Positives = 187/400 (46%), Gaps = 37/400 (9%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+  Y  + ++ D++AGI++    +P ++SY   +A + P  GLYS  +  F+Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
            F +   + +GP + +SL   + +  +T  L +D N++   I+  +T + GAI +  GI 
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESIT--LHKD-NVSLIDISIVITFVSGAILLFSGIS 211

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDT 296
           R GFL   +S   + GF++   L +I   + S +   K + +    Y    E +  L D 
Sbjct: 212 RFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLIDY 271

Query: 297 -----NM-NAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALR 350
                +M  A F    L++LFL +                    +  +++    +   + 
Sbjct: 272 APAQYHMPTAIFSGCCLIILFLMRL----------------LKRKLLKYHKGAIFFPDIL 315

Query: 351 NAVIIVVFTAISWGISRHKLEKPPISLLGKVPSGLKNVGPLELP-EGLVEKLLPELPAAT 409
             VI+ +  ++ + + +H+     I+++G     + N   L+ P      KL+P+L +A+
Sbjct: 316 LVVIVTILISMKFDL-KHRY---GITIVGDF--SMDNFDKLKNPLTRSRRKLIPDLFSAS 369

Query: 410 IIL----LLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALK 465
           +I+      E    +KS G   N  V  ++EL+A+G  N+  + F A P+ G + RS + 
Sbjct: 370 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKIN 429

Query: 466 AKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           A    ++ +SG+F G   L+ +  L +  ++IP   LS +
Sbjct: 430 ALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVI 469

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 97/395 (24%), Positives = 174/395 (44%), Gaps = 27/395 (6%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   WI +YN      D +AG+++    +P  +S+A  LA + P  GLYS  V  FIY+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
            F +   + +GP + +SL   + +  +T +   D ++    IAT ++ + G   +  GI 
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTSH---DLSLETVDIATMISFMSGLTLLFGGIF 188

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHL--- 293
           RLGFL   +S   + GF++     +I   + + +  +K + T    Y    E +  L   
Sbjct: 189 RLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRY 248

Query: 294 KDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAV 353
             +N +     + L +      I          R  + K  R  +W     ++  + + V
Sbjct: 249 GPSNYHLPTSFLSLAVFTTLMTI----------RIFKKKMMRRIKW---IVFIPEILSVV 295

Query: 354 IIVVFTAISWGISRHKLEKPPISLLGKVPS-GLKNV-GPL-ELPEGLVEKLLPELPAATI 410
           I  +  +    + +    K  IS++G   + G  +   PL +   GL+  L      + +
Sbjct: 296 IFSIVLSYMCDLKK----KYDISVIGDFNTDGFDDFRNPLSKCNRGLIPALRDVSLVSAL 351

Query: 411 ILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNV 470
           +  LE I  +KS G   N     ++EL+A+G+ N   + F   PA G + RS + A    
Sbjct: 352 LGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGA 411

Query: 471 KTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           +T ++G+F G+  L  +  L    ++IP   LS +
Sbjct: 412 QTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVI 446

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 103/402 (25%), Positives = 169/402 (42%), Gaps = 41/402 (10%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   WI HY+    + D+VAGI++    +P ++SYA  +A + P  GLYS  +   IY+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLP-EDTNITGPIIATALTLLCGAIAMVIGI 235
            F +   + +GP + +SL    V+ + TE     D+ I+   I   +T + G +   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 236 LRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHL-- 293
           +RLGFL   +S   + GF++   L +I   +   +  + K+   A  Y   +  +  L  
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFR 249

Query: 294 -------KDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYL 346
                  K T   A   L+  ++L   +     L  R   R+L F P             
Sbjct: 250 YASEYYHKPT---AILSLICFLVLISTRIAKKKLMNRY--RFLIFVPE------------ 292

Query: 347 QALRNAVIIVVFTAISWGISRHKLEKPPISLLGKVPS-GLKNVG-PLELP-EGLVEKLLP 403
                 +++VV   I   +         IS +G+  + G  ++G PL      L   L  
Sbjct: 293 ------ILLVVSVTILLSLKYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSSLWN 346

Query: 404 ELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSA 463
           E  A  ++   E    +KS G   N     ++ELIA+G  N+  + F A P+ G + RS 
Sbjct: 347 EGLAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSK 406

Query: 464 LKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           +      KT +SG   G   LL    L    ++ P   LS +
Sbjct: 407 VNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVI 448

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 99/402 (24%), Positives = 175/402 (43%), Gaps = 41/402 (10%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+ +Y    +  D++AGIT+    +P ++SYA  +A + P  GLY+  V  F Y+
Sbjct: 110 LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYA 169

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
            F ++  + +GP   +SL   + +    ++ P+   I   +I  A+TL+ G I ++ GI 
Sbjct: 170 IFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPI---LIVIAVTLISGTILLISGIF 226

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDT 296
           RLG+L   ++   + GF+      +I   + SL+   K  +  A T +            
Sbjct: 227 RLGYLGNILNKALLHGFIGSVGFVMI---IDSLINELKLGDILADTPE------------ 271

Query: 297 NMNAAFGLVPLVLLFLWKWICGSL----------GPRLVDRYLQFKPSRASRWNAAFFYL 346
           + N  F    L ++FLWK+   +              ++     FK     R     F  
Sbjct: 272 HYNTPF----LKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIFIP 327

Query: 347 QALRNAVIIVVFTAISWGISRHKLEKPPISLLGKVPSGLKNV--GPL-ELPEGLVEKLLP 403
           +     ++IV+ T +         +   I +LG   S   ++   PL     GL+  +  
Sbjct: 328 E-----ILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSIFHNPLSNKNRGLIHVVFN 382

Query: 404 ELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSA 463
                 I    E    +K+ G  +   V  ++EL+A+G++N+  +   A P+ G + RS 
Sbjct: 383 IGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYGRSK 442

Query: 464 LKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           + A    KT LSG+F G   +LA+  L    ++IP   LS +
Sbjct: 443 INALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVI 484

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 104/407 (25%), Positives = 185/407 (45%), Gaps = 40/407 (9%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P  RW+  YN +  ++D ++GI++    +P ++SYA  +A + P  GLYS  +   IY 
Sbjct: 114 LPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYG 173

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARV--TENLP--EDTNITGPIIATALTLLCGAIAMV 232
              +   + +GP   +SL   + + ++  + NL   ED +I+   I+  +T L G +  +
Sbjct: 174 ILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFI 233

Query: 233 IGILRLGFLVEFISITAVTGFMTG-SALSIISGQVPSLMGYSKKVNTRATTYKVIIESLK 291
            G+LRLGFL   +S   +  F++    + +I   +  +     K+N       ++I++ +
Sbjct: 234 CGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEM-----KLNC------ILIDNDR 282

Query: 292 HLKDTNMNAAFGLVPLVLLFLWKWICGSL-GPRLVDRYLQFKPSRASRWNAAFFYLQA-- 348
           H      + AF  +    +F+ K+   +   P  V   + F      R+    + ++   
Sbjct: 283 H-----YHTAFEKI----MFIIKYAPNNFHKPTTVLSVVCFSILYFVRYCKKKYIIKHKS 333

Query: 349 ---LRNAVIIVVFTAISWGISRHKLEKPPISLLGKVPSGLKNV--GPLELPEGLVEK-LL 402
              L   +I+V+ T I    S +  +   IS++G V S   N+  G L+ P     K L 
Sbjct: 334 LIFLPEILIVVISTGI-LSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNKELF 392

Query: 403 PELP----AATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGS 458
           P L     A   +   E    +KS G      +  ++EL+A+GV NL A+     P+ G 
Sbjct: 393 PILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSFGG 452

Query: 459 FSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           + RS + A    KT +SG+  G   +L +  L    +FIP   LS +
Sbjct: 453 YGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVI 499

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 101/402 (25%), Positives = 175/402 (43%), Gaps = 27/402 (6%)

Query: 111 RDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSF 169
           RD      P   WI  Y  +    D+VAGIT+    +P ++SYA  LA + P  GLYS  
Sbjct: 75  RDVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLA 134

Query: 170 VGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAI 229
              FIY+ F +   + +GP + +SL   + + ++  +  E + ++   I+  +T + G  
Sbjct: 135 FTPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRAHNHEISTMS---ISVLVTFISGMF 191

Query: 230 AMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIES 289
             V GI R GFL   +S   + GF++   + +I   + S +   K +      +    + 
Sbjct: 192 LFVFGICRFGFLGNVLSRALLRGFISSVGVVMIVNSLISELKLHKLLLETKGHFHTPFQK 251

Query: 290 LKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQAL 349
           ++ +       A   +P  +L L  +I       +  R ++ K  R  RW     ++  +
Sbjct: 252 IRFI--IKYAPANYHIPTAVLSLTCFII-----LVTARVIKKKLMRRRRWPV---FVPEI 301

Query: 350 RNAVIIVVFTAISWGISRHKLEKPPISLLGKVPS-GLKNV-GPLELPEGLVEKLLPELPA 407
              +I  +  +  +   +H      IS++G   + GL N   P+        +L P L  
Sbjct: 302 LILIITTIILSHKFKFKKHY----EISIVGDFDTDGLVNFYNPISKSN---RELAPNLMN 354

Query: 408 ATIIL----LLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSA 463
           A  I+      E    AKS G    + +  ++EL+A+G  NL A+   A PA G + RS 
Sbjct: 355 AGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSK 414

Query: 464 LKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           + +    +T +SG+  G  VLL +        +IP   LS +
Sbjct: 415 INSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVI 456

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 94/405 (23%), Positives = 180/405 (44%), Gaps = 23/405 (5%)

Query: 111 RDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFV 170
           + Y     P+ RW+  Y+   M  DM+AG+T+    +P ++S   +A +SP  GLY+  +
Sbjct: 41  KSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVI 100

Query: 171 GAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALT-LLCGAI 229
              IY+ F +   + +GP  V SL    V+ +  +     +    P++  A+   + G +
Sbjct: 101 PPLIYAVFGSVPTMVVGPQTVASL----VVGQSCDAWAHKS--LEPLMTVAVIGCISGVL 154

Query: 230 AMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIES 289
              +GI RLGF+   IS   + GF +  A+ ++  ++   +    +        KV   +
Sbjct: 155 VFAMGIFRLGFIDNAISKAFLKGFTSALAVVMLITELLPQLQIDDRYKQALKEGKVGSAA 214

Query: 290 LKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQAL 349
              L     NA     P    F  K    +    L+ +YL+   +    W    F+    
Sbjct: 215 WDKLVFALENAREYSNP----FSVKLSVAAFSILLLSKYLKKYLTAKYGWTKLTFF---- 266

Query: 350 RNAVIIVVFTAISWGISRHKLEKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAAT 409
              +++VV  +I          K  + ++G +P    N   +++P    ++      A+ 
Sbjct: 267 -PDLLLVVLGSILLSFYYDWDNKYNLPIVGDLPP---NKDHIKVPIQSFQEFKDLFDASF 322

Query: 410 IILLLEHIAIAKSFGRIN---NYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKA 466
           ++ +L     A +F  I+   +  V  ++EL+++G+ N+  + F++ PA G + RS L  
Sbjct: 323 LVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNI 382

Query: 467 KCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVA 511
            C  +TP++G+F     +  +  L   F+++P   L AVII  +A
Sbjct: 383 FCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCIL-AVIISFIA 426

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 109/406 (26%), Positives = 191/406 (47%), Gaps = 49/406 (12%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   WI  Y    + +D +AGI++    +P ++SYA  +A + P  GLYS  +  FIY+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGI 235
            F +   + +GP + +SL    V+ +  E L   D+ +    I+  LT + GA  +++GI
Sbjct: 149 VFGSVPQMIVGPESAISL----VVGQSVELLKSHDSALEIINISVVLTFISGAALLILGI 204

Query: 236 LRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSK-----KVNTRATTYKVIIESL 290
           LRLGFL   +S + + GF++   L +I   + + +  +K     KV+   +  KV  + L
Sbjct: 205 LRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKV--QFL 262

Query: 291 KHLKDTNMN---AAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQ 347
                TN +   A    +  V LF           RL+ +    K     RW A   ++ 
Sbjct: 263 IKYAPTNYHKPTALLSAIAFVTLF---------SIRLLKKRWMAK----HRWLA---FIP 306

Query: 348 ALRNAVIIVVFTAISWGISRHKLEKPPISLLGKVPS----GLKNVGPLELPEGLVEKLLP 403
            +   VII ++ + +W   +       I ++G   +     LKN  P+        K++P
Sbjct: 307 EILMVVIISIYLSATWEFKKQY----GILIVGDFNTHAIDKLKN--PISKEN---RKIMP 357

Query: 404 ELPAATIILLL----EHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSF 459
           +L    +++ L    E +  +KS G   +  +  ++EL+A+G  N+ A+ F A P+ G +
Sbjct: 358 QLLNTGVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGY 417

Query: 460 SRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
            RS + A    KT +SG+F G+  L+ +  L    ++IP   LS +
Sbjct: 418 GRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVI 463

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 105/448 (23%), Positives = 200/448 (44%), Gaps = 45/448 (10%)

Query: 92  SVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSM 151
           S++ Y   K+   + LNT + Y     P+ +W   Y+   +  D++AGI++    +P ++
Sbjct: 23  SLRSYRAIKVDQPLKLNT-KSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAI 81

Query: 152 SYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTE---NLP 208
           S + +A +SP  GL+S  +   IY+ F +   + +GP  V+SL    V+ +  E   +  
Sbjct: 82  SLSTMAHVSPYAGLFSLVIPPLIYAVFGSVPTMVVGPQTVVSL----VVGQSCEAWSHKS 137

Query: 209 EDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSA-LSIISGQVP 267
            D+ +T  +IA       G I + +G+ R+GF+   IS   + GF+   A + +I+  +P
Sbjct: 138 VDSLVTVAVIACT----SGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLP 193

Query: 268 SLM---GYSKKV---NTRATTYKVIIESLK----HLKDTNMNAAFGLVPLVLLFLWKWIC 317
            L     Y  +V   N   TT+      LK    H    +M  +F  +   +L + K++ 
Sbjct: 194 ELQLEDLYRDEVAQGNAGTTTWDKFNFILKYGPEHADSFSMKLSF--IAFSILMVCKYVK 251

Query: 318 GSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKPPISL 377
                +   +  +F P       A F YL    +           W  +          +
Sbjct: 252 KYFTEKRGSKLCRFFPDLL-LVVAGFIYLSYYND-----------WSSTMGT------RI 293

Query: 378 LGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIA-KSFGRINNYKVVPDQE 436
           +G +P   KN   + +      K L ++     IL L   A A K+ G   +  +  ++E
Sbjct: 294 IGNLPPN-KNHFKVPITSFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNRE 352

Query: 437 LIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYF 496
           L+++G+ N+ ++ F+A PA G + RS L   C+ +TP++G+      +  +  +  AF++
Sbjct: 353 LVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHY 412

Query: 497 IPKATLSAVIIHAVADLIASYKVTWMFW 524
           +P   L+ +I +   +L+        F+
Sbjct: 413 LPLCVLAVIISYIAYNLLEEIPSDLFFY 440

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 88/389 (22%), Positives = 158/389 (40%), Gaps = 40/389 (10%)

Query: 149 QSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLP 208
            S+S + LA L P  GLYS  +   IY    T     +GP  V+SL   +     +    
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHRSL 60

Query: 209 EDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSII----SG 264
           E  +    I   +     G I   +G+ R+GF+   +S   + GF++  AL ++      
Sbjct: 61  EPLSTVAVIGCVS-----GGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELLP 115

Query: 265 QVPSLMGYSKKV------NTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICG 318
           ++     Y+  V       T    ++ I+E      DT              F W     
Sbjct: 116 ELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLSLF 161

Query: 319 SLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLEKPPISLL 378
           +    +  RYL+   +    W    F+ +     ++IVV  +I+   ++   E   I ++
Sbjct: 162 TFILLMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQKWSELKGIKII 216

Query: 379 GKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLL---EHIAIAKSFGRINNYKVVPDQ 435
           G +P    N   +++P     +       + +I +L   E   + KS    +N     ++
Sbjct: 217 GDIP---PNSDHIKVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASSNR 273

Query: 436 ELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFY 495
           EL+++GV NL ++ F+A PA G + RS +   C  +T  SG+F     ++ +  L  AF+
Sbjct: 274 ELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNAFH 333

Query: 496 FIPKATLSAVIIHAVADLIASYKVTWMFW 524
            +P   L+ +I      L+       MF+
Sbjct: 334 HLPICILAVIISTVAFSLLEEAPADLMFY 362

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/397 (21%), Positives = 161/397 (40%), Gaps = 31/397 (7%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+  Y+ + +  D +AG ++    +P +MSY+  +A + P  GL +     F+Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
            F +   + +GP + +SL   + I +    +  D ++    +   LT + GAI    GI+
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAIEK---QMKHDKSLDVVNLCLILTFISGAILFCFGIM 186

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDT 296
           R G+L   +S   + GF++   L ++   + + +   K  N     Y    + L      
Sbjct: 187 RFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHYHAPFQKL------ 240

Query: 297 NMNAAFGLVPLVLLFLWKWICGSL----GPRLVDRYLQFKPSRASRWNAAFFYLQALRNA 352
                        +FL+ +  G+         +  +      R  +   +  Y + +   
Sbjct: 241 -------------IFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFVP 287

Query: 353 VIIVVFTAISWGISRHKLE-KPPISLLGKVPSG--LKNVGPLELPE-GLVEKLLPELPAA 408
            I++V   ++ G      + +  I ++G +  G   K   PL      L  +L       
Sbjct: 288 EILIVVALVTLGSYHFSFKLRYNIDIVGDIEVGDTSKFRNPLSKKNLSLFSELFHAGFMV 347

Query: 409 TIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKC 468
            ++   E    +KS G      V  ++EL+A+G  NL  + F A P+ G + RS + A  
Sbjct: 348 ALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYS 407

Query: 469 NVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
              T +SG+F G    +    L  A + IP   LS +
Sbjct: 408 GAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVI 444

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/395 (21%), Positives = 161/395 (40%), Gaps = 29/395 (7%)

Query: 119 PLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYSF 177
           P   W+  Y++   + D +AG+++    +P +MSYA  +A + P  GLY+     F Y+ 
Sbjct: 98  PCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYAI 157

Query: 178 FATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGILR 237
           F +   + +GP + +SL   + I  +  + P  +++   +I   +T + G +    G+ R
Sbjct: 158 FGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVI---ITFISGVVLFTFGVFR 214

Query: 238 LGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKD-- 295
            GFL   +S   + GF++   + ++   +   +   K  +   + Y    E +  L    
Sbjct: 215 FGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFLIKYA 274

Query: 296 -TNMNAAFGLVPL-VLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAV 353
             N +    L+ L   L L              R L F P                   +
Sbjct: 275 PANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPE------------------I 316

Query: 354 IIVVFTAISWGISRHKLEKPPISLLGKVPSGL--KNVGPLELPEG-LVEKLLPELPAATI 410
           ++VV T I +  +     +  I ++G + + +  K   PL   +      L        +
Sbjct: 317 LLVVVTVIFFSYNFDLKHRYNIEVVGDIEASVFDKLRNPLSKNKRPFYGDLFSAGFMVAM 376

Query: 411 ILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNV 470
           +   E    +KS G   +  V  ++EL+A+G  NL  + F A P+ G + RS + A    
Sbjct: 377 LGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGA 436

Query: 471 KTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           +T +SG   G   +  +  L +   +IP   LS +
Sbjct: 437 QTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVI 471

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/397 (23%), Positives = 166/397 (41%), Gaps = 31/397 (7%)

Query: 118 FPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYSSFVGAFIYS 176
            P   W+  Y+      D++AG ++    +P +MSY+  +A + P  GL +      +Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 177 FFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCGAIAMVIGIL 236
            F +   + +GP + +SL   + I ++T++   D ++    +   LT + G+I    G++
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKH---DASLNVTNLCVVLTFISGSILFSFGLM 201

Query: 237 RLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTY-----KVIIESLK 291
           R GFL   +S   + GF++   L ++   + S +            Y     KV+   L 
Sbjct: 202 RFGFLDSVLSRALLRGFISAVGLIMVINSLISELKLKDTFKNAPGHYHAPFQKVVF--LV 259

Query: 292 HLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRN 351
           H    N +    LV LV          +LG   V      K          FF      +
Sbjct: 260 HYAPANYHLPTALVSLVCF-------AALGALKV----IKKKLVKRFKKVIFF-----PD 303

Query: 352 AVIIVVFTAISWGISRHKLEKPPISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATII 411
            +++V F  +       K+ +  I ++G + +G  N     + +  ++       A  ++
Sbjct: 304 ILVVVAFATLVSYCYDFKV-RYNIDIVGDIETGSSNTIKNPISKDNLKLFNDLFHAGFLV 362

Query: 412 LLL---EHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPATGSFSRSALKAKC 468
            LL   E    +KS G   +  +  ++EL+A+G  NL  + F A P+ G + RS + A  
Sbjct: 363 ALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYS 422

Query: 469 NVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
              T +SG+F G   L+    L  A   IP   LS +
Sbjct: 423 GAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVI 459

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 99/409 (24%), Positives = 166/409 (40%), Gaps = 37/409 (9%)

Query: 109 TARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVPQSMSYA-QLASLSPQYGLYS 167
           T +D      P   WI  Y+V     D +AG+++    +P +MSYA  +A + P  GLYS
Sbjct: 65  TLKDTIPYYLPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYS 124

Query: 168 SFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLPEDTNITGPIIATALTLLCG 227
                 +Y+   +   + +GP + +SL   + I      L ED  +    I   +T + G
Sbjct: 125 LVFSPAVYTVLGSVPQMIVGPESAISLILGQAIE---ARLSEDPKLKAINICLVITFISG 181

Query: 228 AIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPSLMGYSKKVNTRATTYKVII 287
            + +  G+LRLGFL   +S   + GF++G  + ++   +   +  +    TR   Y    
Sbjct: 182 LVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPF 241

Query: 288 ESLKHLKDT------NMNAAFGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNA 341
           E +  +            A   LV  V+L   +                FK     R+  
Sbjct: 242 EKVLFIMKYGPENYHKPTAILSLVAFVILMSLRI---------------FK----KRYGK 282

Query: 342 AFFYLQALRNAVIIVVFTAISWGISRHKLEKPPISLLGKVPSG----LKNVGPL-ELPEG 396
            F +L  L + +++VV  +I      H   +  I ++  +P      LKN  P   +   
Sbjct: 283 KFKWLVLLPD-ILVVVALSIFVSYKMHLKSRYGIEIINDIPKDSMKHLKN--PFSNVNVA 339

Query: 397 LVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLFATFFNAYPAT 456
             + L        ++   E    +KS G   N  +  ++ELIA+G  N+  + F   PA 
Sbjct: 340 TFKDLFSTGFMVAMLGFFESATASKSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAF 399

Query: 457 GSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAV 505
           G + RS + A    +T +SG F G   L  +  L     +IP   LS +
Sbjct: 400 GGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVI 448

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 128/305 (41%), Gaps = 35/305 (11%)

Query: 210 DTNITGPIIATAL-TLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPS 268
           D  IT  I+  AL T++ GA+ + +G LRLG LV F  +  + G + G A  +I   +  
Sbjct: 315 DDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGI-- 372

Query: 269 LMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRY 328
                 +V+TR T ++    SL  L++  M+            L KW+  +L   L    
Sbjct: 373 ------EVSTRVTKFEY---SLAFLRNLFMDPDI---------LAKWLIPAL---LAVSI 411

Query: 329 LQFKPSRASRWNAAFFYLQALR-NAVIIVVFTAISWGISRHKLEKPPISLLG-KVPSGLK 386
           +  +    +      FYL A      I+ +  ++S    R K    P++  G +    L+
Sbjct: 412 ILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLE 471

Query: 387 NVGPLELPEGLVEKLLPELPAATIILLLEHI-----AIAKSFGRINNYKVVPDQELIAIG 441
              P  +   LV   +P + A T   +L H+     A+A S G I+  K+  D+ELIA G
Sbjct: 472 LYNPQRIHWELVLGEIPTMLALTFFGIL-HVPINVPALAISCG-ID--KIDVDKELIAHG 527

Query: 442 VTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKAT 501
            +N+F+    +      ++ S L  +    +  +G        + +         IP   
Sbjct: 528 YSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCI 587

Query: 502 LSAVI 506
           +S++I
Sbjct: 588 VSSLI 592

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 7/143 (4%)

Query: 134 ADMVAGITVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIY-SF-FATSKDVCIGPVAV 191
           A ++A I  G ++     +  +LA   P  G Y S+V  FI  SF FA + +  IG +  
Sbjct: 126 AVVIAWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLIT 185

Query: 192 MSLETAKVIARVTENLPE-DTNITGPIIATALTLLCGA-IAMVIGILRLGFLVEFISITA 249
           M LE   + A +T N  + D+      +A    ++ G  +  V G     F+   I +TA
Sbjct: 186 MPLEL--IAASITVNYWDVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTA 243

Query: 250 VTGFMTGSALSIISGQVPSLMGY 272
           + GF+    + ++ G  PS  GY
Sbjct: 244 IVGFII-LGIVLVCGGGPSDEGY 265

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON}
           Anc_3.455 YPR122W
          Length = 1201

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 17/102 (16%)

Query: 28  NDDIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGSGKPAAQYLGLNVNSREAVPEYE 87
           N +I A+Q+E+D    G + S     +    +R  S  G P +Q+   N+N+  ++P+ +
Sbjct: 147 NKEIYAIQSEHD----GNMSSVTKILYH--ATRMLSDPGHPFSQFSTGNMNTLASIPKLQ 200

Query: 88  ETVVS-------VKDYYNYK----LRGFISLNTARDYALSVF 118
              +         K+YY  K    LRG  S+N    YALS F
Sbjct: 201 GVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALSKF 242

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 302 FGLVPLVLLFLWKWICGSLGPRLVDRYLQFKPSRASRWNAAFFYLQALRNAVIIVVFTA 360
           FGLVP + + L+  +C  +G  L  R  ++ P +    N +FF L  + N    ++F A
Sbjct: 30  FGLVPAIFMLLFCGLCSMMGLLLQSRIAKYGPLK----NVSFFSLAQVVNPASSILFDA 84

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 10/131 (7%)

Query: 397 LVEKLLPELPAATIILLLEHI-----AIAKSFGRINNYKVVPDQELIAIGVTNLFATFFN 451
           L+ K +P + A T   +L H+     A+A S   ++ Y V  D+ELIA G +NL + F  
Sbjct: 523 LIPKQVPTMLALTFFGIL-HVPINVPALAMSLN-VDKYDV--DKELIAHGYSNLISGFLG 578

Query: 452 AYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVA 511
           +      ++ S L  +    +P++G+       + +        FIP   + ++I     
Sbjct: 579 SIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGY 638

Query: 512 DLIASYKV-TW 521
           +LI    + TW
Sbjct: 639 ELIQEAVIDTW 649

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,608,941
Number of extensions: 3629952
Number of successful extensions: 8600
Number of sequences better than 10.0: 55
Number of HSP's gapped: 8568
Number of HSP's successfully gapped: 68
Length of query: 848
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 730
Effective length of database: 39,950,811
Effective search space: 29164092030
Effective search space used: 29164092030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)