Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR076C8.272ON68668633400.0
SAKL0H16808g8.272ON65764616470.0
Kwal_56.237548.272ON58959715720.0
Kpol_543.448.272ON64367015470.0
KLLA0A04631g8.272ON57954215330.0
TDEL0F039908.272ON63165415230.0
ZYRO0C01430g8.272ON59051014830.0
KLTH0G13464g8.272ON59361414710.0
TPHA0A017508.272ON63661214490.0
Ecym_42988.272ON67867014300.0
TBLA0F030408.272ON90651713601e-176
Kwal_26.6669singletonON59052712751e-168
KLLA0F17776gna 1ON5535188141e-99
SAKL0C02178gsingletonON5655568151e-99
SAKL0E04246gna 1ON5655467628e-92
Smik_4.3638.272ON7655315051e-53
Skud_4.3798.272ON7595354689e-49
YDR119W (VBA4)8.272ON7685444652e-48
Suva_2.2798.272ON7755394582e-47
CAGL0J01375g2.473ON5644784405e-46
KLTH0H05456gna 2ON5685024362e-45
Suva_13.2652.473ON5615534263e-44
Kwal_14.1585na 2ON5705054264e-44
NCAS0A078102.473ON5684734202e-43
Smik_13.2722.473ON5615414106e-42
Kwal_26.6697singletonON5775454091e-41
SAKL0E02992g2.473ON5704704081e-41
Skud_13.2442.473ON5625504071e-41
NDAI0H022002.473ON5714624053e-41
YMR088C (VBA1)2.473ON5624794026e-41
SAKL0A07480gsingletonON5735473982e-40
TDEL0C00120singletonON5695213982e-40
TDEL0A024902.473ON5544613954e-40
Skud_2.423na 3ON5604983912e-39
KLTH0E16720gsingletonON5745013903e-39
Suva_4.553na 3ON5625233867e-39
Ecym_73992.473ON5633323841e-38
KLTH0D05434g2.473ON5764783823e-38
KLLA0F13684g2.473ON5714713813e-38
ZYRO0G21868gna 2ON6205573763e-37
KNAG0E025602.473ON5784953726e-37
Kpol_467.242.473ON3703533512e-35
Kwal_26.77552.473ON5594863592e-35
TPHA0G031502.473ON6004833576e-35
ZYRO0G03234g2.473ON5624653532e-34
ZYRO0A00330gsingletonON5765153241e-30
ZYRO0G21890gsingletonON5764613222e-30
YBR293W (VBA2)na 3ON4744323121e-29
Smik_2.434na 3ON4744343068e-29
ABL040W2.473ON5674672911e-26
NDAI0J012808.272ON6947132885e-26
KLTH0B00132gsingletonON5684512601e-22
KLTH0B10142gsingletonON5684992563e-22
YKR105C (VBA5)singletonON5824662474e-21
KLTH0D16962gsingletonON5713382465e-21
Kwal_14.728singletonON5684602403e-20
KLTH0C10120gsingletonON6511642305e-19
Kwal_26.9616singletonON5623342224e-18
SAKL0A00726gsingletonON5981622234e-18
SAKL0F00198gsingletonON5371912215e-18
SAKL0B12716gsingletonON6321912208e-18
SAKL0C05588gsingletonON6771622191e-17
KLTH0C10142gsingletonON5731492163e-17
Skud_7.560na 4ON6424722153e-17
TDEL0G03260singletonON6125632145e-17
YPR198W (SGE1)singletonON5435192127e-17
KLLA0D19941gsingletonON6114762082e-16
CAGL0B02079gna 4ON6241792055e-16
Smik_17.11singletonON5441492002e-15
Smik_16.81na 4ON6251642002e-15
Skud_16.503singletonON5435201983e-15
KNAG0K01020singletonON5995261913e-14
KLLA0E09879gsingletonON6305701903e-14
Skud_18.3singletonON5904931895e-14
Smik_11.368singletonON5805451879e-14
NCAS0C03460na 4ON6301661842e-13
KLTH0B00594gsingletonON6181491842e-13
SAKL0A08228gsingletonON5691491832e-13
YGR224W (AZR1)na 4ON6131491753e-12
Skud_6.14singletonON6365621701e-11
Suva_10.9singletonON6375611682e-11
Smik_6.22singletonON6364871601e-10
KLTH0B00110gsingletonON6274371521e-09
Kwal_56.22298singletonON6105011305e-07
Kpol_1053.243.84ON6201631305e-07
KNAG0J02980singletonON6364471306e-07
TPHA0A006203.84ON6342091306e-07
KAFR0B039408.843ON5473401297e-07
KLTH0D18150gsingletonON6074991281e-06
KLLA0A10439gsingletonON6344611271e-06
ZYRO0G07414gsingletonON7074521262e-06
TDEL0B019008.446ON6871261262e-06
NCAS0C047603.84ON6071421262e-06
KNAG0H031808.272ON677891252e-06
TDEL0B005508.843ON5374711252e-06
Kwal_14.722singletonON6115731243e-06
KLTH0C09372g3.84ON6081041234e-06
CAGL0I07447g3.84ON5701051234e-06
KLLA0C12309g3.84ON5691041234e-06
CAGL0E04092gna 5ON6454991225e-06
Suva_15.623.84ON609691225e-06
SAKL0F00792gsingletonON6174761225e-06
YOL103W (ITR2)3.84ON609691216e-06
Smik_15.543.84ON611691217e-06
Skud_15.513.84ON587691208e-06
SAKL0C09350g3.84ON5781051209e-06
KAFR0C014803.84ON577691209e-06
AFR343C3.84ON5711511209e-06
SAKL0H12518g8.446ON7301261182e-05
Skud_18.6singletonON6104591182e-05
TBLA0F00470singletonON7321291172e-05
TBLA0B083103.84ON6381271172e-05
Suva_26.1singletonON5343051163e-05
NCAS0I025203.84ON5871261163e-05
NDAI0A071103.84ON602691153e-05
KLTH0G18854g8.22ON502711154e-05
KLTH0H16214gsingletonON5512391144e-05
SAKL0C11066gsingletonON580681145e-05
Smik_6.24na 6ON5442481135e-05
KNAG0K006303.84ON6181281145e-05
Suva_10.11singletonON5402181137e-05
Kwal_27.116388.446ON7231261137e-05
TBLA0A08520singletonON6321331137e-05
YCL069W (VBA3)singletonON4583791111e-04
TBLA0C01040singletonON6694581111e-04
SAKL0G06600gsingletonON6294981111e-04
KLLA0C00220gsingletonON6245021111e-04
NCAS0C057804.30ON5671331101e-04
CAGL0E03674g4.30ON5771071101e-04
KAFR0F043904.30ON5671071092e-04
KLLA0A03223g8.446ON6771271102e-04
YHL040C (ARN1)na 5ON6274451092e-04
KAFR0G00160singletonON636701092e-04
Skud_6.16na 6ON5492491092e-04
TPHA0C047908.843ON5562981092e-04
KLTH0D00506gsingletonON6162871092e-04
KLTH0E10406g8.446ON7331261092e-04
KAFR0B054508.272ON625841092e-04
ZYRO0B00990g4.30ON5921191082e-04
Kpol_513.33singletonON6262421082e-04
NDAI0D048404.30ON6391301082e-04
TDEL0H01600singletonON6041521083e-04
YKR106W (GEX2)singletonON6152791073e-04
KLLA0C19272gsingletonON6232971073e-04
Kpol_1003.112.241ON5811361073e-04
TBLA0E01970singletonON578691073e-04
TDEL0G05000singletonON1861141023e-04
YDR497C (ITR1)3.84ON5841051074e-04
CAGL0G03927g4.30ON5671321064e-04
KAFR0I01560singletonON6324591064e-04
TDEL0D06610singletonON4971111054e-04
NDAI0D05020singletonON573711064e-04
TPHA0B00180singletonON6331131056e-04
Suva_8.12na 5ON6331121056e-04
TDEL0C00150singletonON5261441047e-04
TPHA0B039001.432ON554721047e-04
Smik_8.1na 5ON6271121047e-04
YCL073C (GEX1)singletonON6152811047e-04
YDL194W (SNF3)7.309ON8841301048e-04
TDEL0E022805.396ON587681048e-04
TBLA0A085304.30ON6151331048e-04
KLTH0G19404gsingletonON5131441038e-04
TBLA0A08515singletonON6321021048e-04
KAFR0E02030singletonON548891030.001
Kwal_56.227243.84ON578481030.001
KAFR0F04080singletonON549891030.001
YEL069C (HXT13)na 7ON564931030.001
KAFR0F02800singletonON551891030.001
SAKL0F00440gsingletonON544731030.001
YNR072W (HXT17)singletonON564931030.001
TDEL0A033305.469ON5491011030.001
TDEL0D054003.84ON585711030.001
TBLA0A03420singletonON577691020.001
YJL219W (HXT9)singletonON5671011020.001
YJR158W (HXT16)singletonON567921020.001
YDL245C (HXT15)singletonON567921020.001
TBLA0F01600singletonON567891020.001
NDAI0D05010singletonON574701020.001
Kwal_23.2794singletonON6191211020.001
KNAG0E04270singletonON557901020.001
Kwal_56.24841singletonON5111161010.001
ZYRO0A09878g8.446ON6821261020.001
Skud_5.24na 8ON6271261010.002
KNAG0I00110singletonON563901010.002
KLTH0D00484gsingletonON5131461010.002
KAFR0E036505.469ON4981101000.002
Kwal_26.7984na 9ON6121321010.002
Skud_4.5singletonON573791000.002
Skud_4.7713.84ON584691000.002
Smik_4.418.446ON687581000.002
Suva_13.4678.843ON543151990.003
Skud_13.258.843ON53767990.003
NCAS0B037808.272ON589243990.003
TDEL0B039906.155ON481100990.003
Suva_4.547.309ON8901301000.003
Kpol_281.31.432ON55677990.003
YHL047C (ARN2)singletonON620140990.003
TBLA0A03700singletonON57269990.003
KAFR0J009302.242ON566123990.003
KAFR0D00750singletonON55789990.003
TBLA0A03500singletonON57369990.003
Skud_8.3na 5ON631113990.003
Skud_14.406na 10ON564181990.003
Ecym_23175.469ON557105980.003
Skud_4.588.446ON68750990.003
YEL065W (SIT1)na 8ON628126980.003
Smik_4.7743.84ON58469980.004
KAFR0C02660singletonON591164980.004
Suva_13.278.843ON55369980.004
NCAS0I03160singletonON57571970.004
Smik_5.22na 8ON628126970.004
AEL042C1.432ON54771970.005
KAFR0B03930singletonON555238970.005
Kpol_543.55.469ON566101970.005
Smik_14.401na 10ON63692970.006
YDL199C8.446ON68749970.006
KNAG0D05370singletonON45670960.006
TBLA0A03480singletonON57469960.006
Smik_5.19na 7ON56792960.006
Smik_4.467.309ON881130960.006
TPHA0J027405.469ON574107960.006
Suva_4.498.446ON68750960.006
TBLA0D03280singletonON58091960.007
YML116W (ATR1)8.843ON54269960.007
TBLA0A04910singletonON575156960.007
TBLA0B00840singletonON63769960.007
KAFR0D00790singletonON56178960.007
Kpol_541.168.843ON528236960.007
KAFR0I014004.30ON589133960.007
KLTH0D06710gna 9ON611142960.007
SAKL0E06864gna 11ON573157950.007
Skud_4.647.309ON884130960.008
Skud_6.61na 12ON54679950.008
NDAI0I02650na 8ON638131950.008
TDEL0F016704.30ON582130950.008
YOL156W (HXT11)singletonON56796950.008
KLLA0C18931gna 13ON55399950.009
KAFR0D00800singletonON55879950.009
NDAI0H00140na 5ON632112950.009
KLTH0A01562gna 14ON615469950.009
SAKL0D01386g8.843ON521289940.009
Suva_2.6743.84ON57969940.010
Skud_96.1singletonON20896910.010
TBLA0J00100singletonON574156940.010
Skud_13.163na 15ON54779940.011
TBLA0A03430singletonON56469940.011
KAFR0D00740singletonON56870940.011
CAGL0M01672g5.469ON54765940.012
TPHA0O009501.432ON55967940.012
KLLA0B00352gna 16ON498401930.012
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR076C
         (686 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...  1291   0.0  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   639   0.0  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   610   0.0  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   600   0.0  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   595   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   591   0.0  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   575   0.0  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   571   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   562   0.0  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   555   0.0  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   528   e-176
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   495   e-168
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   318   1e-99
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   318   1e-99
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   298   8e-92
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   199   1e-53
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   184   9e-49
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...   183   2e-48
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   181   2e-47
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   174   5e-46
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   172   2e-45
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   168   3e-44
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   168   4e-44
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   166   2e-43
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   162   6e-42
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   162   1e-41
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   161   1e-41
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   161   1e-41
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   160   3e-41
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   159   6e-41
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   157   2e-40
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        157   2e-40
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   156   4e-40
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   155   2e-39
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   154   3e-39
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...   153   7e-39
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...   152   1e-38
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...   151   3e-38
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   151   3e-38
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...   149   3e-37
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   147   6e-37
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   139   2e-35
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...   142   2e-35
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   142   6e-35
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   140   2e-34
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   129   1e-30
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...   128   2e-30
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...   124   1e-29
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   122   8e-29
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...   116   1e-26
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....   115   5e-26
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...   104   1e-22
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...   103   3e-22
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...   100   4e-21
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    99   5e-21
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    97   3e-20
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    93   5e-19
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    90   4e-18
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    91   4e-18
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    90   5e-18
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    89   8e-18
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    89   1e-17
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    88   3e-17
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    87   3e-17
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               87   5e-17
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    86   7e-17
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    85   2e-16
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    84   5e-16
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    82   2e-15
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    82   2e-15
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    81   3e-15
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    78   3e-14
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    78   3e-14
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    77   5e-14
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    77   9e-14
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    75   2e-13
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    75   2e-13
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    75   2e-13
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    72   3e-12
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    70   1e-11
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    69   2e-11
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    66   1e-10
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    63   1e-09
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    55   5e-07
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    55   5e-07
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              55   6e-07
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    55   6e-07
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    54   7e-07
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    54   1e-06
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    54   1e-06
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    53   2e-06
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    53   2e-06
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      53   2e-06
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    53   2e-06
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    53   2e-06
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    52   3e-06
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    52   4e-06
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    52   4e-06
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    52   4e-06
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    52   5e-06
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    52   5e-06
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    52   5e-06
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    51   6e-06
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    51   7e-06
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    51   8e-06
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    51   9e-06
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    51   9e-06
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    51   9e-06
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...    50   2e-05
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    50   2e-05
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               50   2e-05
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    50   2e-05
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        49   3e-05
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    49   3e-05
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    49   3e-05
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...    49   4e-05
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    49   4e-05
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    49   5e-05
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    48   5e-05
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    49   5e-05
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    48   7e-05
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    48   7e-05
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             48   7e-05
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    47   1e-04
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               47   1e-04
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    47   1e-04
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    47   1e-04
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    47   1e-04
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    47   1e-04
KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.3...    47   2e-04
KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} simila...    47   2e-04
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    47   2e-04
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 47   2e-04
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    47   2e-04
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    47   2e-04
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    47   2e-04
KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly...    47   2e-04
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    47   2e-04
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    46   2e-04
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    46   2e-04
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    46   2e-04
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    46   3e-04
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    46   3e-04
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    46   3e-04
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    46   3e-04
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    46   3e-04
TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON}                44   3e-04
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    46   4e-04
CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {...    45   4e-04
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      45   4e-04
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    45   4e-04
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    45   4e-04
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       45   6e-04
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    45   6e-04
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                 45   7e-04
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     45   7e-04
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    45   7e-04
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    45   7e-04
YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma...    45   8e-04
TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.3...    45   8e-04
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    45   8e-04
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...    44   8e-04
TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possi...    45   8e-04
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               44   0.001
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    44   0.001
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    44   0.001
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    44   0.001
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               44   0.001
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    44   0.001
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    44   0.001
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    44   0.001
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    44   0.001
TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON}               44   0.001
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...    44   0.001
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    44   0.001
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    44   0.001
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    44   0.001
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    44   0.001
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    44   0.001
KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON}               44   0.001
Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]...    44   0.001
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    44   0.001
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    44   0.002
KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON}         44   0.002
KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON...    44   0.002
KAFR0E03650 Chr5 (733164..734660) [1497 bp, 498 aa] {ON} Anc_5.4...    43   0.002
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    44   0.002
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    43   0.002
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    43   0.002
Smik_4.41 Chr4 complement(79517..81580) [2064 bp, 687 aa] {ON} Y...    43   0.002
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    43   0.003
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    43   0.003
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    43   0.003
TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.1...    43   0.003
Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W (R...    43   0.003
Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON} c...    43   0.003
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    43   0.003
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               43   0.003
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    43   0.003
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    43   0.003
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    43   0.003
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    43   0.003
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    43   0.003
Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar t...    42   0.003
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    43   0.003
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    42   0.003
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    42   0.004
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}               42   0.004
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    42   0.004
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}               42   0.004
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    42   0.004
AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON} S...    42   0.005
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...    42   0.005
Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON} ...    42   0.005
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    42   0.006
YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON} P...    42   0.006
KNAG0D05370 Chr4 (984855..986225) [1371 bp, 456 aa] {ON}               42   0.006
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               42   0.006
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    42   0.006
Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)    42   0.006
TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {...    42   0.006
Suva_4.49 Chr4 complement(89704..91767) [2064 bp, 687 aa] {ON} Y...    42   0.006
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    42   0.007
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    42   0.007
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    42   0.007
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    42   0.007
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               42   0.007
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    42   0.007
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    42   0.007
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    42   0.007
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    41   0.007
Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W (...    42   0.008
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    41   0.008
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               41   0.008
TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {O...    41   0.008
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...    41   0.008
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    41   0.009
KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {O...    41   0.009
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       41   0.009
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    41   0.009
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    41   0.009
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    41   0.010
Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)          40   0.010
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        41   0.010
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    41   0.011
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    41   0.011
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...    41   0.011
CAGL0M01672g Chr13 (186088..187731) [1644 bp, 547 aa] {ON} simil...    41   0.012
TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {...    41   0.012
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    40   0.012
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    41   0.012
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     40   0.013
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    40   0.013
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    40   0.014
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    40   0.014
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    40   0.015
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    40   0.015
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    40   0.015
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...    40   0.015
ZYRO0E03916g Chr5 complement(296502..298217) [1716 bp, 571 aa] {...    40   0.016
Kwal_33.12950 s33 complement(12899..14599) [1701 bp, 566 aa] {ON...    40   0.016
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       40   0.017
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...    40   0.017
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    40   0.017
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    40   0.017
NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {O...    40   0.017
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     40   0.018
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       40   0.018
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    40   0.018
TBLA0A03410 Chr1 complement(815181..816950) [1770 bp, 589 aa] {O...    40   0.019
TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON}             40   0.019
KNAG0B06940 Chr2 (1377486..1379168) [1683 bp, 560 aa] {ON}             40   0.019
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    40   0.020
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    40   0.020
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    40   0.020
KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.3...    40   0.020
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    40   0.020
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    40   0.021
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                40   0.021
TDEL0C00450 Chr3 (65197..66762) [1566 bp, 521 aa] {ON} Anc_8.22 ...    40   0.022
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...    40   0.026
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    40   0.026
Kwal_27.9678 s27 complement(14940..16481) [1542 bp, 513 aa] {ON}...    40   0.026
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    39   0.027
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    39   0.028
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               39   0.028
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    39   0.029
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    39   0.029
KLTH0H00308g Chr8 (28695..30227) [1533 bp, 510 aa] {ON} weakly s...    39   0.029
TDEL0E00120 Chr5 (7519..9231) [1713 bp, 570 aa] {ON}                   39   0.029
NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155     39   0.030
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    39   0.031
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    39   0.031
Smik_113.1 Chr113 complement(3..554) [552 bp, 184 aa] {ON} YOL15...    38   0.031
KAFR0C03590 Chr3 complement(734372..735910) [1539 bp, 512 aa] {O...    39   0.032
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    38   0.033
TDEL0E02300 Chr5 (447834..449537) [1704 bp, 567 aa] {ON}  YIL170W      39   0.035
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    39   0.035
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    39   0.036
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    39   0.037
TDEL0A00420 Chr1 complement(75025..76554) [1530 bp, 509 aa] {ON}...    39   0.038
ZYRO0D17864g Chr4 (1481311..1483047) [1737 bp, 578 aa] {ON} some...    39   0.038
SAKL0D10450g Chr4 (875475..877151) [1677 bp, 558 aa] {ON} highly...    39   0.038
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               39   0.042
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     39   0.044
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    39   0.044
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    39   0.044
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    39   0.045
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    39   0.045
Kwal_27.12811 s27 (1383808..1384353) [546 bp, 181 aa] {ON} YDL13...    37   0.046
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    39   0.047
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      39   0.048
KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.3...    39   0.051
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               39   0.054
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    39   0.054
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    39   0.055
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    39   0.056
YLR081W Chr12 (290212..291936) [1725 bp, 574 aa] {ON}  GAL2Galac...    39   0.056
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...    39   0.057
Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536...    39   0.059
Ecym_3420 Chr3 (792244..793902) [1659 bp, 552 aa] {ON} similar t...    39   0.060
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    39   0.061
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             39   0.062
KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON...    39   0.064
Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}...    38   0.066
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    38   0.068
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    38   0.071
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    38   0.071
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    38   0.072
YNL318C Chr14 complement(38707..40329) [1623 bp, 540 aa] {ON}  H...    38   0.073
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    38   0.075
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    38   0.076
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    38   0.077
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    38   0.079
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    38   0.081
TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON} Anc_5...    38   0.082
Ecym_1345 Chr1 (711048..712715) [1668 bp, 555 aa] {ON} similar t...    38   0.085
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    38   0.086
Kpol_281.2 s281 complement(3711..5390) [1680 bp, 559 aa] {ON} co...    38   0.088
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    38   0.088
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    38   0.090
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    38   0.090
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     38   0.091
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    38   0.091
Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}...    38   0.092
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...    38   0.094
KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} simila...    38   0.097
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...    38   0.10 
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    38   0.10 
SAKL0B00946g Chr2 (87829..89412) [1584 bp, 527 aa] {ON} similar ...    38   0.10 
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    38   0.10 
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    38   0.11 
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    37   0.12 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    37   0.12 
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    37   0.12 
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    37   0.12 
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    37   0.12 
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    37   0.12 
Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W (...    37   0.12 
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    37   0.12 
ZYRO0E03410g Chr5 complement(268553..270388) [1836 bp, 611 aa] {...    37   0.13 
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    37   0.14 
Smik_14.13 Chr14 complement(23204..24826) [1623 bp, 540 aa] {ON}...    37   0.14 
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}             37   0.14 
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    37   0.14 
Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W...    37   0.14 
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    37   0.14 
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             37   0.14 
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...    37   0.14 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    37   0.15 
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    37   0.15 
KLLA0E01783g Chr5 (171319..173037) [1719 bp, 572 aa] {ON} simila...    37   0.15 
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    37   0.16 
SAKL0F02178g Chr6 complement(187479..189050) [1572 bp, 523 aa] {...    37   0.16 
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...    37   0.16 
Kwal_34.16190 s34 complement(239113..240783) [1671 bp, 556 aa] {...    37   0.16 
SAKL0G03432g Chr7 complement(282042..283655) [1614 bp, 537 aa] {...    37   0.16 
Skud_12.38 Chr12 (75867..77630) [1764 bp, 587 aa] {ON} YLL028W (...    37   0.17 
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              37   0.18 
Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028...    37   0.18 
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    37   0.18 
TBLA0C01090 Chr3 (223890..226874) [2985 bp, 994 aa] {ON}               37   0.19 
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    37   0.19 
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    37   0.19 
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    37   0.19 
Kwal_14.1105 s14 (197347..198915) [1569 bp, 522 aa] {ON} YFL040W...    37   0.20 
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    37   0.20 
Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536...    37   0.20 
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    37   0.20 
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    37   0.20 
Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W (...    36   0.20 
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...    36   0.21 
Skud_14.21 Chr14 complement(32206..33831) [1626 bp, 541 aa] {ON}...    37   0.21 
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    37   0.22 
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    37   0.23 
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    37   0.23 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    37   0.24 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    37   0.25 
KLTH0H13728g Chr8 (1199825..1201510) [1686 bp, 561 aa] {ON} simi...    36   0.26 
Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W (...    36   0.26 
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...    36   0.26 
NDAI0A04360 Chr1 (981092..982726) [1635 bp, 544 aa] {ON} Anc_5.469     36   0.27 
KNAG0C03990 Chr3 (786172..788541) [2370 bp, 789 aa] {ON} Anc_7.3...    37   0.27 
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    36   0.27 
TDEL0A00150 Chr1 (24714..26414) [1701 bp, 566 aa] {ON}                 36   0.27 
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    36   0.27 
YDR536W Chr4 (1508005..1509714) [1710 bp, 569 aa] {ON}  STL1Glyc...    36   0.28 
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    36   0.28 
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         36   0.28 
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             36   0.29 
SAKL0A06050g Chr1 (548837..550408) [1572 bp, 523 aa] {ON} simila...    36   0.29 
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...    36   0.30 
KLTH0A06336g Chr1 (528991..530520) [1530 bp, 509 aa] {ON} highly...    36   0.30 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    36   0.30 
SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} high...    36   0.31 
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    36   0.32 
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    36   0.33 
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    36   0.34 
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...    36   0.34 
TPHA0N01090 Chr14 (227811..229274) [1464 bp, 487 aa] {ON} Anc_6....    36   0.35 
KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {O...    36   0.35 
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    36   0.36 
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    36   0.36 
Suva_8.322 Chr8 complement(573995..575953) [1959 bp, 652 aa] {ON...    36   0.36 
Smik_12.27 Chr12 (69102..70865) [1764 bp, 587 aa] {ON} YLL028W (...    36   0.37 
YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON} ...    36   0.37 
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    36   0.37 
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               36   0.38 
Kpol_1057.20 s1057 (38011..39723) [1713 bp, 570 aa] {ON} (38011....    36   0.38 
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    36   0.39 
NCAS0A08630 Chr1 complement(1704322..1706103) [1782 bp, 593 aa] ...    36   0.39 
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...    36   0.40 
KLLA0F06853g Chr6 (656373..657959) [1587 bp, 528 aa] {ON} simila...    36   0.40 
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    36   0.41 
Suva_8.420 Chr8 (755472..757112) [1641 bp, 546 aa] {ON} YBR008C ...    36   0.41 
TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa] ...    36   0.44 
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               36   0.44 
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843       35   0.45 
Suva_14.21 Chr14 complement(34919..36544) [1626 bp, 541 aa] {ON}...    35   0.45 
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    35   0.47 
Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081...    35   0.48 
KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} simi...    35   0.48 
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...    35   0.49 
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    35   0.49 
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    35   0.50 
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    35   0.50 
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    35   0.51 
KLLA0A11110g Chr1 (964084..965739) [1656 bp, 551 aa] {ON} unipro...    35   0.51 
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...    35   0.52 
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    35   0.55 
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    35   0.59 
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     35   0.60 
Smik_8.172 Chr8 complement(267609..269321) [1713 bp, 570 aa] {ON...    35   0.60 
ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {...    35   0.61 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    35   0.61 
NCAS0E01350 Chr5 complement(261125..262696) [1572 bp, 523 aa] {O...    35   0.64 
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    35   0.64 
Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON} (61814..6...    35   0.64 
NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}...    35   0.65 
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    35   0.68 
Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {...    35   0.68 
ZYRO0E10054g Chr5 complement(804765..806651) [1887 bp, 628 aa] {...    35   0.70 
ADR139C Chr4 complement(950169..951845) [1677 bp, 558 aa] {ON} N...    35   0.70 
AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON} N...    35   0.71 
KLTH0D12320g Chr4 complement(1001954..1003720) [1767 bp, 588 aa]...    35   0.72 
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    35   0.72 
KLLA0F26246g Chr6 (2432209..2433960) [1752 bp, 583 aa] {ON} high...    35   0.75 
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    35   0.75 
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...    35   0.75 
YHR094C Chr8 complement(290913..292625) [1713 bp, 570 aa] {ON}  ...    35   0.76 
TBLA0C00430 Chr3 (79303..81042) [1740 bp, 579 aa] {ON} Anc_8.22 ...    35   0.78 
NCAS0A11910 Chr1 complement(2361519..2363180) [1662 bp, 553 aa] ...    35   0.78 
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    35   0.78 
TBLA0A07710 Chr1 complement(1905062..1906672) [1611 bp, 536 aa] ...    35   0.83 
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    35   0.83 
KAFR0A04120 Chr1 complement(828182..829957) [1776 bp, 591 aa] {O...    35   0.84 
YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putat...    35   0.90 
Kpol_1059.39 s1059 (87634..89325) [1692 bp, 563 aa] {ON} (87634....    35   0.93 
Suva_7.163 Chr7 complement(303502..304992) [1491 bp, 496 aa] {ON...    35   0.95 
SAKL0B12540g Chr2 complement(1075772..1077490) [1719 bp, 572 aa]...    35   0.95 
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    35   0.96 
TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {...    35   0.98 
YDR387C Chr4 complement(1248154..1249821) [1668 bp, 555 aa] {ON}...    35   0.98 
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...    35   1.0  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    34   1.0  
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    34   1.1  
CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} simila...    34   1.1  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       34   1.1  
Skud_15.438 Chr15 complement(773226..775205) [1980 bp, 659 aa] {...    34   1.1  
Kpol_1023.17 s1023 (34188..35789) [1602 bp, 533 aa] {ON} (34188....    34   1.1  
SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar ...    34   1.2  
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    34   1.3  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    34   1.3  
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    34   1.3  
SAKL0G18810g Chr7 complement(1624866..1626581) [1716 bp, 571 aa]...    34   1.4  
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    34   1.4  
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    34   1.4  
KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON}               34   1.4  
TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {O...    34   1.4  
YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyami...    34   1.5  
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    34   1.5  
CAGL0H06039g Chr8 complement(592526..594295) [1770 bp, 589 aa] {...    34   1.5  
NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa] ...    34   1.6  
TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON}       34   1.7  
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    34   1.7  
KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON...    34   1.7  
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               34   1.7  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    34   1.8  
CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {...    33   1.8  
NCAS0E03210 Chr5 complement(637282..638961) [1680 bp, 559 aa] {O...    33   1.8  
TBLA0D01160 Chr4 (296153..298081) [1929 bp, 642 aa] {ON} Anc_8.7...    33   1.9  
AFR602W Chr6 (1523461..1525137) [1677 bp, 558 aa] {ON} Non-synte...    33   1.9  
TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.3...    33   2.0  
Kpol_365.10 s365 complement(21800..23701) [1902 bp, 633 aa] {ON}...    33   2.0  
TDEL0A04250 Chr1 (756579..758300) [1722 bp, 573 aa] {ON}  YBR298C      33   2.0  
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       33   2.0  
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    33   2.1  
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               33   2.2  
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             33   2.2  
TPHA0N01930 Chr14 (410871..412556) [1686 bp, 561 aa] {ON}              33   2.2  
CAGL0A04323g Chr1 (429121..429771) [651 bp, 216 aa] {ON} similar...    33   2.3  
NCAS0G03970 Chr7 (735897..737729) [1833 bp, 610 aa] {ON} Anc_1.4...    33   2.3  
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    33   2.3  
KNAG0E03090 Chr5 (616710..618212) [1503 bp, 500 aa] {ON} Anc_8.2...    33   2.3  
Suva_10.165 Chr10 (295189..296898) [1710 bp, 569 aa] {ON} YEL069...    33   2.3  
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               33   2.3  
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    33   2.4  
Kwal_56.24469 s56 complement(1008164..1010293) [2130 bp, 709 aa]...    33   2.4  
ABR223C Chr2 complement(820634..822508) [1875 bp, 624 aa] {ON} S...    33   2.4  
Skud_8.156 Chr8 complement(264872..264913,264917..265015,265033....    33   2.5  
Skud_8.155 Chr8 complement(264872..264913,264917..265015,265033....    33   2.5  
Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON} (2010...    33   2.6  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    33   2.7  
TPHA0H01570 Chr8 complement(354813..356744) [1932 bp, 643 aa] {O...    33   2.8  
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    33   2.8  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...    33   2.8  
NCAS0A03030 Chr1 complement(593557..595281) [1725 bp, 574 aa] {O...    33   2.9  
ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]...    33   2.9  
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    33   3.1  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                33   3.2  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    33   3.3  
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     33   3.4  
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    33   3.4  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843       33   3.5  
Smik_4.97 Chr4 (189933..192236) [2304 bp, 767 aa] {ON} YDL138W (...    33   3.8  
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    33   3.9  
Kwal_23.6233 s23 (1500534..1501562) [1029 bp, 342 aa] {ON} YCR05...    32   3.9  
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    33   3.9  
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    33   3.9  
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    32   4.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    32   4.2  
KLLA0E03037g Chr5 complement(278965..280587) [1623 bp, 540 aa] {...    32   4.2  
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    32   4.2  
Smik_11.6 Chr11 (6316..8166) [1851 bp, 616 aa] {ON} YKL217W (REAL)     32   4.3  
KAFR0A08520 Chr1 (1708192..1709877) [1686 bp, 561 aa] {ON} Anc_3...    32   4.3  
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    32   4.3  
YDL138W Chr4 (213351..215642) [2292 bp, 763 aa] {ON}  RGT2Plasma...    32   4.4  
Kpol_1049.20 s1049 (47753..49456) [1704 bp, 567 aa] {ON} (47753....    32   4.5  
Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W ...    32   4.6  
KAFR0L01310 Chr12 complement(241337..243691) [2355 bp, 784 aa] {...    32   4.8  
Smik_4.657 Chr4 complement(1168668..1170332) [1665 bp, 554 aa] {...    32   4.8  
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    32   4.9  
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    32   5.0  
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    32   5.1  
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    32   5.1  
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    32   5.4  
Kpol_1019.31 s1019 (61016..63517) [2502 bp, 833 aa] {ON} (61016....    32   5.4  
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               32   5.5  
ZYRO0E09900g Chr5 (786545..788164) [1620 bp, 539 aa] {ON} simila...    32   5.5  
TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {O...    32   5.8  
KLLA0E16259g Chr5 complement(1450546..1452348) [1803 bp, 600 aa]...    32   5.9  
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    32   5.9  
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    32   6.1  
TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.7...    32   6.2  
CAGL0A01782g Chr1 complement(175018..176724) [1707 bp, 568 aa] {...    32   6.3  
Suva_15.290 Chr15 complement(493441..495144) [1704 bp, 567 aa] {...    32   6.4  
ZYRO0B16808g Chr2 (1368857..1370446) [1590 bp, 529 aa] {ON} simi...    32   6.5  
Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {O...    32   6.7  
CAGL0H06017g Chr8 complement(588556..590229) [1674 bp, 557 aa] {...    32   6.7  
SAKL0F15422g Chr6 complement(1242050..1243387) [1338 bp, 445 aa]...    32   6.7  
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    32   6.8  
ZYRO0F02090g Chr6 complement(169045..170850) [1806 bp, 601 aa] {...    32   6.9  
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    32   7.2  
NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON...    32   7.2  
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    32   7.2  
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    32   7.3  
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    32   7.4  
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    32   7.5  
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    32   7.6  
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    32   7.6  
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    32   7.7  
ZYRO0E09988g Chr5 (796142..797788) [1647 bp, 548 aa] {ON} simila...    32   7.8  
TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa] ...    32   8.1  
ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} simi...    32   8.2  
Skud_4.660 Chr4 complement(1168794..1170461) [1668 bp, 555 aa] {...    32   8.2  
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    32   8.5  
KLLA0B07227g Chr2 complement(627833..629695) [1863 bp, 620 aa] {...    32   8.5  
KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON}      32   8.5  
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    32   8.6  
KLLA0F05181g Chr6 (510384..512747) [2364 bp, 787 aa] {ON} unipro...    32   8.7  
SAKL0D10131g Chr4 complement(846993..848705) [1713 bp, 570 aa] {...    32   8.8  
Ecym_2262 Chr2 (515606..517051) [1446 bp, 481 aa] {ON} similar t...    31   9.0  
Suva_2.562 Chr2 complement(999213..1000880) [1668 bp, 555 aa] {O...    32   9.1  
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    32   9.1  
YGL104C Chr7 complement(308713..310173) [1461 bp, 486 aa] {ON}  ...    31   9.6  
Suva_14.215 Chr14 complement(386700..388712) [2013 bp, 670 aa] {...    31   9.8  
TPHA0P00120 Chr16 complement(23525..25201) [1677 bp, 558 aa] {ON...    31   9.9  

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 1291 bits (3340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/686 (92%), Positives = 637/686 (92%)

Query: 1   MGKRRKGLKTKQRDRLREFAKRKERQRALAGQNQAGVGQDXXXXXXXXXXXXGEQSGLLE 60
           MGKRRKGLKTKQRDRLREFAKRKERQRALAGQNQAGVGQD            GEQSGLLE
Sbjct: 1   MGKRRKGLKTKQRDRLREFAKRKERQRALAGQNQAGVGQDAQPARRQHRPRAGEQSGLLE 60

Query: 61  ASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQKPTEVYLT 120
           ASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMAT         TQKPTEVYLT
Sbjct: 61  ASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATSGSGSSYGSTQKPTEVYLT 120

Query: 121 ATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWI 180
           ATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWI
Sbjct: 121 ATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWI 180

Query: 181 ATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGI 240
           ATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGI
Sbjct: 181 ATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGI 240

Query: 241 GGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLV 300
           GGGGLTSMCSITTTDIVPLRSRALYQGICNVFF             FADRAVGWRMAFLV
Sbjct: 241 GGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFADRAVGWRMAFLV 300

Query: 301 QVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLV 360
           QVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLV
Sbjct: 301 QVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLV 360

Query: 361 CSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMM 420
           CSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMM
Sbjct: 361 CSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMM 420

Query: 421 GMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC 480
           GMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC
Sbjct: 421 GMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC 480

Query: 481 LVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSIS 540
           LVGVLGQVQISYVTPSISTWRQYCLYMIPGFGS               PQRHQAATTSIS
Sbjct: 481 LVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSAVLLTVTLLALIVAVPQRHQAATTSIS 540

Query: 541 YAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHK 600
           YAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHK
Sbjct: 541 YAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHK 600

Query: 601 EAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHAGNTAPRPQRERTLN 660
           EAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHAGNTAPRPQRERTLN
Sbjct: 601 EAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHAGNTAPRPQRERTLN 660

Query: 661 LSTLFVPKDYILIINVFTYSLYAPHF 686
           LSTLFVPKDYILIINVFTYSLYAPHF
Sbjct: 661 LSTLFVPKDYILIINVFTYSLYAPHF 686

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/646 (52%), Positives = 425/646 (65%), Gaps = 14/646 (2%)

Query: 4   RRKGLKTKQRDRLREFAKRKERQRALAGQNQAGVGQDXXXXXXXXXXXXGEQSGLLEASR 63
           R+K  K KQR +L+ F K KERQR L       V Q              E +  L+  R
Sbjct: 3   RKKNSKNKQRKKLQAFVKLKERQRQLLNDEPKVVIQQNPAHSIEPT----ETTPFLQPIR 58

Query: 64  GTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQKPTEVYLTATA 123
             LV DP+S L G VA ELE Q +         ++ A+               + L  ++
Sbjct: 59  RELVLDPTSDLPGFVAGELEEQEE----RCAEEQTNASGYDSIKKNTVATAKTIDLETSS 114

Query: 124 VEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATA 183
           +EA  ++  GL   R +++M SM LG+FLA+LD TIV+TLL HIASEFNE+P ISWIATA
Sbjct: 115 IEA--KNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATA 172

Query: 184 YLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGG 243
           YLLSSATFQPLYGK+SDIFGR+PLL+FSN++F LG LICG+S  LW LV GRF+AGIGGG
Sbjct: 173 YLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIAGIGGG 232

Query: 244 GLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVP 303
           GLTSM SITT+DIVPLR+RALYQGICN FF             F++   GWR+AFL+Q+P
Sbjct: 233 GLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWRVAFLIQIP 292

Query: 304 LTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSL 363
           L  +S + I  +L LPK               + KLR +DW G ++LVVFL  F L  SL
Sbjct: 293 LCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFGALSLVVFLLLFMLASSL 352

Query: 364 YGEDLPH----LYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCM 419
            G++LP      Y + V I++ G+ F+Y E YV+ DPILP+ FL+NR++L +SL+NWF M
Sbjct: 353 GGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLANWFSM 412

Query: 420 MGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAF 479
           MGMMTT +++PVY+A VLNM PTD+GKR +PSFFSTA GSLGAGYYMK+TGKY W L+AF
Sbjct: 413 MGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKWLLMAF 472

Query: 480 CLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSI 539
           C + V+GQ+QIS + P+I+ WRQY L +IPGFG                P  HQAATTSI
Sbjct: 473 CALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSI 532

Query: 540 SYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVH 599
           SYAFRSTG TLGVSIGGAIFR  L + L   +M L S +HP  EL +II+ AAHS++++H
Sbjct: 533 SYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIH 592

Query: 600 KEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645
             APEF R  LI+ YH+A R T+ FCLA +  A ++C  + EYKLH
Sbjct: 593 DSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLH 638

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/597 (52%), Positives = 398/597 (66%), Gaps = 22/597 (3%)

Query: 53  GEQSGLLEASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQ 112
           GE++  L      ++ DPS+GL+G VA+E+E   QQ+  +    +S            + 
Sbjct: 4   GERTSFLAPIDKDVIQDPSTGLAGFVANEVE---QQDYNSRTGHDSYGATAVDDRTATSA 60

Query: 113 KPTEVYLTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFN 172
           +    +  +   E A      L ++R R++M SM LG+FLAALDGTIV+TLL  I SEFN
Sbjct: 61  RCDLTFPPSETPEFA------LSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFN 114

Query: 173 ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLV 232
            L ++SWIAT+YLLSS+T QPLYGKLSD  GR+PLLVFSN+VF +G LICGMS ++W +V
Sbjct: 115 SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVV 174

Query: 233 LGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAV 292
           +GRFV+GIGG GLT + S+  +D+VPLR RA+YQG+CN  F             F D   
Sbjct: 175 VGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD--- 231

Query: 293 GWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVV 352
            WRMAF +Q P++L S   I  +L LP     H+    R   WT+KLR +DW G VTLV 
Sbjct: 232 -WRMAFTIQCPISLASCALIVSYLELPP---RHEDDKDRH--WTSKLRDLDWAGVVTLVC 285

Query: 353 FLFCFTLVCSLYGEDLPHLYLIF----VVILLSGSYFIYHELYVATDPILPIRFLENRSV 408
           FLF F LV SL G+++ +  ++F    V  L+ GS F Y ELYVA DP+LPI FL+ RSV
Sbjct: 286 FLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSV 345

Query: 409 LAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKR 468
           L +SL+NWF MM M+TT +Y+PVY+ASVLNM PTDIGKR +PSFFS AFGSLGAG YMKR
Sbjct: 346 LGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKR 405

Query: 469 TGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXX 528
           TGKYYWFLLAFC +G+LGQ++I+ +TP+   W+QY L ++P FG                
Sbjct: 406 TGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAV 465

Query: 529 PQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRII 588
           P  H AATTSISYAFRSTG+TLGVSIG AIFR+ L+  L +K++   S EHP  ELLRII
Sbjct: 466 PHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRII 525

Query: 589 EKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645
             AAHS  WVHKEAPEF R  L++CYHYA + TF FCL  M+LA  +C  I E+ LH
Sbjct: 526 NNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLH 582

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/670 (48%), Positives = 421/670 (62%), Gaps = 48/670 (7%)

Query: 7   GLKTKQRDRLREFAKRKERQRALAGQNQAGVGQD-----------XXXXXXXXXXXXGEQ 55
           G K KQR +LR F K K +Q     ++Q  +  D                        ++
Sbjct: 2   GKKDKQRKKLRNFTKAKVKQ---VQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDE 58

Query: 56  SGLLEASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQKPT 115
           + +L   R  L+ DPS+ L G +A+E+E   Q+                           
Sbjct: 59  NSVLLPIRDELLQDPSTELPGFIAAEIEEGEQEYEETRSGHYG----------------- 101

Query: 116 EVYLTATAVEAAKEDAGG--LGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNE 173
                  A+E+ +  + G  L   R +++M SM LG+FLAALD TIV+TLL HIASEFNE
Sbjct: 102 -------AIESRRISSKGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNE 154

Query: 174 LPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVL 233
           LPRISW+ATAYLLSSATFQP+YGK+SDIFGR+ +L+F N+ F +G+LICG+S +   LV 
Sbjct: 155 LPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVA 214

Query: 234 GRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVG 293
           GRF+AGIGGGG+TSM SITT+DIVPLR+RALYQGICN +F             F+DR+VG
Sbjct: 215 GRFIAGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVG 274

Query: 294 WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRM--VDWTGTVTLV 351
           WRM+FL+Q+P+   ST  I LFL LPK           +   T K+R+  VDW G  TLV
Sbjct: 275 WRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLV 334

Query: 352 VFLFCFTLVCSLYGEDLPHLYLIF----VVILLSGSYFIYHELYVATDPILPIRFLENRS 407
           +FLF F +  SL G+++P+    F    VV ++    F Y EL +A DPILP+RFL++RS
Sbjct: 335 LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRS 394

Query: 408 VLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMK 467
           VL +SLSNWFCMM +MT  +Y+P+Y+A VLNM PTDIGKRI+P+FFSTAFGSLGAGYYMK
Sbjct: 395 VLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMK 454

Query: 468 RTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXX 527
           +TGKYYWF+++FC++  +G +QI ++ P IS ++QY L  IPG G+              
Sbjct: 455 KTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAA 514

Query: 528 XPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRI 587
            P  HQA TTSISYAFRSTG TLGVSIGGAIFR  L N L SK++  +SPEH   EL+RI
Sbjct: 515 VPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRI 574

Query: 588 IEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHAG 647
           I+KA+ STEWV   +P F +  LIDCYH+A +  F FCL C + AT +   I E++LH  
Sbjct: 575 IDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLH-- 632

Query: 648 NTAPRPQRER 657
           NT  R     
Sbjct: 633 NTLDRDNENE 642

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/542 (55%), Positives = 372/542 (68%), Gaps = 12/542 (2%)

Query: 116 EVYLTATAVEAAKEDAGGLGAT-----RRRVVMASMCLGVFLAALDGTIVTTLLDHIASE 170
           EV  T   +E+  E   GL  +     R  ++++SMCLG FLAALD TIVTTLL HIASE
Sbjct: 32  EVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASE 91

Query: 171 FNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV 230
           FNEL  ISWIATAYLLSSATFQPLYGK+SDIFGRRPL++ SNL F LG LICG+SKNLW 
Sbjct: 92  FNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWT 151

Query: 231 LVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADR 290
           LV GRF+AGIGGGG+TS+ SIT +DIVPLRSRALYQGI N FF             F++ 
Sbjct: 152 LVAGRFIAGIGGGGVTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSES 211

Query: 291 AVGWRMAFLVQVPLTLLSTTAIQLFLTLP---KPVDAHKGAGQRSIPWTTKLRMVDWTGT 347
             GWRMAFLVQVPL  +S   I +FL LP   K +          +    KL+ +DW G+
Sbjct: 212 KNGWRMAFLVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGS 271

Query: 348 VTLVVFLFCFTLVCSLYGEDLPH----LYLIFVVILLSGSYFIYHELYVATDPILPIRFL 403
           ++LV FLF F L  SL G+++P+      L+ V  +LSG+ FIY ELY++ DPILPIRFL
Sbjct: 272 LSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFL 331

Query: 404 ENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAG 463
            NRS+L AS +NWFCMM  +T  FY+PVY++SV N+ PTD+GKRI P+FFSTAFGS+GAG
Sbjct: 332 TNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAG 391

Query: 464 YYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXX 523
           YYMK+TG+YY FLL F  + VLGQ+Q+  + P ISTWRQY L  +P FGS          
Sbjct: 392 YYMKKTGRYYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLLA 451

Query: 524 XXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASE 583
                P  HQAATTSISYAFRSTGSTLGVS+G A+FRN LS  L+  +M  +S ++    
Sbjct: 452 MIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEY 511

Query: 584 LLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYK 643
           LL II++A+ S+E+VH  AP+F +  LI CY  A + TF FC    + A ++C  I EYK
Sbjct: 512 LLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYK 571

Query: 644 LH 645
           LH
Sbjct: 572 LH 573

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/654 (49%), Positives = 412/654 (62%), Gaps = 32/654 (4%)

Query: 7   GLKTKQRDRLREFAKRKERQRALAGQNQAGVGQDXXXXXXXXXXXXGEQSGLLEASRGTL 66
           G K KQR++LREF ++K+ Q+A     +  + ++             E S LL   +  +
Sbjct: 2   GKKDKQRNKLREFTRQKQLQQA----KKNDMLEETRPLVAPSSAEPIEASLLLPI-KPEI 56

Query: 67  VSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQKPTEVYLTATAVEA 126
           + DPS+ L G VA E  + +Q+EV     +              +++P         V  
Sbjct: 57  LQDPSTDLPGFVAEE--IGQQEEVANGYGS----ITDPHDGDNKSERP---------VST 101

Query: 127 AKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLL 186
           A+E +G     R RV+M SM LG+FLAA+D TIV+T   H+ASEFN+L ++SWIAT+YLL
Sbjct: 102 AEEISGA----RLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLL 157

Query: 187 SSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLT 246
           SSATFQPLYGK+SDIFGR+ LLVF+N+ F +G L+CG+SK+ W LV+ RFVAG+GGGGLT
Sbjct: 158 SSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLT 217

Query: 247 SMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTL 306
           SM SIT TD+VPLR RA+YQGICNVF+             F+D   GWRMAFL+QVPL+ 
Sbjct: 218 SMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSA 277

Query: 307 LSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGE 366
           +S   I L L LP    + +    +      KL  +DW G  TLV+FL  F L  SL G+
Sbjct: 278 ISLLVIILHLKLP----SKRATRNQDNSIKRKLLAIDWLGASTLVIFLVLFLLTASLGGK 333

Query: 367 DLPH----LYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGM 422
           ++ +      L+ +  LLS   FIY EL VA DPILP+RFL  RSVL +SLSNWFCMM  
Sbjct: 334 EIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSVLGSSLSNWFCMMAT 393

Query: 423 MTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLV 482
           MTT +Y+P+Y++ VLNM PTD+GKR++P+FFS AFGSLGAGYYMK+T KYYWF L FC V
Sbjct: 394 MTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAV 453

Query: 483 GVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYA 542
            VLGQ+QI  + P I TWRQY L ++PG G+               P  HQAATTSISYA
Sbjct: 454 AVLGQLQILLIDPKIPTWRQYILLLVPGVGTSVLITVALLAMIAAVPHEHQAATTSISYA 513

Query: 543 FRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEA 602
           FRS G TLGVSIGGAIFR  LS      ++   S EHP  ELL+II+KA+ S+EWVH  A
Sbjct: 514 FRSAGCTLGVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSA 573

Query: 603 PEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHAGNTAPRPQRE 656
           P+F R  L++CYH A + TF FC  C +L  V+   I E KLH+       Q +
Sbjct: 574 PDFIRQTLLECYHKACKNTFLFCFICSILTLVSFSIIKEKKLHSSLDRKEDQED 627

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/510 (56%), Positives = 355/510 (69%), Gaps = 9/510 (1%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           V+  SM LG+FLAA DGT+V+T++ HIASEFNELPRISWIATAYLLSSATFQPLYGKLSD
Sbjct: 80  VITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 139

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
           IFGR+PLL+ +N+VF +G L+CG++ + W LV  RF++GIGGGG+TSMCSIT +DIVPLR
Sbjct: 140 IFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISGIGGGGVTSMCSITISDIVPLR 199

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            RALYQG+CN FF             F+D   GWRMAFL+QVPL+ LS+  I +F+ LP 
Sbjct: 200 DRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPP 259

Query: 321 PVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVILL 380
              + +     SI    KL  VDW G   LVVFL  F +  SL G+++      FV + +
Sbjct: 260 --RSKRVNSPASI--KNKLLSVDWIGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCI 315

Query: 381 SGS----YFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASV 436
             S    +FI  ELY A DPILP+ FL NRSVL +S SNWFCMM MMTT +Y+P+YY+ V
Sbjct: 316 GSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGV 375

Query: 437 LNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPS 496
           LNM PT +GKR++P+FFSTA GSLGAGYYMKRTGKYYW  + FC + +LG +QI+ + P 
Sbjct: 376 LNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPD 435

Query: 497 ISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGG 556
           I+TWRQ+ L +IPGFG                P  H AATTSISYAFRSTGSTLGVSIGG
Sbjct: 436 IATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGG 495

Query: 557 AIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHY 616
           AIFR  L+  L  K++   + +HP  ELL IIEKA+ S+EWVH  APEF R  LI CYH+
Sbjct: 496 AIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHF 554

Query: 617 AGRYTFHFCLACMVLATVACCFIVEYKLHA 646
           A + TF FC  C +    +   I EYKLHA
Sbjct: 555 ACKDTFLFCTLCSIGTLASISIIKEYKLHA 584

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/614 (48%), Positives = 387/614 (63%), Gaps = 54/614 (8%)

Query: 54  EQSGLLEASRGTLVSDPSSGLSGLVASELEVQ------RQQEVCAAVTAESMATXXXXXX 107
           E S LL       + DPS+ L G VA+++E Q       Q     + T  S+++      
Sbjct: 5   EHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISS------ 58

Query: 108 XXXTQKPTEVYLTATAVEAAKEDAGG------------LGATRRRVVMASMCLGVFLAAL 155
                            E  +EDAGG            L ++R  ++M SM LG+FLAAL
Sbjct: 59  -----------------ENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAAL 101

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           DGTIV+TLL HI SEFN L + SWIAT+YLLSS+T QPLYGKLSD  GR+PLLVFSN VF
Sbjct: 102 DGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVF 161

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G LICG+S ++W +V GRF++GIGG GLTS+ ++  +D+VPLR RA+YQG+CN  F  
Sbjct: 162 AIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGL 221

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPW 335
                      F D    WR+AF++Q P+++LS   I ++L LP      + +      W
Sbjct: 222 GTASGGLVGAYFRD----WRLAFILQCPISVLSGILIVVYLELPP-----RASASNKDCW 272

Query: 336 TTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVI----LLSGSYFIYHELY 391
           + +LR +DW G  +L+ FLF F L  S+ G  + +   +F  +    L+ G+ F+Y EL 
Sbjct: 273 SARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELR 332

Query: 392 VATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPS 451
           VA DP+LP+ FL +RSVL +SL+NWFCMM MMTT FY+PVY++SVL M  TD+GKR +PS
Sbjct: 333 VAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPS 392

Query: 452 FFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGF 511
           FFS AFGSLGAG YMKRTGKYY+FLLAFC++ + GQVQI  +TP +  WRQY L ++PGF
Sbjct: 393 FFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGF 452

Query: 512 GSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
           G                P  H AATTSISYAFRSTG+TLGVS+G A+FR+ L++ L +K+
Sbjct: 453 GVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKV 512

Query: 572 MPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVL 631
           M   S  H   EL  II  AA S++WVH+ AP F R  L++CYH+A R TF FCL  MVL
Sbjct: 513 MRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVL 572

Query: 632 ATVACCFIVEYKLH 645
           A V+C  I E+KLH
Sbjct: 573 AGVSCSIIKEHKLH 586

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/612 (47%), Positives = 389/612 (63%), Gaps = 39/612 (6%)

Query: 54  EQSGLLEASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQK 113
           ++S LL A RG L+ D S  L G VA+E+E + +    A++ +                 
Sbjct: 25  DKSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQHHD------------ 72

Query: 114 PTEVYLTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNE 173
               Y +         D   L  TR R+ M+SM LG+FL+ALD TIV+TLL  I SEFNE
Sbjct: 73  ----YGSVANSIILDNDKNNLSPTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFNE 128

Query: 174 LPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVL 233
           LPRISWIATAYLLSSATFQPLYGK+SDIFGR+ +L F N+ F +G LICG +K+ WVLV+
Sbjct: 129 LPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVI 188

Query: 234 GRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVG 293
           GRF++G+GGGG+TSM +IT +DI+PLR+RALYQG+CN ++             F ++   
Sbjct: 189 GRFISGVGGGGITSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLGS 248

Query: 294 WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAH----------KGAGQRSIPWTTKLRMVD 343
           WR AFL QVPL+++ST  + ++L LPK   ++             G  SI    KL+ +D
Sbjct: 249 WRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESII-MKKLKTID 307

Query: 344 WTGTVTLVVFLFCFTLVCSLYGEDLP-------HLYLIFVVILLSGSYFIYHELYVATDP 396
           W G ++LV+FL  F ++ S  G D+        +L LI V   +S   FIY EL  A DP
Sbjct: 308 WYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFIS---FIYIELKFAKDP 364

Query: 397 ILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTA 456
           ILP+ FL++RSVL +SLSNWF MM +MT  +Y+P+Y+ SV+ +G  D+GKR +P+FFS A
Sbjct: 365 ILPLVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVA 424

Query: 457 FGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXX 516
           FGSLGAGYYMK+TGKYYWF+  FCLV V+G +QI  +   IS WRQY L  +PG G+   
Sbjct: 425 FGSLGAGYYMKKTGKYYWFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVL 484

Query: 517 XXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPL-- 574
                       P  +QA TTSISYAFRSTG TLGVSIG A+FR+ L+  L +K++ L  
Sbjct: 485 ITIALLSMIVAVPHEYQAVTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILELGS 544

Query: 575 QSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATV 634
           Q+  +   ELL+II+ A+ S +WVH EAP F +  +++CYHYA +  F FCL C VLA +
Sbjct: 545 QNGNYSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALL 604

Query: 635 ACCFIVEYKLHA 646
           +   I E+KLH+
Sbjct: 605 SISMIKEHKLHS 616

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/670 (45%), Positives = 413/670 (61%), Gaps = 23/670 (3%)

Query: 1   MGKRRKGLKTKQRDRLREFAKRKERQRAL----AGQNQAGVGQDXXX---XXXXXXXXXG 53
           MG++R G+KTK+R+RL+EFAK K RQR L    AG+   G   +               G
Sbjct: 1   MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQG 60

Query: 54  EQSGLLEASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXX--- 110
           E    L      ++ D SSG  G V ++LEVQ      A   + ++              
Sbjct: 61  ETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTP 120

Query: 111 -TQKPTEVYLTATAVEAAK-EDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIA 168
            + K   V++ +++VE     D+  +   R   +++S+ +GVFL +LDGTI++TLLD+IA
Sbjct: 121 DSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIVSSLVVGVFLGSLDGTILSTLLDYIA 180

Query: 169 SEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNL 228
           SEF  LP ISWIA +YLLS+  FQPLYGKLSDIFGR+ +L+FSNL+F LG L+CG +  +
Sbjct: 181 SEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTV 240

Query: 229 WVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFA 288
           W L+ GRFVAGIGGGGLTSM SI  +DIVPLRSRA YQ + N+ +              A
Sbjct: 241 WWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA 300

Query: 289 DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAG---QRSIPWTTKLRMVDWT 345
           +   GWR+ FL+QV   L+S   IQ FL LPK    H G G          TKL M+DW 
Sbjct: 301 EYG-GWRLVFLLQVVAALISGCFIQAFLILPK---VHHGNGIALANKESLKTKLYMMDWL 356

Query: 346 GTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLEN 405
           GT  LV+FL   TL CSL   +   L L+ +++ +SG YF+YHEL +A DPIL +  L +
Sbjct: 357 GTFCLVIFLASLTLTCSLVDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTD 416

Query: 406 RSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYY 465
           R+VLA+SL+N+FCM+  + T FY+P+Y+ASVL MGP +IGKR + SF  T+ GS G GYY
Sbjct: 417 RNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYY 476

Query: 466 MKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXX 525
           +KR GKY  F+   C++G+LGQ+QI+ + PSISTWRQY L +IP   +            
Sbjct: 477 IKRRGKYRTFICLACIIGILGQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSLLISLI 536

Query: 526 XXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELL 585
              P ++Q A  SISY FRSTG+ LG S+GG IFR+ L + L + +MPL+S  HP S+LL
Sbjct: 537 AAVPYKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQLL 596

Query: 586 RIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645
            II+KA HST+WVH+E+PE+A  ILI CYHY  +  F F + C++  +++C F+ EY +H
Sbjct: 597 HIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVH 656

Query: 646 AGNTAPRPQR 655
           A     +PQ 
Sbjct: 657 AS----QPQE 662

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  528 bits (1360), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 349/517 (67%), Gaps = 16/517 (3%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGK 197
           +  ++M SM LGVFLAALD T+V+TL+ HI SEFN++P++ W+AT+YLLSSA FQPLYGK
Sbjct: 395 KMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGK 454

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           LSDIFGR+ LL+FSNL+F  G +ICGMS +L +LV GRFVAGIGGGG+TSM +IT +DIV
Sbjct: 455 LSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSDIV 514

Query: 258 PLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLT 317
           PLRSRA+YQGICN FF             F D   GWRM F  QVP++ LST  I  FL 
Sbjct: 515 PLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQVPVSGLSTLLICSFLV 574

Query: 318 LPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYG-------EDLPH 370
           +P+  +     G+       KL  VDW G+++++++L  F L+ ++ G        D  H
Sbjct: 575 VPRIKNYEVSLGR-------KLMRVDWLGSISMILWLTSFLLITTMMGGISLDIDSDQFH 627

Query: 371 LYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIP 430
             ++F  +  S   F+  EL+VA+DP+LP+RFL NRSVL ASL N+FC+MG MT  FY+P
Sbjct: 628 YLIMFSSV--SAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFFCVMGFMTICFYLP 685

Query: 431 VYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQI 490
           +Y+ASVL++ PT IGKR+ P+F  TA GSLGAG YMK+TGKYYWF++ F LV  LG   +
Sbjct: 686 IYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFVVLFALVSTLGHYYL 745

Query: 491 SYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTL 550
           + +  ++S   QY L ++PG GS               P +HQAATTSISYAFRSTG TL
Sbjct: 746 TLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAATTSISYAFRSTGGTL 805

Query: 551 GVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHIL 610
           GV++G ++F   L  +L++ ++   SPEHP  ELLRII+KA+HSTEWVH++AP F R  L
Sbjct: 806 GVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEWVHRKAPTFIRDTL 865

Query: 611 IDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHAG 647
           I CY  A    F FC AC +LA ++   I E +L  G
Sbjct: 866 ITCYDVACHDVFVFCTACALLAAISLALIREERLATG 902

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  495 bits (1275), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/527 (46%), Positives = 340/527 (64%), Gaps = 9/527 (1%)

Query: 122 TAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA 181
           +A + +  +   L + R  ++ ASM LG+FLAALD TIV+TLL HI SE N++P +S +A
Sbjct: 63  SATDFSSNNLSDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVA 122

Query: 182 TAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIG 241
           T+Y+ S A FQPL+GK SD+FGR+PLL+ SNL+F  G L CG+SK +W L+LGR V GIG
Sbjct: 123 TSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIG 182

Query: 242 GGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQ 301
           GGGLTSMC+I   DIVPLR+RA+YQG  N+F+             F++   GWRMAF++Q
Sbjct: 183 GGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWRMAFMIQ 242

Query: 302 VPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVC 361
           +P   LST +I ++L L    D  +  G+ S+    KLR++DW G +TLV FL  F +  
Sbjct: 243 LPFCFLSTISIIVYLDLS---DDKQDLGRSSL--YCKLRLIDWLGALTLVTFLLLFLVTM 297

Query: 362 SLYGEDLPH----LYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWF 417
           ++ G+ +P+     +L+ V +  SG    Y E+++A DPILPI FL N++VL +SL+NWF
Sbjct: 298 TIGGQHVPYGSLRFFLLCVAVCASGLALAYVEIFLANDPILPISFLRNKNVLGSSLANWF 357

Query: 418 CMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLL 477
           CMMGMMT  +Y+P+Y++SV N GP  +GK+ +PSFFS A GS G  YY+++ G YY  L+
Sbjct: 358 CMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGTYYRLLM 417

Query: 478 AFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATT 537
             CL+ + GQ+QI Y+TP +  WRQY L  +PGFG                P +HQAATT
Sbjct: 418 TSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHKHQAATT 477

Query: 538 SISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEW 597
           S+SYAFR+TG  +G S+ GAIF+N L   + + +M     EH   EL  +IEKA  S++W
Sbjct: 478 SLSYAFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKALRSSDW 537

Query: 598 VHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKL 644
           V+  +PEF    L+ CY  A   TF FCL C +L  ++C FI E  L
Sbjct: 538 VNNGSPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEINL 584

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  318 bits (814), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 287/518 (55%), Gaps = 18/518 (3%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ ++ +G +LAALD TIVTTLL  IASE +   ++SWIAT+YLLS + FQPLYGKLSD+
Sbjct: 34  IVFALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 202 FGRRPLLVFSNLVFCLGALICG--MSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPL 259
           FGR+PLL++SNL F  G ++CG   +K+LW+L +GRF+AG+GGGGL S+ +ITT+DI+PL
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPL 153

Query: 260 RSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLP 319
           R R +YQG+ N+ F             F  + +GWR AFL QVPL+LLS + I  FL LP
Sbjct: 154 RQRGVYQGMGNIVF-ALGCASGSLIGAFLQQRIGWRWAFLCQVPLSLLSCSLIMKFLNLP 212

Query: 320 --KPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHL----YL 373
              P         + I        VD+TG+ TL+  +    ++ S+  ++  HL    + 
Sbjct: 213 AGSPGRGLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVL-DNPSHLTYGTWA 271

Query: 374 IFVVIL-LSGSYFIYHELYVATDPILPIRFL-ENRSVLAASLSNWFCMMGMMTTGFYIPV 431
           +F+V L L+G  F+  EL V  +P++PIR L  NR+VLA+SL+NWF  M      +Y+PV
Sbjct: 272 LFIVGLALAGYTFVSTELSVH-NPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPV 330

Query: 432 YYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQ--VQ 489
           ++ +V ++ P +IG R V +FF  A GS+  G YMKRTGKY         V V G   V 
Sbjct: 331 FWQTVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVY 390

Query: 490 ISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGST 549
           +S          +Y +  +PG G                   HQA  TSI YAFR+ GST
Sbjct: 391 LSTYNTEPKGLLEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGST 450

Query: 550 LGVSIGGAIFRNGLSNQLYSKLMPLQS--PEHPASELLRIIEKAAHSTEWVHKEAPEFAR 607
           LGVS  G I+++ L   L   ++  ++   ++   +L +  +    +  +     P    
Sbjct: 451 LGVSFAGLIYQSKLQTSLLRNIVENKTLNDKYSTHQLRKWCQTLLENNSFDVSFDPLLES 510

Query: 608 HILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645
              I  +    R    F +   +L  ++  FI E+ LH
Sbjct: 511 LAKIS-FQGGSRLVLGFAVLASILGLLSSLFIREHVLH 547

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  318 bits (815), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 208/556 (37%), Positives = 301/556 (54%), Gaps = 38/556 (6%)

Query: 115 TEVYLTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNEL 174
           TE  L  T  E+    +  L  T+ R+ + ++ +G FL+ALD TIV TLL  IAS+ +  
Sbjct: 17  TETALVDTGEESTTSHSE-LPPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDAS 75

Query: 175 PRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICG--MSKNLWVLV 232
            ++SWIATAYLLS + FQPLYGKLSDIFGR+ LL+ SNL F LG  ICG   + N+WVL 
Sbjct: 76  SQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLS 135

Query: 233 LGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAV 292
            GRFVAGIGGGG  ++ +ITT+DI+PLR R +YQG+ N+ F                + +
Sbjct: 136 TGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVL-QQGI 194

Query: 293 GWRMAFLVQVPLTLLSTTAIQLFLTLPKP--------VDAHKGAGQRSIPWTTKLRMVDW 344
           GWR AFLVQVP+ L+    I + L LP          ++  +G   + + W T   MVD+
Sbjct: 195 GWRWAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRG---KRLKWCTVTEMVDF 251

Query: 345 TGTVTLVVFLFCFTLVCSLYGE----DLPHLYLIFVVILLSGSYFIYHELYVATDPILPI 400
            G+ TL+  +       SL  +          L+ V++  S   F Y E     +P++P+
Sbjct: 252 VGSFTLIASMILLMTAISLLSDPTQLSTSLWLLLGVLLTASSLQFAYTEC-TTRNPMVPL 310

Query: 401 RFL-ENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGS 459
           R L ENR+V A+S +NWF  M   T  +Y+PV++ +V    P DIG R + +F   A GS
Sbjct: 311 RLLWENRTVCASSFTNWFMTMTTFTVMYYVPVFWHTVYKFTPWDIGVRSMSNFVGIASGS 370

Query: 460 LGAGYYMKRTGKYYWFLLA---FCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXX 516
           + AG YMKRTGKY+ F +A      VGVL     S+   S     +Y L  +PGFG    
Sbjct: 371 MLAGMYMKRTGKYWSFSVATNSLFAVGVLSLFAFSF-KGSPQGVVEYLLMFLPGFGYATM 429

Query: 517 XXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLM---P 573
                          HQA  TSI YAFR+TGSTLGV++   I+++ L ++LY+ ++   P
Sbjct: 430 LTVTLLALIASVSVEHQAQVTSIQYAFRATGSTLGVALASLIYQSCLQSRLYNNVLTDGP 489

Query: 574 LQSPEHPASELL----RIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACM 629
           L + ++ +  L+     I++  +    + H+ A E  R      + ++ +    F     
Sbjct: 490 LLA-QYGSRRLMDWCQSILQDNSFDISFDHRLA-ELVRQ----GFQFSNQCALGFAFVVC 543

Query: 630 VLATVACCFIVEYKLH 645
           VL  ++ CF+ E+ LH
Sbjct: 544 VLGVLSSCFMREHVLH 559

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  298 bits (762), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 202/546 (36%), Positives = 301/546 (55%), Gaps = 31/546 (5%)

Query: 127 AKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLL 186
           A  +   L  T+ R+++ ++ LG FL+ALD TIV+TLL  IAS+ +   ++SWIAT+YLL
Sbjct: 28  AAANHSVLTETKTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASSQMSWIATSYLL 87

Query: 187 SSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICG--MSKNLWVLVLGRFVAGIGGGG 244
           S + FQPLYGKLSDIFGR+ LLV+SNLVF +G  +CG   + N+W+L  GRF+AGIGGGG
Sbjct: 88  SCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCGSPWTTNIWILSAGRFIAGIGGGG 147

Query: 245 LTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
           LT++ +ITT+DI+PLR R +YQG+ N+ F                + +GWR AFL+QVP+
Sbjct: 148 LTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCASGSVLGAVL-QQGIGWRWAFLIQVPI 206

Query: 305 TLLSTTAIQLFLTLPKPVDAH-----KGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTL 359
            L+S   I   L LP           + A   +  W+   +M+D+ G++TLV+ +    +
Sbjct: 207 ALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSKVTKMIDFVGSITLVMSMLLLMI 266

Query: 360 VCSLYGE--DLPHLYLIFVVILLSG--SYFIYHELYVATDPILPIRFL-ENRSVLAASLS 414
             S   +   L     + +V+L++G  + F++ E  +  +P++P+R L ENR+V A+S +
Sbjct: 267 TISFLSDPSQLSENSWVVLVLLVAGFCAKFVHTECTIH-NPMVPLRLLWENRTVFASSFT 325

Query: 415 NWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYW 474
           NWF  M      +YIPV++ +V    P DIG R + +F   A GS+ AG YMK TGKY+ 
Sbjct: 326 NWFMTMSTFAVMYYIPVFWQTVFKFTPYDIGFRSISNFVGIATGSMLAGVYMKCTGKYWN 385

Query: 475 FLLA---FCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQR 531
           F L        G+L     ++         +Y L  +PGFG                   
Sbjct: 386 FSLVTNILYFTGILSLFACTFRNTPQGV-LEYLLMFLPGFGYATMLTVTLLALIASVDFE 444

Query: 532 HQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQS--PEHPASELLR--- 586
           HQA  TSI YAFR+TGSTLGVS+ G I++  L  +LY  ++  Q+   ++   +L +   
Sbjct: 445 HQAQVTSIQYAFRATGSTLGVSLAGLIYQASLQYKLYRDILGDQTLLGKYGQDQLRKWCK 504

Query: 587 -IIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645
            I++  +  T +  + A E  R      + ++      F LA   L  V  CF+ E+ L 
Sbjct: 505 EILQDNSFDTSFDQRLAKEVHRG-----FQFSSECALGFALAACTLGVVLSCFMREHVL- 558

Query: 646 AGNTAP 651
            G T P
Sbjct: 559 -GKTVP 563

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  199 bits (505), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 146/531 (27%), Positives = 237/531 (44%), Gaps = 21/531 (3%)

Query: 122 TAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA 181
           T V  +  D      TR+R+  + MC  +F  A+D +I+  +   IASEF+EL R+S + 
Sbjct: 237 TYVANSSSDELVHDLTRKRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVI 296

Query: 182 TAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIG 241
           + YLL +A  Q ++ KLS + G + LL  +   F LG+ +   S + W  +L R V G G
Sbjct: 297 SVYLLGNAIGQLMFLKLSLVSGVKLLLCVAQFSFILGSYLSWSSIHFWTFILARSVTGFG 356

Query: 242 GGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRA--VGWRMAFL 299
            G L ++ S T  +    ++   Y    ++               F D +   GW+ AFL
Sbjct: 357 SGSLIALKS-TIMNRFSQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSHGSGWKNAFL 415

Query: 300 VQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTT---KLRMVDWT----GTVTLVV 352
           + VP  L++ + +   +   K    H+G      P TT   + + V W+      +TL +
Sbjct: 416 IPVPFCLVNASIMLADIYSVKNTIHHEG------PTTTLQKRFKKVLWSPDLYEILTLAL 469

Query: 353 FLFCFTLVCSLYGEDLPH----LYLIFVVILLSGS-YFIYHELYVATDPILPIRFLENRS 407
           FL CF    SL    L H      +IF VI++ G  +F+  +  V  + +  +    ++ 
Sbjct: 470 FLLCFVQATSLDSTRLEHSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKH 529

Query: 408 VLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMK 467
           ++   +  +FC   +M    +   Y+  VLN+   +I +R++P FFS   G     Y+  
Sbjct: 530 LIWTMMGIFFCFAALMCIIPFGTTYFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWN 589

Query: 468 RTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXX 527
              + Y F      V +L  V +  +  S+S W+QY    +P  GS              
Sbjct: 590 SERQNYLFKFVLSGVTLLLYVALMGMNLSLSVWKQYTCLSLPLLGSSMILTLLSTLYHEY 649

Query: 528 XPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRI 587
             QR    + SI+Y F + G T+GVS  G +F   L   +  ++M      +   +L +I
Sbjct: 650 HVQRKSPISGSIAYCFAAMGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQGYLKKDLFKI 709

Query: 588 IEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCF 638
           I+ A  S+ WVHK AP+F    LI+CY  A R  F        +  V   F
Sbjct: 710 IKHATQSSNWVHKSAPKFIFRTLIECYLQACRNVFKLSALFFTITVVTLFF 760

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 7  GLKTKQRDRLREFAKRKERQRALAGQNQ 34
          G K +QR +LREFAK K RQR L    Q
Sbjct: 2  GKKDRQRKKLREFAKLKNRQRNLKESVQ 29

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  184 bits (468), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 158/535 (29%), Positives = 245/535 (45%), Gaps = 33/535 (6%)

Query: 124 VEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATA 183
           + +   DA     TRRR+  + MC  +F  A+D +I+  ++  IASEF+EL R+S I + 
Sbjct: 233 IASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSV 292

Query: 184 YLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGG 243
           YLLS+A  Q L+ KLS I   + LL  +   F LG+ +   S + W  +  RFVAG G G
Sbjct: 293 YLLSNAIGQLLFLKLSIISSVKLLLCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSG 352

Query: 244 GLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRA--VGWRMAFLVQ 301
            L ++ S T  +    ++ + Y    +V                 D +   GW+ AFL+ 
Sbjct: 353 SLIALKS-TIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIP 411

Query: 302 VPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMV-DWTGTVTLVVFLFCFTLV 360
           VP  L++ + +   +   K    H+G+         K+ +  D    +TL +FL CF  V
Sbjct: 412 VPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEILTLTLFLLCFVQV 471

Query: 361 CSLYGEDLPH----LYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSN- 415
            +L   +L H     +++F VIL+ G  F   E   A D  +        SV++ SL   
Sbjct: 472 TTLDLTELEHRTMIQWVLFSVILICGVLFWLIE---ANDTYM-------NSVISMSLQGD 521

Query: 416 ----W------FCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYY 465
               W      FC   +M    +   Y+  VLN+    I +R++P FFS   G     Y+
Sbjct: 522 KRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYF 581

Query: 466 MKRTGKYYWFLLAFCLVGVLGQVQISY--VTPSISTWRQYCLYMIPGFGSXXXXXXXXXX 523
            K   + Y  LL F L GV   + I+   V  S+  W+QY    +P  GS          
Sbjct: 582 WKSKKQNY--LLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSLPFLGSSMLLTLLSSL 639

Query: 524 XXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASE 583
                 QR    + SI Y F + G T+G+S+GG +F   L+  L+ ++M      +   +
Sbjct: 640 YHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKD 699

Query: 584 LLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCF 638
           LL+II+ A  S++WVH+ AP+F    LI+CY  A R  F        +  ++  F
Sbjct: 700 LLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVFFTIMVISMFF 754

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score =  183 bits (465), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 144/544 (26%), Positives = 225/544 (41%), Gaps = 48/544 (8%)

Query: 119 LTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRIS 178
           L    VE    D      TRRR+  + MC  +F  A+D +I+  +   IASEF+EL R+S
Sbjct: 228 LNPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLS 287

Query: 179 WIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVA 238
            + +AYLLS+A  Q ++ KLS I   + LL  +   F LG  +   S + W  +  R V 
Sbjct: 288 LVISAYLLSNAIGQLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFIFARCVT 347

Query: 239 GIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXF-ADRAVGWRMA 297
           G GGG L ++ S                    + F             F +    GWR A
Sbjct: 348 GFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNA 407

Query: 298 FLVQVPLTLLSTTAI-----QLFLTL---PKPVDAHKGAGQRSIP--------------- 334
           FL+ VP  L++ + +      +  TL   P P    +       P               
Sbjct: 408 FLIPVPFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEILTLTLFLLCF 467

Query: 335 -WTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVILLSGSYFIYHELYVA 393
              T L +        +   LF   +VC           ++F +I  S +Y         
Sbjct: 468 VQVTSLDLTGLKNNTMIQALLFSVIIVCG----------ILFFLIETSDTYM-------- 509

Query: 394 TDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFF 453
            + ++ +    ++ ++   +   FC   +M    +   Y+  VLN+    + +R+ P FF
Sbjct: 510 -NSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFF 568

Query: 454 STAFGSLGAGYYMKRTGKYYWFLLAFCLVG--VLGQVQISYVTPSISTWRQYCLYMIPGF 511
           S   G     Y+ K  G+   FLL F L G  +L  V +  V+ ++  W+QY    +P  
Sbjct: 569 SIVLGYFSVSYFWKSKGQN--FLLKFVLSGATLLLYVALMGVSLNLPVWKQYICLSLPFL 626

Query: 512 GSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
           GS                QR    + SI Y F + G T+G+S+GG +F   L   ++ K+
Sbjct: 627 GSSMILTLLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKV 686

Query: 572 MPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVL 631
           MP     +   +LL+II+ A  S++WVH+ AP+F    LI+CY  A R  F        +
Sbjct: 687 MPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQACRNVFKLSTLFFTI 746

Query: 632 ATVA 635
             VA
Sbjct: 747 TVVA 750

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 7  GLKTKQRDRLREFAKRKERQRALAGQNQ 34
          G K +QR +LREFAK K RQR L    Q
Sbjct: 2  GKKDRQRKKLREFAKLKNRQRNLRKSVQ 29

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  181 bits (458), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 152/539 (28%), Positives = 238/539 (44%), Gaps = 16/539 (2%)

Query: 111 TQKPTEVYLTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASE 170
           T K  E   T++    A  D      TRRR+  + MC  +F  A+D TI+ +++  IASE
Sbjct: 236 TVKDVENGTTSSYARVASSDKFVHDLTRRRIFSSCMCTYLFFIAMDSTILMSIVSKIASE 295

Query: 171 FNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV 230
           F+EL R+S I + YLLS+A  Q ++ KLS +   + LL  +   F LG+ +   + + W 
Sbjct: 296 FHELWRLSLIISIYLLSNAIGQLVFLKLSIVTSVKLLLCVAQFSFILGSYLSWSAFHFWT 355

Query: 231 LVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFAD- 289
            V  R + G G G L ++ S         +          + F             F + 
Sbjct: 356 FVFARSITGFGSGALMALKSTIMNRFSDKKKNGYSLSASVIVFSLGVAIGPFLVYLFDNS 415

Query: 290 RAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMV-DWTGTV 348
           R  GW+ AFL+ VP  L++ + +   +   K    H G+   S     K+ M  D    +
Sbjct: 416 RGSGWKNAFLIPVPFCLVNASIMLADIYSIKDNLHHGGSAPISWKRIKKILMSPDLYEIL 475

Query: 349 TLVVFLFCFTLVCSLYGEDLPHLYLI----FVVILLSGSYFIY---HELYVATDPILPIR 401
           TL + L CF  V SL    L H  +I    F VI+  G  F +   +E Y   + I+ + 
Sbjct: 476 TLALLLLCFVQVTSLDITRLEHSAVIQGVLFFVIITCGILFWWIETNETY--ANSIISMS 533

Query: 402 FLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLG 461
              ++ ++   +   FC   +M    +   Y+  VLN+    I +R++P   +   G   
Sbjct: 534 LRGDKHLMWTIMGISFCFAALMCIIPFGTTYFTIVLNISTLQIAERLLPLSVAIVVGYFS 593

Query: 462 AGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSIS--TWRQYCLYMIPGFGSXXXXXX 519
             Y+ K   K Y  LL   L GV   + I+ +  S+S   W+QY    +P  GS      
Sbjct: 594 VCYFWKPQMKNY--LLEVVLGGVTLILYIALMGASLSLPVWKQYVCLSLPLLGSAMILTL 651

Query: 520 XXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEH 579
                      +    + SI Y F + G T+G+S+GG +F   L   ++  +M      +
Sbjct: 652 LSSLYHEYHQPKKSPISGSIVYCFSAMGGTIGISLGGYVFHKTLLKAVHDGVMKFSKHGY 711

Query: 580 PASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCF 638
              +LL+IIE A  S++WVH+ AP+F    LI+CY  A R  F    A +   TV   F
Sbjct: 712 HEKDLLKIIEHATQSSDWVHESAPKFIFQTLIECYLQACRNVFKLS-AILFTITVMTMF 769

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  174 bits (440), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 144/478 (30%), Positives = 225/478 (47%), Gaps = 51/478 (10%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL++LDGTIV  +++ +A EF E  +  WIAT+YLL++  FQPLYGKLSD+
Sbjct: 39  IVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDL 98

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  ++ ++  F LG L+   + ++    + R + G+GGGG+ +M SIT +DI   R 
Sbjct: 99  TGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRE 158

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKP 321
           R +YQG  N+ F             F D  +GWR+ F +QVP  LL ++ +       K 
Sbjct: 159 RGIYQGYANIVFGLGQILGAPIGGLFID-TLGWRILFGLQVPTILLCSSLVH------KN 211

Query: 322 VD---AHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVI 378
           V+   +H    +    W + L  +D  G+ TLV  +     +CS   E    L  IF VI
Sbjct: 212 VNIKLSHLLPVEERFKW-SNLSRIDILGSSTLVFTISGVLFLCS--TELNKALLSIFTVI 268

Query: 379 LLSGSYFIYHELYVATDPILPIRFLENRSVL--AASLSNWFCMMGMMTTGFYIPVYYASV 436
             S   FI  ELY + + I+P   L+    L  AA++ + F + G +   F  P+Y   +
Sbjct: 269 --SFIAFILIELYYSKERIMPFELLKGSFGLASAATVISSFIIFGDI---FRSPIYLQLI 323

Query: 437 LNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKY-----YWFLLAFCLVGVLGQVQIS 491
             +  T  G  ++    S A GSL  G+ ++ T        YW +     + +LG V   
Sbjct: 324 QGVSVTKTGFFMLFPSISVAVGSLATGWILRHTKMKLSHCAYWIVTIGMSIQLLGLVVAY 383

Query: 492 YVT----PSIS--------------------TWRQ-YCLYMI-PGFGSXXXXXXXXXXXX 525
           Y+     PS+S                    TW   Y L +I   FG             
Sbjct: 384 YLIQNLEPSLSGSAIFGAFVQIGQNISSQSYTWVVIYALALILVSFGYACLLVATLVNIV 443

Query: 526 XXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASE 583
              P+  Q   T I Y +RS G+ LG S+    +  G+S+ L++ +   Q  ++  S+
Sbjct: 444 FTIPKSQQGTVTGIFYLWRSIGNVLGASLTLVFYEKGVSSFLWNYMFNKQHDDYNFSK 501

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  172 bits (436), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 137/502 (27%), Positives = 240/502 (47%), Gaps = 60/502 (11%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ L   + A+DGTI++T ++ IAS F E  +++W+ATAY+L++   QPLYGK SD+
Sbjct: 50  ILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDL 109

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+F+ +VF +G ++CG ++ +  L++ R + G+GG GL +MC+I  +D+ PL  
Sbjct: 110 LGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQ 169

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKP 321
           R++Y G  +V +               +   G R  F+VQ+P  L S +    ++     
Sbjct: 170 RSIYWGWGSVIWGFSQSVGGPLGGLLLNW-FGVRGLFVVQIPFCLFSLSLTVKYI----- 223

Query: 322 VDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGE--DLPHLYLI----F 375
              H  + Q    W    R +D+ G+  L+  +  F  +CS  G+  D   + L     F
Sbjct: 224 ---HDLSNQTQGTW----RDIDFAGSFCLITGISAFIFLCSSSGDVTDDSAVSLFKVGCF 276

Query: 376 VVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYAS 435
           ++ +LS S FIY E  VA   ILP   L+    + + +     M+  +   F +P+Y   
Sbjct: 277 LITVLSVSGFIYVEKNVAAKSILPAEVLKGSLGVISFIYGLASMLSYVGL-FVVPLYLQL 335

Query: 436 VLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTG---------KYYWFLLAFCLVGVLG 486
           V  +     G  I+ +  ST+ GS G+G+ +++ G              L+   L+  LG
Sbjct: 336 VWGVSVAGSGGYIMYAVISTSIGSFGSGWLLRKYGAPDKDATLLNSGMMLIGSTLINTLG 395

Query: 487 ---------QVQISY---VTPSISTWRQYCL-YMIPGFGSXXXXXXXXXXXXXXXPQRHQ 533
                    +++ ++    +PS      + L + I G  +                ++ Q
Sbjct: 396 FFVMFKNILEIKPAFEGVKSPSPDQKFWFLLGFAIMGLSAGFQSVSVMLYTVAKVGRKGQ 455

Query: 534 AATTSISYAFRSTGSTLGVSIGGAIFR-----------NGLSNQLYSKLMP----LQSPE 578
           A++TS+++ FRS G+ L VSI  ++F             G  + LY KL+     L+S E
Sbjct: 456 ASSTSVTFLFRSLGNVLSVSISLSVFVASLKGKLKSYFQGQQSDLYRKLLKENAFLRSGE 515

Query: 579 HPAS---ELLRIIEKAAHSTEW 597
            P+    +LL++ + A     W
Sbjct: 516 VPSDQLKDLLQVFKSAIVKAFW 537

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  168 bits (426), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 151/553 (27%), Positives = 251/553 (45%), Gaps = 74/553 (13%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL++LD TIV  +++ +A EF+E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GRRP L+ +   F LG L+   ++N+    + R V GIG GGL ++ SI  +DI   R 
Sbjct: 98  IGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARE 157

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPL----TLLSTTAIQLFLT 317
           R +YQG  N+ F             F +  +GWR  F VQVP+    ++L+   I + L 
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGIFIE-TIGWRALFGVQVPMIIVCSILAIKNINIKLF 216

Query: 318 LPKPVDAHKGAGQRSIPWTTK-LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFV 376
              P+            +T K L  +D  G+++LV  +     +CS       H+  I++
Sbjct: 217 HVPPMKER---------YTLKNLSRIDIFGSLSLVATISGVLFLCS------SHMNKIYL 261

Query: 377 VILLSGSY--FIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIPVY 432
            +   GS+  F+  E Y AT+ ILP   L     L+++++  + F + G +   F  P+Y
Sbjct: 262 ALFTIGSFIVFVLVERYYATERILPFELLTGSFCLSSAVTVISSFVVFGEI---FRSPIY 318

Query: 433 YASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL--GQV-- 488
              + N+  T  G  ++    S A GSL  G+ ++ T       LA C   ++  G V  
Sbjct: 319 LQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTKMN----LAHCAYQIIFGGMVTQ 374

Query: 489 -------------------------QISYVTPSISTWRQYCLY--MIPGFGSXXXXXXXX 521
                                     I++ + SI  W+   ++  ++  FG         
Sbjct: 375 LLGLGMGYLLLGHLYPDYTVYDMLESITFKSHSI-WWKLIYVFASVLVSFGYACLLVATL 433

Query: 522 XXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPA 581
                   +  Q   T + Y +RS G+ LG S+    + N LS+ L+S +      E   
Sbjct: 434 VSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWSYMF-----ERKR 488

Query: 582 SELLRIIEKAAHS--TEWVHKEAPEFARHI---LIDCYHYAGRYTFHFCLACMVLATVAC 636
            +     +K  +S   +  +   P F   I   ++D Y  A   ++   +A  V+  V  
Sbjct: 489 DDGYHFTKKQYYSLINDSSYLRKPNFPTDIFVRILDVYKKAFLISYLPNIALAVVGIVLS 548

Query: 637 CFIVEYKLHAGNT 649
            ++V++ L   +T
Sbjct: 549 LYLVKHTLKRSST 561

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  168 bits (426), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 138/505 (27%), Positives = 236/505 (46%), Gaps = 65/505 (12%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           +V+ S+ L   + A+DGTI++T ++ +AS F E   ++W+ATAY+L++ + QPLYGK SD
Sbjct: 52  LVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSD 111

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
           + GR+  L+F+ +VF +G ++CGM++ +  L + R + GIGG GL +MC+I  +D+ PL 
Sbjct: 112 LLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLS 171

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            R++Y G+ ++ +               +   G    F++QVP  L S     LFLT+  
Sbjct: 172 QRSIYWGLGSLIWGFSQSIGGPLGGLLLNW-FGVSGLFVIQVPFCLFS-----LFLTVRY 225

Query: 321 PVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSL-----YGEDLPHLYLIF 375
               H    QR   W    R +D+ G+  L++ +  F   CS        ++ P   +  
Sbjct: 226 ---IHDLTDQRQGTW----RDIDFAGSFCLIIGISAFIFSCSAGDGVDSNDEGPFKVVCL 278

Query: 376 VVILLSGSYFIYHELYVATDPILPIRFLENR---SVLAASLSNWFCMMGMMTTGFYIPVY 432
           +V + + + F+  E  +AT  ILP   L+       L   LS+    +G+    F +P+Y
Sbjct: 279 IVTIAAVAGFVVVEKRMATKSILPAHVLKGSLGVVGLIYGLSSMLSYVGL----FIVPLY 334

Query: 433 YASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTG---------KYYWFLLAFCLVG 483
              V        G  I+ +  ST+ GS  +G+ ++R G              L++  L+ 
Sbjct: 335 LQVVWGTSVAGSGGYIIYAVVSTSVGSFSSGWLLRRYGSPTRCTTLFNSGIMLVSSTLIN 394

Query: 484 VLGQV----QISYVTPSI------STWRQYCL---YMIPGFGSXXXXXXXXXXXXXXXPQ 530
           VLG       I  ++P+       S  +++     ++I G                   +
Sbjct: 395 VLGFAILFRNILSISPNFENTGGPSGSQKFWFLLGFVIMGCSQGFQNVSVMLYTVAKVGR 454

Query: 531 RHQAATTSISYAFRSTGSTLGVSIGGA-----------IFRNGLSNQLYSKLMPLQS--- 576
           + QAA+TS+++ FRS G+ L VSI  +           I+  G    LY KL+   +   
Sbjct: 455 KGQAASTSVTFLFRSLGNVLSVSIALSVYVASLKHDLTIYFEGQKTDLYFKLLKENAFLR 514

Query: 577 ----PEHPASELLRIIEKAAHSTEW 597
               PE    +LL++ + A     W
Sbjct: 515 SGSVPEDQLKDLLQLFKAAITDAFW 539

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  166 bits (420), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 138/473 (29%), Positives = 221/473 (46%), Gaps = 52/473 (10%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL++LD TIV  +++ +A EF E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 42  ILLSLWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDI 101

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  ++ S+  F LG  +   ++N+    + R + GIG GG+ +M SIT +DI   R 
Sbjct: 102 TGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRE 161

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKP 321
           R +YQG  N+ F             F D +VGWR+ F VQVP+ LL +T     + +   
Sbjct: 162 RGIYQGYANIVFGLGQLLGAPLGGLFID-SVGWRVIFGVQVPMLLLCSTLATRNINVKL- 219

Query: 322 VDAHKGAGQRSIPWTTKLRM-----VDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFV 376
             AH    +    W    R+     +   GT++ ++FL   TL      + +  L +I  
Sbjct: 220 --AHIPPRKERFTWKNLSRIDIFGSLALVGTISSLLFLTSTTL-----NKIVLTLSMIAS 272

Query: 377 VILLSGSYFIYHELYVATDPILPIRFLENRSVLAA--SLSNWFCMMGMMTTGFYIPVYYA 434
            IL     FI+ ELY A + ILP   L+    L +  ++++ F + G +   F  P+Y  
Sbjct: 273 FIL-----FIWIELYYAKERILPFDLLKGSFGLCSLVTVASSFVVFGDI---FRSPIYLQ 324

Query: 435 SVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKY-----YWFLLAFCLVGVLGQVQ 489
            V ++  T  G  +V    + A GSL  G+ ++ T K      Y  +L    + + G V 
Sbjct: 325 LVQDISVTKTGLFLVFPSIAVAGGSLVTGWILRHTKKNLSHCAYGIILGGVCIQLCGLVI 384

Query: 490 ISYV---------------------TPSISTWR-QYCLYMI-PGFGSXXXXXXXXXXXXX 526
             Y+                     TP+   W+  Y L +I   +G              
Sbjct: 385 AYYLIKNLKPAMVHIDDSAMAFFTFTPNSIMWKIIYALALILVSYGYASLLVATLVSIVF 444

Query: 527 XXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEH 579
              +  Q   T I Y +RS G+ LG S+   I+ N L+ +L++ +    + + 
Sbjct: 445 TIEKSQQGTMTGIFYLWRSIGNVLGASLTLVIYENSLAKKLWNYMFETNNKKD 497

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  162 bits (410), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 151/541 (27%), Positives = 249/541 (46%), Gaps = 81/541 (14%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL++LDGTIV  +++ +A EF+E  R  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ ++  F +G L+   ++N+    + R + GIG GGL ++ SI  +DI   R 
Sbjct: 98  TGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARE 157

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTT------AIQLF 315
           R +YQG  N+ F             F +  +GWR  F VQVP+ +L +        I+LF
Sbjct: 158 RGVYQGYANIVFGLGQLLGAPLGGVFIE-TIGWRALFGVQVPVIMLCSVLAIKNINIKLF 216

Query: 316 LTLPKPVDAHKGAGQRSIPWTTK-LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLI 374
              P          +R   +T K L  +D  G+++LV  +     +CS       HL  +
Sbjct: 217 HVPPMK--------ER---YTLKNLSRIDIFGSLSLVATISGVLFLCS------SHLNKL 259

Query: 375 FVVILLSGSY--FIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIP 430
           ++ +   GS+  FI  E Y AT+ ILP+  L     L+++++  + F + G +   F  P
Sbjct: 260 YLTLFTIGSFIVFILVERYYATEKILPLELLTRSFCLSSAVTVISSFVVFGEI---FRSP 316

Query: 431 VYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC-----LVGVL 485
           +Y   + N+  T  G  ++    S A GSL  G+ ++ T       LA C       G++
Sbjct: 317 IYLQLLQNISVTKTGLFLIFPSVSVAVGSLVTGWLLRNTK----INLAHCAYQIIFGGMI 372

Query: 486 GQV------------------------QISYVTPSISTWRQYCLY--MIPGFGSXXXXXX 519
            Q+                         I++ + SI  W+   ++  ++  FG       
Sbjct: 373 TQLLGLGLGYLLLAYLNPDYTIYDMLESITFESDSI-WWKLIYVFASVLVSFGYACLLVA 431

Query: 520 XXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEH 579
                     +  Q   T + Y +RS G+ LG S+    + N LS+ L++ +      E 
Sbjct: 432 TLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMF-----ET 486

Query: 580 PASELLRIIEKAAHS--TEWVHKEAPEFARHI---LIDCYHYAGRYTFHFCLACMVLATV 634
             S+     +K  +S   +  +   P F   I   ++D Y  A   ++   L  +VLA V
Sbjct: 487 KRSDKYHFTKKQYYSLINDTSYLRGPNFPTDIFVRILDIYKKAFLISY---LPNIVLAVV 543

Query: 635 A 635
            
Sbjct: 544 G 544

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  162 bits (409), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 149/545 (27%), Positives = 243/545 (44%), Gaps = 40/545 (7%)

Query: 138 RRRVVMASMCL--GVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLY 195
           R R+++    L   VFL+ LD TI  ++   I +EF ++   SWI TAYL++  +FQPLY
Sbjct: 42  RNRILLIETALFTNVFLSGLDSTITASIYQLIGNEFEDVKVSSWITTAYLVTCTSFQPLY 101

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  SD  GRR  L F+N +F LG L CG++  ++ L++ R V GIGGGGL ++ +I  +D
Sbjct: 102 GSFSDTLGRRRCLFFANTIFALGCLGCGLTSTIYSLIIMRAVTGIGGGGLITLSTIVNSD 161

Query: 256 IVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLF 315
           I+P + R +YQ   N+                A  ++GWR  FL+QVP+++       LF
Sbjct: 162 IIPAKKRGMYQSFQNILVGTGAVVGASCGGEIAS-SMGWRWCFLLQVPISIGGAVMAYLF 220

Query: 316 LTLPKPVDAHKGAGQRSIPWT-TKLRMVDWTGTVTLV---VFLFCFTLVCS--------- 362
           +     VD +  +G  ++P   +K++ +D+ G   L+   V    F  + S         
Sbjct: 221 VQDQDVVDKNPRSG--ALPSNVSKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGKSTW 278

Query: 363 LYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLE---NRSVLAASLSNWFCM 419
           L G  L  L L+  V L+    F Y E     +PI+P   L    + +VL   +   F  
Sbjct: 279 LSGRSL-ALGLVTAVSLI---LFAYVEKTTTANPIIPHDLLGQWYSTTVLIVGVLVGFVS 334

Query: 420 MGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAF 479
              +   F +P+Y+  V+     + G R+    F T  G +  G  MK   +    L+  
Sbjct: 335 YAYI---FTLPLYFQVVVGDTAAEAGLRLTVPSFCTPIGGVIMGISMKDPKRLPGLLIVG 391

Query: 480 CLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSI 539
             + + G +    + P+   W    L +    G                P   QA  T+ 
Sbjct: 392 ISLMLFGNLCFLLIKPTTPYWLTSLLLVPANIGQGITFPSTLFSFLFAFPPYKQATATAT 451

Query: 540 SYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVH 599
            Y FRS G   GV+   ++ ++ +  Q   +L  + + E    E+  ++ K +H T  + 
Sbjct: 452 LYLFRSVGCVWGVAGTSSLIQSVVRKQATKRLQGILTDE----EIKSLLVKLSHKTSLIE 507

Query: 600 KEAPEFARHILIDCYHYAGRYTFHF----CLACMVLATVACCFIVEYKLHAGNTAPRPQR 655
           K  P+  R  ++  Y  + + T+ F    CL  ++LA +   F    K    N     +R
Sbjct: 508 K-LPDNVRAAVLTSYEISIKSTYFFSVILCLIAIILALMRRVF---KKFDGTNDRDLEER 563

Query: 656 ERTLN 660
           E   N
Sbjct: 564 EDLTN 568

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  161 bits (408), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 143/470 (30%), Positives = 224/470 (47%), Gaps = 59/470 (12%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ +G FL ALDGTIV  +++ +A EF E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 53  IVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDI 112

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ ++  FCLG L+   ++N+    + R + GIGGGG+++M SIT +DI   R 
Sbjct: 113 TGRKFALLVAHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARE 172

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLS------TTAIQLF 315
           R  YQG  NV F               DR +GWR  F +QVP+ L+          I+L 
Sbjct: 173 RGAYQGYANVVFSTGQLLGAPLGGFALDR-IGWRAIFGLQVPMLLICMVLGYRNVNIKL- 230

Query: 316 LTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIF 375
                   AH    +    W   L  +D  G++TLV  +     +CS       +  ++ 
Sbjct: 231 --------AHVPPLEERFTW-KNLSRIDIGGSITLVCTISGVLFLCSTS----LNKAILS 277

Query: 376 VVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIPVYY 433
           V   LS   F+Y+ELY+A + ILP   L     LA+ L+  + F + G +   F  P++ 
Sbjct: 278 VFTGLSFMLFMYNELYLARERILPFELLGGSFGLASILTVGSSFVIFGDV---FRSPIFL 334

Query: 434 ASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGK----------YYWFLLAFCLVG 483
             V N+  T  G  ++ S  +TA  SL  G+ ++ T            ++   L  C + 
Sbjct: 335 QLVQNISVTKTGGFLLFSSIATAAASLITGWILRNTKMNLAKCSYLIVFFSIFLQLCGL- 393

Query: 484 VLGQVQISYVTPSISTW--------RQY----------CLYM----IPGFGSXXXXXXXX 521
           V+    +SY+ P+ ++         R Y          C+Y+      G+G         
Sbjct: 394 VIAVTLLSYLEPNQTSLMANNTRLKRDYLFKSDSLAWKCVYICASAFTGYGYASLLVSTL 453

Query: 522 XXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
                   +  QA  T + Y +RS G+ LG S+  +++   LS +L+S L
Sbjct: 454 VSIVFTIDKSQQATITGLFYLWRSIGNVLGASLTLSLYEATLSKKLWSYL 503

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  161 bits (407), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 145/550 (26%), Positives = 248/550 (45%), Gaps = 68/550 (12%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL++LD TIV  +++ +A +F+E  R  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ +   F LG L+   ++N+    + R + GIG GGL ++ SI  +DI   R 
Sbjct: 98  TGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLST------TAIQLF 315
           R +YQG  N+ F             F +  +GWR  F VQVP+ +L T        I+LF
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIE-TIGWRALFGVQVPMIMLCTILAIKNINIKLF 216

Query: 316 LTLPKPVDAHKGAGQRSIPWTTK-LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLI 374
              P          +R   +T K L  +D  G+++LV  +     +CS       HL  +
Sbjct: 217 HVPPMK--------ER---YTLKNLSRIDLFGSLSLVATISGVLFLCS------SHLNKL 259

Query: 375 FVVILLSGSY--FIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIP 430
           ++ +   GS+  F+  E Y AT+ ILP   L     L+++++  + F + G +   F  P
Sbjct: 260 YLSLFTIGSFIVFVLVERYYATERILPFELLTPSFCLSSAVTVISSFVVFGEI---FRSP 316

Query: 431 VYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL--GQV 488
           +Y   + N+  T  G  ++    S A GSL  G+ ++ T       LA C   ++  G V
Sbjct: 317 IYLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMV 372

Query: 489 ---------------------------QISYVTPSISTWRQYCLY--MIPGFGSXXXXXX 519
                                       I++ + SI  W+   ++  ++  FG       
Sbjct: 373 TQLLGLGLGYLLLAHLNPDYTVYDMLESITFKSNSI-WWKLIYVFASVLVSFGYACLLVA 431

Query: 520 XXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEH 579
                     +  Q   T + Y +RS G+ LG S+    + N LS+ L++ +   +  + 
Sbjct: 432 TLVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKSKREDE 491

Query: 580 PASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFI 639
                 +       S+       P++    ++D Y  A   ++   +A  V+  V   ++
Sbjct: 492 YHFSKKQYYSLIDDSSYLRGNNFPKYVFVRILDVYKKAFLISYIPNIALAVIGMVLSLYL 551

Query: 640 VEYKLHAGNT 649
           V++ L   ++
Sbjct: 552 VKHTLKRSSS 561

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  160 bits (405), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 125/462 (27%), Positives = 220/462 (47%), Gaps = 51/462 (11%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           +++S+ LG F ++LD TIV  +++ +A EF E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 45  ILSSLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDI 104

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  ++ ++  F LG L+   ++N+    + R + G+G GG+ +M SITT+DI   R 
Sbjct: 105 TGRKFAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRE 164

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTL----LSTTAIQLFLT 317
           R ++QG  N+ F             F D  +GWR  F +QVP+ +    L+ T + + L 
Sbjct: 165 RGIFQGYANIVFGMGQVLGAPLGGLFLDH-IGWRTLFGIQVPMIMFCSYLTITNVNIKL- 222

Query: 318 LPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVV 377
                  H    +    W   L  +D  G+++LV  +     + S   + L    L+ + 
Sbjct: 223 ------LHVPPRKERFTW-KNLSRIDIFGSLSLVATISGILFLTSTQLDKL----LLSLF 271

Query: 378 ILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIPVYYAS 435
             +S   F++ ELY A + ILP   L     L + ++  + + + G +   F  P+Y   
Sbjct: 272 TFISFGLFMWIELYYAKERILPFDLLNGSFGLCSVVTVISSYVVFGDI---FRSPIYLQL 328

Query: 436 VLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKY-----YWFLLAFCLVGVLGQV-- 488
           + ++  T  G  ++    + A GSL  G+ ++ T K      Y  +L+  ++ + G V  
Sbjct: 329 IQDISVTKTGLFLIIPSIAMAGGSLVTGWILRNTTKNLSHCAYGIILSGVIIQLAGLVIA 388

Query: 489 --QISYVTPSIS------------------TWRQYCLY--MIPGFGSXXXXXXXXXXXXX 526
              I ++ PS++                  TW+   ++  ++  +G              
Sbjct: 389 YLLIGHLNPSLNQLGNVFNIAMENFTSGSRTWKVIFVFSLLLGSYGYSSILVATLVSIVF 448

Query: 527 XXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLY 568
              +  Q   T I Y +RS G+ LG S+   ++RN L+ +L+
Sbjct: 449 TIEKSQQGTMTGIFYLWRSIGNVLGASLTLVLYRNTLAKRLW 490

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  159 bits (402), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 136/479 (28%), Positives = 222/479 (46%), Gaps = 66/479 (13%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL++LD TIV  +++ +A EF+E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ +   F LG L+   ++N+    + R + GIG GGL ++ SI  +DI   R 
Sbjct: 98  TGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTT------AIQLF 315
           R +YQG  N+ F             F +  +GWR  F +QVP+ +L +        I+LF
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIE-TIGWRALFGIQVPVIMLCSVLAIKNINIKLF 216

Query: 316 LTLPKPVDAHKGAGQRSIPWTTK-LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLI 374
              P          +R   +T K L  +D  G+++LV  +     +CS     L  LYL 
Sbjct: 217 HVPPMK--------ER---YTLKNLSRIDIFGSLSLVATISGVLFLCS---SQLNKLYLA 262

Query: 375 FVVILLSGSY--FIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIP 430
              I   GS+  FI  E Y AT+ ILP   L     L+++++  + F + G +   F  P
Sbjct: 263 LFTI---GSFIVFILVERYYATEKILPFELLTRSFCLSSAVTVISSFVVFGEI---FRSP 316

Query: 431 VYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL--GQV 488
           +Y   + N+  T  G  ++    S A GSL  G+ ++ T       LA C   ++  G +
Sbjct: 317 IYLQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMI 372

Query: 489 Q-----------ISYVTPSIS--------TWRQYCLY---------MIPGFGSXXXXXXX 520
                       +S++ P  +        T+R   ++         ++  FG        
Sbjct: 373 MQLLGLGLGYFLLSHLNPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACLLVAT 432

Query: 521 XXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEH 579
                    +  Q   T + Y +RS G+ LG S+    + N LS+ L++ +   +  + 
Sbjct: 433 LVSIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKTKRDDE 491

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 157/547 (28%), Positives = 249/547 (45%), Gaps = 38/547 (6%)

Query: 138 RRRVVMASMCL--GVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLY 195
           R R+V     L   VFL+ LDGTI  +    I +EF+     +WI TAYL+++ +FQPLY
Sbjct: 41  RYRIVFIETALFANVFLSGLDGTITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLY 100

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  SD  GRR  L F+N VF LG L CG++  +  L+  R + GIGGGGL ++ +I  +D
Sbjct: 101 GSFSDTLGRRHCLFFANTVFALGCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSD 160

Query: 256 IVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLF 315
           I+P  SR +YQ   NV                A   +GWR  FL+QVP+++  T    +F
Sbjct: 161 IIPPESRGIYQAFQNVLLGIGAVIGASTGGAVASY-LGWRWCFLLQVPVSVGGTIMAYMF 219

Query: 316 LTLPKP-VDAHKGAGQRSIPWTTKLRMVDWTGTVTLVV----FLFCFTLVCSLYGEDLPH 370
           L   K  V   + +GQ       +   +D  G++ L+V     L   T+  S+       
Sbjct: 220 LENQKGFVSESESSGQL---LKNRFSKIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQW 276

Query: 371 LYL----IFVVILLSGSYFIYHELYVATDPILPIRFL-ENRSVLAASLSNWFCMMGMMTT 425
           L      + ++ +LS   FI+ E     +PI+P + L ++ S +   +S    ++G ++ 
Sbjct: 277 LSKESIGLILLTVLSLVMFIHTERTTQANPIIPTKLLSQSHSTMVLVIS---VLVGFVSY 333

Query: 426 G--FYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLV- 482
              F +P+++  V+       G R+    F T  G L  G  M R  K   FLL+F +V 
Sbjct: 334 AYLFTLPLFFQIVVGDSAARAGFRLAIPSFCTPIGGLITGLSM-RIPKTLPFLLSFGMVL 392

Query: 483 GVLGQVQISYVTPSISTWRQYCLYMIP-GFGSXXXXXXXXXXXXXXXPQRHQAATTSISY 541
            ++G      +  +   W   CL + P   G                   +QA  TS  Y
Sbjct: 393 MMIGNAFFLLLKTTTPEWL-VCLLLTPANVGQGVTFPATLFSFLFSFHPENQATATSTLY 451

Query: 542 AFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKE 601
            FRS GS  GV+    + +  +  ++  KL  + SPE    E+ R+  K  H T ++ K 
Sbjct: 452 LFRSIGSLWGVAGTSGLIQLLVGRKIREKLHGILSPE----EIARLRSKIGHKTSYIEK- 506

Query: 602 APEFARHILIDCYHYAGRY----TFHFCLACMVLATVACCFIVEY---KLHAGNTAPRPQ 654
            P   +  +++ Y  A ++    +  FC+  + ++ V   F   Y   K H       P 
Sbjct: 507 LPSEIKEAVVESYESAIKFAHILSVSFCVIAIGISIVR-HFSKGYRNLKEHNDPDLESPD 565

Query: 655 RERTLNL 661
           R  +++L
Sbjct: 566 RRNSVSL 572

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 149/521 (28%), Positives = 232/521 (44%), Gaps = 41/521 (7%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           ++ A++   VFL+  DGT+  +    I +EFN +   SWI TAYL++S +FQPLYG  SD
Sbjct: 56  IIEAALFTNVFLSGFDGTVTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGSFSD 115

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
             GRR  L F+N  F +G L CG+S N+ VL   R + GIGGGGL ++ +I  +D++P  
Sbjct: 116 ALGRRNCLFFANTSFTIGCLACGLSPNIVVLSFMRALTGIGGGGLITLSTIVNSDMIPSS 175

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            R ++Q   N+                A  ++GWR  F VQVP+ + ++      L +  
Sbjct: 176 KRGIFQAFQNLLLGLGAICGASFGGSIAS-SIGWRWCFFVQVPICITNS------LIMSS 228

Query: 321 PVDAHKGAGQRSIPW----TTKLRMVDWTGTVTLVVFLFCFTLVCSLYGED--------- 367
            V   K    R I +       L+ +D TG+V +++ L    L  SL             
Sbjct: 229 YVPNQKEYEDREIGFLFHPKKILKDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPS 288

Query: 368 -LPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENR---SVLAASLSNWFCMMGMM 423
            LP L+   ++++L    F+Y+E   +   I+P+  + +     VL  S+   F     +
Sbjct: 289 VLPLLFASGIILVL----FVYNEAKTSARAIIPLELMRSSFSFVVLTISILVGFASYAYL 344

Query: 424 TTGFYIPVYYASVLNMGPTDIGKRI-VPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLV 482
              F +P+++  VL       G R+ +PS F T  G L  G  M R       L A   +
Sbjct: 345 ---FTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGGLITGICMSRYNCLQILLYAGVFL 400

Query: 483 GVLGQVQISYVTPSISTWRQYCLYMIP-GFGSXXXXXXXXXXXXXXXPQRHQAATTSISY 541
             LG     ++      W    L++IP   G                P+  QA  TS  Y
Sbjct: 401 MALGNFLFLFIEKGSPNWL-VGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLY 459

Query: 542 AFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKE 601
            FRS GS  GV++   + +      L S L  L   E   +EL+  I   +   E +H E
Sbjct: 460 LFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLD-EDKINELVTKITSNSSYIEKLHGE 518

Query: 602 APEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEY 642
                + ++IDC+  + +   H     + L  +A C I E+
Sbjct: 519 ----LKDVVIDCFDSSTKKA-HLLSTILSLLALAFCVIKEF 554

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  156 bits (395), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 137/461 (29%), Positives = 228/461 (49%), Gaps = 53/461 (11%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG F+++LDGTIV  +++ +A EF+E  +  WIAT++LL++  FQPLYGKLSD+
Sbjct: 37  ILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDV 96

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ +     +G L+  +++N+    + R + GIGGGG+ +  SIT +DI   + 
Sbjct: 97  TGRKFALLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKE 156

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLST----TAIQLFLT 317
           R +YQG  N+ F             F D  +GWR  F +QVP+ ++S       + + L+
Sbjct: 157 RGIYQGYANIVFGMGQMLGAPLGGLFID-TIGWRAIFGIQVPVVMVSAFLAYRNVNIKLS 215

Query: 318 LPKPVDAHKGAGQRSIPWTTK-LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFV 376
              P+            +T K L  +D+ G+VTL   +    ++CS    DL  L ++ +
Sbjct: 216 HVPPISER---------FTRKNLSRIDFLGSVTLASTICGVLVLCS---TDLNKL-VVSL 262

Query: 377 VILLSGSYFIYHELYVATDPILPIRFLENRSVLAA--SLSNWFCMMGMMTTGFYIPVYYA 434
               S   F++ EL+ A + ILP   L+    L++  ++ + F + G +   F  P+Y  
Sbjct: 263 ATAASFVLFLWVELFYAAERILPFELLKGPFGLSSVVTVCSSFVIFGDI---FRSPIYLQ 319

Query: 435 SVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGK-----YYWFLLAFCLVGVLGQVQ 489
            + ++  T+ G  ++    S A GSL  G  ++RT K      Y F+LA   + + G V 
Sbjct: 320 LIHDLSVTNTGLFMIFPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLTGLV- 378

Query: 490 ISY-----VTPSIST----------------WRQYCLY--MIPGFGSXXXXXXXXXXXXX 526
           ISY     V P++ST                W+   ++  ++ GFG              
Sbjct: 379 ISYYLVGVVEPALSTQMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVSIVF 438

Query: 527 XXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQL 567
              +  QA  T I Y +RS G+ LG S+   +F+N L+  L
Sbjct: 439 SIDKSQQATMTGIFYLWRSIGNVLGASLTLVVFQNSLTTSL 479

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 142/498 (28%), Positives = 228/498 (45%), Gaps = 40/498 (8%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           ++ A++   VFL+  DGT+  +    I +EFN++   +WI TAYL++S +FQPLYG  SD
Sbjct: 54  IIEATLFSNVFLSGFDGTVTASTYQTIGNEFNQMSISNWITTAYLITSTSFQPLYGSFSD 113

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
             GRR  L F+N  F +G L C +S N++ L L R +AGIGGGGL ++ +I  +D++P  
Sbjct: 114 ALGRRNCLFFANAAFTIGCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSS 173

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            R ++Q   N+                A   +GWR  FL+QVP++++S+  +  ++    
Sbjct: 174 KRGIFQAFQNLLLGFGAICGASFGGTIAS-TIGWRWCFLIQVPISIISSVLMNYYV---- 228

Query: 321 PVDAHKGAGQRSIPWTTK--LRMVDWTGTVTLVVFLFCFTLV----CSLYGEDL----PH 370
           P          +I   +K  L  +D TG++ ++  L    L     CS  G  L    P 
Sbjct: 229 PNQKEYNHENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCS--GSKLSWTSPS 286

Query: 371 LYLIFV---VILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGF 427
           + L+ V    ILL    FI HE       I+P+  + +       L +           F
Sbjct: 287 VLLLLVGSIAILL---LFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYAYLF 343

Query: 428 YIPVYYASVLNMGPTDIGKRI-VPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGV-- 484
            +P+++  VL       G R+ +PS F T  GSL  G+ M +    Y  L +   VGV  
Sbjct: 344 TLPLFFQIVLGDSTAKAGLRLAIPSLF-TPVGSLITGFSMSK----YNCLRSLLYVGVSL 398

Query: 485 --LGQVQISYVTPSISTWRQYCLYMIP-GFGSXXXXXXXXXXXXXXXPQRHQAATTSISY 541
             LG     ++  +   W    L++IP   G                P+  QA  TS  Y
Sbjct: 399 MFLGNFLFLFIEKTSPNWL-ISLFLIPANLGQGITFPTTLFTFIFLFPKSDQATATSTLY 457

Query: 542 AFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKE 601
            FRS GS  GV+I   + +   +  L S L  +   E+  ++L+  +   +   E +H E
Sbjct: 458 LFRSIGSVWGVAISAGVIQLSFAKYLRSNLKDMLD-ENTIAKLITKLNANSSYIESLHGE 516

Query: 602 APEFARHILIDCYHYAGR 619
                ++ +I+ +  A +
Sbjct: 517 ----VKNTVIESFDAATK 530

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  154 bits (390), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 144/501 (28%), Positives = 227/501 (45%), Gaps = 25/501 (4%)

Query: 136 ATRRRVVMASMCL--GVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQP 193
           + R +V++    L   VFL+ LD TI  +    I +EF ++   SWI TAYL++  +FQP
Sbjct: 37  SERHKVLLIETALFTNVFLSGLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQP 96

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITT 253
           LYG  SD  GRR  L F+N +F LG   CG +  ++ L+L R + GIGGGGL ++ +I  
Sbjct: 97  LYGSFSDTLGRRHCLFFANTIFALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIIN 156

Query: 254 TDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQ 313
           +DI+P + R +YQ   NV                A   +GWR  FL+QVP+++  T    
Sbjct: 157 SDIIPAKKRGIYQAFQNVLLGTGAVVGASCGGLIAT-TMGWRWCFLLQVPISVGGTLVAF 215

Query: 314 LFLTLPKPVDAHKG-AGQRSIPWTTKLRMVDWTGTVTLVVFLFC---FTLVCSLYGEDLP 369
            F+   +P D + G +  R+  W  KL  +D++G + LV+ L C   F  + S       
Sbjct: 216 FFVHDQRP-DINGGVSAVRTTGW-EKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSES 273

Query: 370 HLYLIFVVIL-----LSGSYFIYHELYVATDPILP---IRFLENRSVLAASLSNWFCMMG 421
           + Y    ++L     +S   F Y E     +PI+P   +R     +VL  S+   F    
Sbjct: 274 YWYSPQSIVLTLSTGVSLILFAYVEHTTKANPIIPHDLLRQAHGATVLIISVLVGFVAYA 333

Query: 422 MMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCL 481
            +   F +P+Y+  V+       G R+    F T  G L  G  MK        L++   
Sbjct: 334 YI---FTLPLYFQVVIGDTAAKAGLRLTVPSFCTPIGGLITGLSMKNPNHLPVLLISGIT 390

Query: 482 VGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISY 541
             +LG +   ++ P    W+   L +    G                P   QA  TS  Y
Sbjct: 391 CMLLGNLCFLFIKPWTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTLY 450

Query: 542 AFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKE 601
            FRS G   GV+   ++ +  + NQ    L  L + +    E+ +++ + +H+T  + K 
Sbjct: 451 LFRSVGCVWGVAGTSSLIQYAVRNQAKKSLNGLLTEK----EIRKLLLQLSHTTSQIKKL 506

Query: 602 APEFARHILIDCYHYAGRYTF 622
            P+  R  +I  Y  A R  +
Sbjct: 507 PPD-VRSAVISSYDNAIRQAY 526

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score =  153 bits (386), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 147/523 (28%), Positives = 241/523 (46%), Gaps = 35/523 (6%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           ++ A++   VFLA  DGTI  +    I +EFN++   SWI TAYL++S +FQPLYG  SD
Sbjct: 59  IIEATLFSNVFLAGFDGTITASTYQTIGNEFNQMSISSWITTAYLITSTSFQPLYGSFSD 118

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
             GRR  L F+N VF +G L C  S N+++L   R +AGIGGGGL ++ +I  +D++P  
Sbjct: 119 ALGRRNCLFFANAVFTIGCLACSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVIPSS 178

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            R ++Q   N+                    +GWR  FL+QVP++++++  +  ++   K
Sbjct: 179 KRGIFQAFQNLLLGFGAICGASFGGTITS-TIGWRWCFLIQVPISMIASLLMNYYVPNQK 237

Query: 321 PVDAHKGAGQRSIPWTTK--LRMVDWTGTVTLVVFLFCFTLV----CSLYGEDLPHLYLI 374
             D  K     +I  ++K  L+ +D TG++ ++  L    L      S    + P L L+
Sbjct: 238 EYDDQK----INILLSSKKILKDIDITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLL 293

Query: 375 F---VVILLSGSYFIYHELYVATDPILPIRFLENR-SVLAASLSNWFCMMGMMTTG--FY 428
               V+I+L    FI +E       I+P+  + +  S +  S+S    ++G  +    F 
Sbjct: 294 LASIVIIIL----FILNERKTTARAIIPMELVNSSFSFVVLSIS---ILVGFASYAYLFT 346

Query: 429 IPVYYASVLNMGPTDIGKRI-VPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQ 487
           +P+++  VL       G R+ +PS F T  GSL  G  M +       L     +  LG 
Sbjct: 347 LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITGISMSKYDCLQSLLYIGIFLMFLGN 405

Query: 488 VQISYVTPSISTWRQYCLYMIP-GFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRST 546
               ++  +   W    +++IP   G                P+R QA  TS  Y FRS 
Sbjct: 406 FLFLFIEKTSPNWL-IGVFLIPANLGQGITFPTTLFTFIFAFPKRDQATATSTLYLFRSI 464

Query: 547 GSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFA 606
           GS  GV+I   + +   +  L   L  L   EH  ++++  I   +     +H E     
Sbjct: 465 GSVWGVAISAGVIQLYFARYLRFNLKDLLD-EHTINKIITRINANSSYIGSLHGE----V 519

Query: 607 RHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHAGNT 649
           ++ +I  +  A +          +LA + C  IV+  L   N+
Sbjct: 520 KNTVIKSFDSATKKAHLMSTLLSLLALIFC--IVKDNLKKPNS 560

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score =  152 bits (384), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/332 (29%), Positives = 171/332 (51%), Gaps = 12/332 (3%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R  ++ S+ +  FLA++D TI+  +++ +  EF E  RI W+AT++LL+S  FQP+YGKL
Sbjct: 46  RLPMLLSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKL 105

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SD+ GRR +LV +  +F LG L+   ++N+W    GR + GIG GG+ +MC IT  D+  
Sbjct: 106 SDVTGRRFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFS 165

Query: 259 LRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTL 318
           ++ +++YQ   ++ +              A   VGWR  FL QVP+    T  I L L  
Sbjct: 166 VKEQSIYQSYAHIIY-TIGEVLGAPIGGIALETVGWRAIFLAQVPVL---TICIYLTLCD 221

Query: 319 PKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVI 378
                 H       + W    RM D +G++ L++ L    L+ S    +    Y +++++
Sbjct: 222 DDLAQQHIPPHGERLTWKNISRM-DLSGSILLIISLCGVILLSSATIIE----YWMWLLV 276

Query: 379 LLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFY-IPVYYASVL 437
           + S   FI +ELY  ++ I+P R L  +  +  +         +  +  Y  P++   V 
Sbjct: 277 IASAGLFIINELYWVSECIIPFRKL--KGAIGLTSLLLLVSSFIEYSELYRTPLFLQLVQ 334

Query: 438 NMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRT 469
           NM  +  G  ++ S  ++A  +L +G+ ++ T
Sbjct: 335 NMSTSTTGVVLLFSSAASAVATLLSGWVLRTT 366

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  151 bits (382), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 135/478 (28%), Positives = 221/478 (46%), Gaps = 47/478 (9%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL ALDGTIV  +++ IA EF E  +  WIAT++LL++  FQPLYGKLSD+
Sbjct: 42  ILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 202 -FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
             GR+   + +   F LG +I   ++N+    +GR V GIGGGG+++M SI  +DI   +
Sbjct: 102 ATGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAK 161

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            R +YQG  N+ F                  +GWR  F +QVP+ L       +FLT   
Sbjct: 162 ERGMYQGYANIVFGSGQLLGAPLGGLLIT-TIGWRAIFAIQVPMALFC-----MFLTGRN 215

Query: 321 PVDAHKGAGQRSIPWTTK-LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVIL 379
                     R+  +T K L  +D  G+ TLV+     + +  L+   +   + I    +
Sbjct: 216 VNIKLAHLPSRNERFTLKNLSRLDLLGSCTLVL---SISGLLFLFSTSMNRTW-ISAFTI 271

Query: 380 LSGSYFIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIPVYYASVL 437
           ++ + FIY+E + A + I+P   L   S + + L+  + F M G +   F  P+Y   V 
Sbjct: 272 VTFAIFIYNERFWAKERIIPFDLLCGTSGITSLLTVLSSFIMFGDV---FRSPIYLQIVQ 328

Query: 438 NMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGK-----YYWFLLAFCLVGVLGQ----V 488
           N+     G  I+    + A  S+  G+ ++RT        Y  +L    + ++G     +
Sbjct: 329 NVSLAKSGIFILFGSVACAATSVLTGWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAI 388

Query: 489 QISYVTPSIS------------------TWRQYCLY--MIPGFGSXXXXXXXXXXXXXXX 528
            I+ + P+ +                  TW+   ++  ++  FG                
Sbjct: 389 LIANLIPNNTTYADKDVAIKVALSAKGFTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFTV 448

Query: 529 PQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLR 586
           P+  QA  T + Y +RS G+ LG SI  A++   L ++L    M         S+L+R
Sbjct: 449 PKSQQATLTGVFYLWRSIGNVLGTSITLALYDLILKSKL-RVFMEAHGLSKSYSKLVR 505

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  151 bits (381), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 136/471 (28%), Positives = 217/471 (46%), Gaps = 53/471 (11%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ +G FL +LD TIV  +++ +A EF E  +  WI T++LL++  FQPLYGKLSD+
Sbjct: 42  ILYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ ++  F +G L   +S+NL    + R V G+G GG++++ SI+ +DI   + 
Sbjct: 102 AGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKE 161

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTL------LSTTAIQLF 315
           R +YQG  NV F               D + GW++ F  QVPL +           I+L 
Sbjct: 162 RGVYQGYANVVFGTGSMLGGPIGGWLMD-SFGWKVIFAGQVPLIMTCMFLGYRNVNIKLL 220

Query: 316 LTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIF 375
              P+              W   ++ +D  G+++L+  +  F  +CS    DL +  L+ 
Sbjct: 221 HVPPR---------HERYRW-ENIKRIDLGGSISLIGTISGFLCLCS---TDL-NKPLLA 266

Query: 376 VVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYAS 435
            + LLS   FI +ELY A + I+P   L     + + L+ +   +      F  PVY   
Sbjct: 267 TLTLLSLVLFIMNELYWAPERIIPTDLLSGTFGITSLLTVFSSFIAFGDV-FRNPVYLQL 325

Query: 436 VLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTG------KYYWFLLAFCLVGV---LG 486
           V N+ PT  G  ++ S  S+A  SL  G+ ++ T        Y    +A CL  +   LG
Sbjct: 326 VQNISPTSTGGFLLFSSISSALASLATGWILRNTSLGLATCSYLLITIAVCLHFISLSLG 385

Query: 487 QVQISYVTPSIST--------------------WRQ-YCLYMI-PGFGSXXXXXXXXXXX 524
              IS++ P+ ++                    WR  Y + MI   +G            
Sbjct: 386 YTTISHLEPNPTSHVSALDTSGTNYWFTSNQFRWRVLYVIAMILNSWGYASLLVATLVSI 445

Query: 525 XXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQ 575
               P+  QA  T   Y +RS G+ LG S    IF +  + +LY  L P+ 
Sbjct: 446 VFTIPKSQQATITGCFYLWRSIGTVLGASSVLTIFESSATTKLYQYLHPIN 496

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score =  149 bits (376), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 148/557 (26%), Positives = 244/557 (43%), Gaps = 78/557 (14%)

Query: 123 AVEAAKEDAGGLGATRR-----RVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRI 177
           A+E  KED   L    R     + V+ S+     L+ALDGTIV+T ++ +AS F +   +
Sbjct: 80  ALEGNKEDEEDLEIDLRDPKTFKWVLTSLWTNSALSALDGTIVSTTVNDVASRFQQASMV 139

Query: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFV 237
           +W+ATAYLL++   QPLYGK+SDI GRR  L+F  +VF +G  +C  SK++  L + R +
Sbjct: 140 TWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVGVGLCIFSKSIPQLAIARGI 199

Query: 238 AGIGGGGLTSMCSITTTDIVPLRSRALYQG----ICNVFFXXXXXXXXXXXXXFADRAVG 293
            GIGG G  +M +I  +D+ PL  R  Y G    +  VF              F     G
Sbjct: 200 CGIGGSGTGAMTNIILSDMAPLSERGKYWGYGSMLGGVFQSLGGPLGGILLTYF-----G 254

Query: 294 WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAH---KGAGQRSIPWTTKLRMVDWTGTVTL 350
               F+ Q+P  L +     L+L+     D +   KG+ +R          +D+ G++ L
Sbjct: 255 VSGLFIPQIPFCLAT-----LYLSWKYVQDYNQDTKGSWKR----------IDFGGSICL 299

Query: 351 VV----FLFCFTL----VCSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRF 402
           +V    F+F F+       S +    P+    F + +L    F+  E YVA + I+P+  
Sbjct: 300 LVGISSFIFFFSADENPSISEHSGWSPYKKWSFAIFVLFTILFLVVEKYVALENIIPMEV 359

Query: 403 LENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGA 462
           L+    L A +     M+   T  F +P++   V  +  +  G  IV    S + GSL +
Sbjct: 360 LKGTLGLLAFIQGLVSMIN-YTELFIVPLFLQLVWGISVSTSGAYIVCIVISYSVGSLLS 418

Query: 463 GYYMKRTGK-------YY-----WFLLAFCLVG-------------VLGQVQISYVTPSI 497
           G  +K+  K       YY     +++    +VG             V G  ++    P  
Sbjct: 419 GALIKKVAKPSRESTIYYSGVSIFYMSLISMVGYYFLDRAVRYTKPVYGDTKV----PES 474

Query: 498 STWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGA 557
             ++      + G                   ++ QA++TS+ + FRS G+ L VS+   
Sbjct: 475 LNFQLIFGITLLGLCQGSQGVTIMLYNVAKVGRKGQASSTSVQFLFRSLGNVLSVSLAFN 534

Query: 558 IFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYA 617
           +F N L   L   L           EL  ++ K        +K+ P      +++ +H A
Sbjct: 535 VFTNALRKTLGKVL------AGKNDELFALLLKDNAFLR--NKDMPTDDLDSILEAFHKA 586

Query: 618 GRYTFHFCLACMVLATV 634
              +F  C+ C++L+ +
Sbjct: 587 LVSSFVPCIWCLILSVI 603

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  147 bits (372), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 142/495 (28%), Positives = 222/495 (44%), Gaps = 60/495 (12%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG F++ALDGT+V  +++ IA+EF E  +  WIAT+YLL++  FQPLYGKLSDI
Sbjct: 44  ILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  ++ ++  F LG L+   ++N+    + R + GIGGGG+ +M SIT TDI   R 
Sbjct: 104 TGRKVAVITAHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARE 163

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKP 321
           R +YQG  NV F               D ++GWR  F +QVP+ +L +    L L     
Sbjct: 164 RGVYQGYANVVFGTGQLLGAPIGGFLLD-SIGWRSIFGIQVPMLMLCSV---LALKNVNI 219

Query: 322 VDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLF-CFTLVCSLYGEDLPHLYLIFVVILL 380
              H         W   L  +D  G+++LV  +     L  S + + L  ++ +     L
Sbjct: 220 KLVHIPPRNERFTW-KNLSRIDIFGSISLVATISGILFLTSSNWNKSLLGIFTV-----L 273

Query: 381 SGSYFIYHELYVATDPILPIRFLENRSVLA--ASLSNWFCMMGMMTTGFYIPVYYASVLN 438
           S S FIY ELYVA + I+P   L+    L+  A++   F + G +   F  P+Y   + N
Sbjct: 274 SFSLFIYIELYVAKERIMPFELLKGSFGLSSIATVITSFIIYGEI---FRSPIYLQLIQN 330

Query: 439 MGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL--GQVQ------- 489
           +  T  G  ++    + A GS+  G  ++ T       LA C   ++  G +        
Sbjct: 331 VSVTVTGLYLIFPSVAIALGSIVTGSILRNTKMD----LAHCAAAIIFGGMIMQLAGLAL 386

Query: 490 ----ISYVTPSI--------------------STWRQYCL---YMIPGFGSXXXXXXXXX 522
               +S+V P++                    S W +       +I   G          
Sbjct: 387 SYYLLSHVNPALDLADLPANLFSAATIYFVSDSIWWKIVYVGALVIGSSGYASLLVATLV 446

Query: 523 XXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSP----E 578
                  +  Q   T I Y +RS G+ LG SI   +F   L   L+  +    S      
Sbjct: 447 SIVFTVDRSKQGTITGIFYLWRSIGNVLGASITLVVFERSLGRMLWEFMFGDSSTTGSYR 506

Query: 579 HPASELLRIIEKAAH 593
              SE  R+I  +++
Sbjct: 507 FKKSEYRRLISDSSY 521

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  139 bits (351), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/353 (31%), Positives = 175/353 (49%), Gaps = 32/353 (9%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL+++D TIV  +++ +A EF E     WIAT++LL++  FQPLYGKLSDI
Sbjct: 36  ILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDI 95

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ +   F LG  +  +S N+    + R + GIGGGG+ ++ SIT  DI   + 
Sbjct: 96  TGRKFALLTALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKD 155

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTL--- 318
           R +YQG  N+ F             F    +GWR  F +QVPL +++    ++++ +   
Sbjct: 156 RGIYQGYANIVFGMGQLLGAPVGGLFI-ATIGWRALFWIQVPLVIIAIILGEMYVNIKLV 214

Query: 319 --PKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFV 376
             P P +  K        W    R +D+ G+ TLV  + CF ++ S     +    L  +
Sbjct: 215 HVPPPSERFK--------WKNISR-IDFLGSFTLVSSITCFIILISTKSNVILLSLLSVL 265

Query: 377 VILLSGSYFIYHELYVATDPILPIRFLENR---SVLAASLSNWFCMMGMMTTGFYIPVYY 433
             +     FIY ELYV+ D ILP   L+     + +A  +S+ + + G +   F  P+Y 
Sbjct: 266 SFI----AFIYVELYVSKDRILPFELLKGSFGCNSIATVISS-YVIFGEI---FRSPIYL 317

Query: 434 ASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTG------KYYWFLLAFC 480
             V +      G  ++    +TA GSL  G  +KRT        Y   LL  C
Sbjct: 318 QLVQDFSVIKTGIFLIFPAITTAIGSLVTGAILKRTKLDLAYCSYKLVLLGLC 370

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 144/486 (29%), Positives = 223/486 (45%), Gaps = 63/486 (12%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL ALDGTIV  +++ IA EF E  +  WIAT++LL++  FQPLYGKLSD+
Sbjct: 42  ILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 202 -FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
             GR+   + +   FCLG +I   ++N+    +GR V GIGGGG+ +M SI  +DI   +
Sbjct: 102 ATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAK 161

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLL------STTAIQL 314
            R +YQG  N+ F                  +GWR  F +QVP+TLL          I+L
Sbjct: 162 ERGMYQGYANIVFGSGQLLGAPLGGLLIT-TLGWRAIFAIQVPVTLLCMVLAFRNVNIKL 220

Query: 315 FLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYL- 373
              LP P +               L  +D  G+ TLV+     + +  L+   L  L++ 
Sbjct: 221 -AHLPPPKECFT---------LKNLSRLDLLGSCTLVM---SISGLLFLFSTTLNKLWIS 267

Query: 374 IFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLS--NWFCMMGMMTTGFYIPV 431
           IF  +  S   F+Y+E Y AT+ I+P   L   S + ++L+  + F M G +   F  P+
Sbjct: 268 IFTAV--SFGLFVYNEYYWATERIIPFELLRGESGVTSALTVLSSFVMFGDV---FRSPI 322

Query: 432 YYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGK-----YYWFLLAF------- 479
           Y   V N+     G  I+    + A  S+  G+ ++RT        Y  +L         
Sbjct: 323 YLQVVQNVSLARSGLFILFGSIACAGSSMLTGWLIRRTNMGLVKCAYLIVLGMIISQLAG 382

Query: 480 -----CLVGVLGQVQISY-VTPSIST---------WRQYCLY----MIPGFGSXXXXXXX 520
                 L+  L   Q S+ +T SI+          W+   +Y    ++  FG        
Sbjct: 383 TAINAVLIAKLKPNQTSHALTDSITQQTLQPEGLLWK--IIYVSATVLNTFGYGGVLVAV 440

Query: 521 XXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHP 580
                   P+  QA  T + Y +RS G+ LG S+   ++   L  +L+ K M        
Sbjct: 441 LVSIVFTVPKSQQATLTGVFYLWRSIGNVLGTSVTLTLYDLTLKAKLW-KYMSSNGLSSS 499

Query: 581 ASELLR 586
            ++L+R
Sbjct: 500 YTQLIR 505

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  142 bits (357), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 135/483 (27%), Positives = 218/483 (45%), Gaps = 45/483 (9%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FL+ALD TIV  +++ +A +FN   +  WIAT+YLL++  FQPLYG+LSDI
Sbjct: 68  ILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDI 127

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+   +     F +G+ +   SK L    L R VAGIGGGG+++M SI  +DI  ++ 
Sbjct: 128 IGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKE 187

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLP-- 319
           R +YQG  N+F+               DR +GWR  F  QVP+      A+ +FL+    
Sbjct: 188 RGMYQGYANIFYGAGQLIGAPIGGLLIDR-IGWRALFAFQVPM-----VAVAMFLSFTYL 241

Query: 320 KPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVIL 379
               AH    +    W   L  +D  G++TLV+ +    ++ S  G +     ++  + L
Sbjct: 242 NIKLAHLPPKEERYKW-KHLSKLDIFGSITLVITIGICIVILSDNGLN---RMVLGAMGL 297

Query: 380 LSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM 439
           LS   F+  E Y     ILP++ L+  S   ASL+       +    F  P+Y   + N 
Sbjct: 298 LSFGLFLIIEKYYTKHQILPLKCLQG-SFGYASLTIIISTYVIFGEYFRTPIYLQVIQNF 356

Query: 440 GPTDIGKRIVPSFFSTAFGSLGAGYYMKRTG-----------------KYYWFLLAFCLV 482
             +  G  ++      A GS+  G  +K++                  ++   L+   L+
Sbjct: 357 TVSQSGIFLLFPTICVAGGSVLTGRVLKQSKMDLEKCSYQLIFYSVCTQFVGLLMLTLLI 416

Query: 483 GVLGQVQISYVTPSIS-----------TWR-QYCLYM-IPGFGSXXXXXXXXXXXXXXXP 529
             L     +   P +            +W+  +C+   +  FG                 
Sbjct: 417 NYLHIFNSNNTKPGVGNIFHELTTVDFSWKIIFCIATSLVTFGYASILVATLVSIVHTVE 476

Query: 530 QRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIE 589
           +  Q + T + Y +RS G+ LG SI    + N L+++LY K M  ++PE     +  I E
Sbjct: 477 KSQQGSITGLFYLWRSLGNVLGTSITLITYENNLTSKLY-KFM-FENPEQHMDYIFTIEE 534

Query: 590 KAA 592
             A
Sbjct: 535 YKA 537

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  140 bits (353), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 136/465 (29%), Positives = 214/465 (46%), Gaps = 51/465 (10%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG F+ +LDGTIV  +++ +A EF E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 35  ILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDI 94

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GRR  L+ ++  F LG L+   ++++    L R + GIGGGG+ +  SI  +DI   + 
Sbjct: 95  TGRRFALLTAHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKE 154

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPL----TLLSTTAIQLFLT 317
           R  YQG  N+ F               D  +GWR  F VQVP+    + L+   I + L+
Sbjct: 155 RGSYQGYANIVFGTGQMLGGPIGGLLID-TIGWRAIFAVQVPIIMFCSFLTYKNITIKLS 213

Query: 318 LPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVV 377
              PV            W   L  +D  G+ +LVV +     +CS     +    ++   
Sbjct: 214 HIPPVSER-------FTW-MNLSRIDIMGSSSLVVVICGILFICSTNWNKV----ILSTF 261

Query: 378 ILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTG--FYIPVYYAS 435
            ++   +FI  E Y A + ILP++ L+  S L + ++    +   +T G  F  P+YY  
Sbjct: 262 TIVGFLFFIVTETYFAKECILPLKLLKGASGLCSLVT---VLSSFITFGEIFRAPIYYQV 318

Query: 436 VLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRT----GKYYWFLLAFC----LVG-VLG 486
           V +M  T  G  ++    S A GS+  G  ++ T    G Y + ++       L+G +L 
Sbjct: 319 VQDMSVTKTGLFVLFPAVSVAVGSVVTGTALRHTKLDLGHYCYLIILRSIFTQLIGLLLA 378

Query: 487 QVQISYVTPSI-----------------STWRQYCLY---MIPGFGSXXXXXXXXXXXXX 526
            V I+   P+I                 S W +  L     +  +G              
Sbjct: 379 YVVINGTEPTIGASSSTFAVHWFQFSSDSIWWKILLVSAGCMVSYGYSGLLVATLVSIVC 438

Query: 527 XXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
              +  QA  T I Y +RS GS LG S+   I+ N L+  L+  +
Sbjct: 439 SVEKSEQATLTGIFYLWRSIGSVLGTSLTLVIYENSLTKSLWGAM 483

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  129 bits (324), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 130/515 (25%), Positives = 224/515 (43%), Gaps = 30/515 (5%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           ++ A++   VFL+  D T+  +    I +EFN +   SWI  +YL++S +FQPLYG  SD
Sbjct: 68  LIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLSSWITASYLITSTSFQPLYGSFSD 127

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
           + GRR  L F++++F +G L CG+S N+  L   R   GIGGGGL ++ +I  +D++P  
Sbjct: 128 VLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGLITLSTIVNSDMIPTS 187

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            R ++Q   N+                   ++GWR  FL+QVP++L       L++    
Sbjct: 188 KRGIFQAFQNLLLGLGAICGASFGGVITS-SIGWRWCFLLQVPISLAGALIGHLYVRNQD 246

Query: 321 PVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGE--------DLPHLY 372
             +  K   + S      L+ +D++G   +++ L    +  SL             P L 
Sbjct: 247 EYERRK--SKESSQTKEMLKHIDFSGAFLIIIGLTLQLVYLSLGSAADESGNTWSSPGLS 304

Query: 373 LIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTG--FYIP 430
            + V   +    F+  E   +   I+P + +  RS+ +  +     ++G  +    F +P
Sbjct: 305 AVLVASFIVLVLFVLTEERTSARAIIPSKLV--RSLFSFLVLTISVLVGFASYAYLFTLP 362

Query: 431 VYYASVLNMGPTDIGKRI-VPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQ 489
           +++  +L       G R+ +PS F T  G L AG  M +       L        LG   
Sbjct: 363 LFFQVILGDSTAKAGLRLAIPSVF-TPVGGLIAGICMSKFNCLQTLLYVGIAFMCLGNFL 421

Query: 490 ISYVTPSISTWRQYCLYMIP-GFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGS 548
             Y+    +T      ++IP   G                 +  QA  TS  Y FRS GS
Sbjct: 422 FLYIGAD-ATDSLIGFFLIPANLGQGITFPSSLFTFIFAFSKIDQATATSTLYLFRSIGS 480

Query: 549 TLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHK-EAPEFAR 607
             GV+    I +   S+ L   L  L        ++ ++I+K   +T ++ + E P   +
Sbjct: 481 VWGVTGSAGIVQFCFSHHLEKALEGLLDER----KIRKLIKKITSNTSYIKELEGP--VK 534

Query: 608 HILIDCYHYAGR----YTFHFCLACMVLATVACCF 638
             +I+ +  A +     +  FCL  ++L  +   F
Sbjct: 535 VAVIESFDTATKKVHLISTSFCLVALILCVIKDVF 569

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score =  128 bits (322), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 127/461 (27%), Positives = 204/461 (44%), Gaps = 55/461 (11%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           V+ S+     LAALDGTIV+T ++ IAS+F +   ++W+ATAYLL++   QPLYGK+SDI
Sbjct: 62  VLTSIWTNSALAALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDI 121

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GRR  L+F  ++F LG L+C  +  +  L + R + GIGG G ++M +I   DI+PL  
Sbjct: 122 IGRRKCLLFGEVIFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSV 181

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKP 321
           RA Y                        +  G    F  Q+P  + S     ++L+  K 
Sbjct: 182 RATYWSY-GAILASIFQSLGGPIGGLLLKWFGVGGLFTPQIPFCIGS-----IYLSY-KY 234

Query: 322 VDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLY--------GEDLPHLYL 373
           +  +K   + S  W    + +D+ G++ L+V +  F    S          G   P  + 
Sbjct: 235 IHDYKEHARSS--W----KRIDFGGSICLLVGISSFIFFFSASDNTTIEDDGWSTPKKWS 288

Query: 374 IFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMM-----TTGFY 428
           + V++++S   F + E +VA + I+P      R +L  +L    C+ G++     T  F 
Sbjct: 289 V-VLLIVSIIAFAFIENFVAVECIIP------RVILEGTLGLMVCIHGLVAVINYTCLFM 341

Query: 429 IPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC-------- 480
           +P++      +  +  G  I+     ++ GSL     + R  K       FC        
Sbjct: 342 VPLFLQLNWGVSVSRSGGYIMFIVIFSSAGSLFTSMILNRFSKPTRSSQLFCAASAIFYM 401

Query: 481 -LVGVLG----QVQISYVT---------PSISTWRQYCLYMIPGFGSXXXXXXXXXXXXX 526
            ++ ++G    Q  I Y           P    W       I GF               
Sbjct: 402 SILTIVGYYYMQKAIYYSKPIYGSDTQIPKYDNWSIILGIAILGFCQGSQNVTISIYNVA 461

Query: 527 XXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQL 567
              ++ QA++TS++  FRS G+ L VSI   IF N L  +L
Sbjct: 462 KVGRKEQASSTSVNLLFRSMGNVLSVSIALNIFTNVLKKKL 502

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score =  124 bits (312), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 125/432 (28%), Positives = 203/432 (46%), Gaps = 28/432 (6%)

Query: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFV 237
           +WI TAYL++S +FQPLYG  SD  GRR  L F+N  F +G L CG SKN+++L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAL 64

Query: 238 AGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMA 297
            GIGGGGL ++ +I  +D++P   R ++Q   N+                A  ++GWR  
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIAS-SIGWRWC 123

Query: 298 FLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVV----- 352
           FL+QVP++++S+  +  ++   K  +    +  ++ P    LR +D  G++ ++      
Sbjct: 124 FLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQN-PGKI-LRDIDVMGSILIITGLTLQ 181

Query: 353 ----FLFCFTLVCSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENR-S 407
                L C T   S     +  L +  V+ILL    FI HE   +   I+P+  + +  S
Sbjct: 182 LLYLSLGCSTSKLSWTSPSVLLLLVGSVIILL---LFILHERKTSARAIIPMELVNSSYS 238

Query: 408 VLAASLSNWFCMMGMMTTG--FYIPVYYASVLNMGPTDIGKRI-VPSFFSTAFGSLGAGY 464
           V+  S+S    ++G  +    F +P+++  VL       G R+ +PS F T  GSL  G+
Sbjct: 239 VVVLSIS---ILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITGF 294

Query: 465 YMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIP-GFGSXXXXXXXXXX 523
            M +       L     +  LG     ++  +   W    L++IP   G           
Sbjct: 295 SMSKYNCLRLLLYIGISLMFLGNFLFLFIEKTSPNWL-IGLFLIPANLGQGITFPTTLFT 353

Query: 524 XXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASE 583
                 +  QA  TS  Y FRS GS  GV+I   + +   +  L S L  L   E+   +
Sbjct: 354 FIFMFSKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAGLLRSNLKGLLD-ENKIKK 412

Query: 584 LLRIIEKAAHST 595
           L  I++ +A+S+
Sbjct: 413 L--IVQLSANSS 422

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  122 bits (306), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 120/434 (27%), Positives = 199/434 (45%), Gaps = 33/434 (7%)

Query: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFV 237
           +WI TAYL++S +FQPLYG  SD  GRR  L F+N  F +G L CG S N+++L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRAL 64

Query: 238 AGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMA 297
            GIGGGGL ++ +I  +D++P   R ++Q   N+                A   +GWR  
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIAS-TIGWRWC 123

Query: 298 FLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVV----- 352
           FL+QVP++++S+  +  ++   K  +  + +   + P    L  +D  G++ ++      
Sbjct: 124 FLIQVPISMISSILMNYYVPNQKEYN-DQNSNIFNDP-KKILTGIDVMGSILIITGLTLQ 181

Query: 353 ----FLFCFTLVCSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENR-S 407
                L C T   S     +  L    V+ILL    FI HE       I+P+  + +  S
Sbjct: 182 LLYLSLGCSTSNLSWTSPSVLLLLFGSVIILL---LFILHERKTTARAIIPMELVSSSYS 238

Query: 408 VLAASLSNWFCMMGMMTTG--FYIPVYYASVLNMGPTDIGKRI-VPSFFSTAFGSLGAGY 464
            +  S+S    ++G  +    F +P+++  VL       G R+ +PS F T  GSL  G+
Sbjct: 239 FVVLSIS---ILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLITGF 294

Query: 465 YMKRTGKYYWFLLAFCLVGV----LGQVQISYVTPSISTWRQYCLYMIP-GFGSXXXXXX 519
            M +    Y  L +   +G+    LG     ++  +   W    L++IP   G       
Sbjct: 295 SMSK----YNCLRSLLYLGISLMFLGNFLFLFIEETSPNWL-ISLFLIPANLGQGITFPT 349

Query: 520 XXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEH 579
                    P+  QA  TS  Y FRS GS  GV+I   + +   +N L + L  L     
Sbjct: 350 TLFTFIFMFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGLLDENT 409

Query: 580 PASELLRIIEKAAH 593
               ++++ + +++
Sbjct: 410 IKKLVIKLSDNSSY 423

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 121/467 (25%), Positives = 207/467 (44%), Gaps = 53/467 (11%)

Query: 142 VMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 201
           ++ S+ LG FLA++D +IV  +++ IA EF+E  +  W+AT++LL++A FQPLYG+ SDI
Sbjct: 46  ILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDI 105

Query: 202 FGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRS 261
            GR+  L+ +   F LG L+   ++N+    + R + G+GGGG+ +M SIT +DI   + 
Sbjct: 106 VGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKE 165

Query: 262 RALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTL----LSTTAIQLFLT 317
           R +YQG  NV F               +    WR+ F  QV   +    L+   I L L 
Sbjct: 166 RGMYQGYANVIFGAGQVLGAPVGGLIME-TFNWRIIFAAQVVAIMICMILAYRNINLKLL 224

Query: 318 LPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVV 377
              P   H+   +++      L  +D  G+  L   L  F +   L+   +    L F++
Sbjct: 225 HIPPF--HQRFTRKN------LSRIDLFGSSMLSCSLVSFLM---LFSSGVSR-SLWFLL 272

Query: 378 ILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVL 437
            L+S + F  +E Y+AT+ +LP   L     L+A L      M M    + +PVY   + 
Sbjct: 273 TLVSLTLFCINERYIATERLLPNGILRGHFGLSALLIVVSSFM-MFAELYRMPVYLQLIQ 331

Query: 438 NMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGK-----YYWFLLAFCLVGVLGQV---- 488
           ++  +  G  ++ +  S++  SL  G+ ++ T +      Y   LA   + ++G +    
Sbjct: 332 DISVSRSGIFLLFASVSSSGASLFTGWLLRTTKQDLGKLVYKIALASSFIQLVGMMLALF 391

Query: 489 ------------------------QISYVTPSISTWRQY--CLYMIPGFGSXXXXXXXXX 522
                                   Q+ Y       WR       M   F           
Sbjct: 392 TTSVTEPSQAVHAGWAVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLLVSILV 451

Query: 523 XXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYS 569
                  +  QA    + Y +RS G+TLG S+  +++   ++ +L+ 
Sbjct: 452 SIVDTTEKSQQATMIGVFYLWRSIGNTLGASVPLSVYEFEVARKLWD 498

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score =  115 bits (288), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 151/713 (21%), Positives = 268/713 (37%), Gaps = 95/713 (13%)

Query: 7   GLKTKQRDRLREFAKRKERQRAL------------------AGQNQAGVGQDXXXXXXXX 48
           G K KQR RLR+FAK KE+QR L                    QN      D        
Sbjct: 2   GRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNIE 61

Query: 49  XXXXGEQSGLL--EASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXX 106
                E + LL  + S   +    SSG+  L +  +E   ++EV +    +         
Sbjct: 62  DNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISDDNQ 121

Query: 107 XXXXTQKP----TEVYLTATAVEAA--------------------------KEDAGGLGA 136
                 +P     E+  +A+  EA                            E+   L  
Sbjct: 122 LIEEPSRPQSSREEISSSASTNEAPIVPHKKIHSPSYGSIEQRLSHEEPAFTEEVVDLET 181

Query: 137 TRRRVVMAS-----------MCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYL 185
             R + + +             L +F    D T+   L     S   +    SWI  +YL
Sbjct: 182 NNRDISLLNEPQLTAGMIFLFSLLLFTIIFDFTLAMMLSTTSGSHVKQSSNSSWIIASYL 241

Query: 186 LSSATFQPLYGKLSDIFGR-RPLLVFSNLVFCLGALICGMSK-NLWVLVLGRFVAGIGGG 243
           ++    Q L  ++S  +   + L     ++F +G+ I  +   + W +V+ RF+ G+  G
Sbjct: 242 ITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASG 301

Query: 244 GLT-SMCSITTTDIVPLR-SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQ 301
            L   M +I    I+  R SR   +      F              A     W+  + + 
Sbjct: 302 SLIYVMLTIINKCILNKRFSRPSMK-----IFTIPIVGGLSLAYATAIFITSWQNVYFLL 356

Query: 302 VPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVC 361
              +  +   I  +     P +        ++        +D  G   L VFL    ++ 
Sbjct: 357 AIFSFFTLFLIMFYF----PSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIAVIT 412

Query: 362 SLYGEDL----PHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWF 417
           +          P+   + + I+L G   +  E     +PI+P+ F+EN+ +   SL+ +F
Sbjct: 413 TGNSNGFSITSPYSATLVISIILVGILLLLSETTTNKNPIIPLDFIENKVIFFKSLTVFF 472

Query: 418 CMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLL 477
             M ++T   Y P Y    LN+   DI KR  P F +  F  +     +       + L+
Sbjct: 473 ASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLSYGLV 532

Query: 478 AFC-LVGVLGQ-VQISYV---TPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRH 532
            F  ++G++GQ + ++YV   T     W+Q  + ++P  GS                 + 
Sbjct: 533 TFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGS---TFLVIATLMDVTDDKK 589

Query: 533 QAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAA 592
               ++ S+A  + GS LG+ I G IF  GL ++L+     + S E     L +II K  
Sbjct: 590 LPIISTSSFAVSTLGSILGICISGFIFNQGLYDELW-----VHSTEEKG--LGKIIRKMI 642

Query: 593 HSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645
           +++E+  + +  +  + +++ Y     Y F F   C+++A ++ CF ++ K H
Sbjct: 643 NNSEY--ESSSRYYCYEILESYFIVSGYVFLFSAICLLVAVISFCFTIKNKRH 693

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 110/451 (24%), Positives = 193/451 (42%), Gaps = 36/451 (7%)

Query: 150 VFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLV 209
           +F+ ALD  IV T++D + + F +  +  WI T Y L +A F  L+G+LS + G R  ++
Sbjct: 54  MFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVI 113

Query: 210 FSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGIC 269
              ++F  G+LI  ++K++ +L+ GR +AG+GG GL ++  +    +V  +SR L   + 
Sbjct: 114 SCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLL 173

Query: 270 NVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAG 329
           N  F             F    V WR  F + +P+  L+  AI +F   P+  D  +   
Sbjct: 174 NCTFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLA-IAIFIFFYNPEGADLLEKGS 231

Query: 330 Q--------RSIPWTTKLRMVDWT----GTVTLVVFL---FCFTLVCSLYGEDLPH---- 370
           Q        R    + K +++D        V+ V+F      F L  +  G+  P     
Sbjct: 232 QTFKKLLSYRRANLSLK-QLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGI 290

Query: 371 -LYLIFVVILLSGSYFIY------HELYVAT-DPILPIRFLENRSVLAASLSNWFCMMGM 422
            +  I V +LL     IY      H   + T  P+L    +  R++L A+ + +F  +  
Sbjct: 291 VISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAY 350

Query: 423 MTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLV 482
                Y   ++  V        G  ++P   ST   S+ +G  +K+TG     L+    +
Sbjct: 351 NVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAM 410

Query: 483 GVLGQVQISYVTPSISTWRQYCLYMIP----GFGSXXXXXXXXXXXXXXXPQ--RHQAAT 536
           GVLG   +  +  + +   Q  + ++P    GF                 P        T
Sbjct: 411 GVLGSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDRTSPSYGADMLET 470

Query: 537 TSISYAFRSTGSTLGVSIGGAIFRNGLSNQL 567
           TS++   +S G+T+G  +   +F   L N++
Sbjct: 471 TSVNALLKSLGTTVGSILSTMVFSTSLHNKM 501

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score =  103 bits (256), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 114/499 (22%), Positives = 206/499 (41%), Gaps = 56/499 (11%)

Query: 150 VFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLV 209
           +F+ ALD  IV T++D +   F +  +  WI T Y L +A F  L+ +LS + G R  +V
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 210 FSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGIC 269
              ++F  G+LI  ++ ++ +L+ GR VAGIGG GL ++  +    +V  +SR L   + 
Sbjct: 114 SCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 173

Query: 270 NVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAG 329
           N  F             F    V WR  F + +P+  L+  AI +F   P+ V+  +  G
Sbjct: 174 NCTFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLA-IAIFVFFYNPEGVNLLEKFG 231

Query: 330 QRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVILLSG------- 382
             +    +    V  +    L   LF F ++  +        +L+F++ L  G       
Sbjct: 232 N-TFKKVSSFHPVKKSPKKVLQQLLFGFDILSFI---SFTAGWLLFLLALTFGGQTHAWN 287

Query: 383 -----SYFIYHELYVATD------------------PILPIRFLENRSVLAASLSNWFCM 419
                S+ I   L +A                    P+L    + NRS+L ++ + +F  
Sbjct: 288 SGIVISFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFST 347

Query: 420 MGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAF 479
           +       Y   ++  V        G  ++P   ST   S+ +G   K+TG     L+  
Sbjct: 348 VAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFG 407

Query: 480 CLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQA----- 534
             +GVLG   ++ +    +   Q  + ++PG                   + + +     
Sbjct: 408 SAMGVLGGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKGNPSYGADL 467

Query: 535 -ATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQL---------YSKLMPLQS--PEH--- 579
             TTS++   +S G+TLG  +   +F   ++N++         Y +L  + S   +H   
Sbjct: 468 LETTSVNALLKSLGTTLGSILSTMVFSTSMNNKMKHGGLSLEEYDRLDGIASYRMDHFDG 527

Query: 580 PASELLRIIEKAAHSTEWV 598
           P SE+  I+  +  +  W+
Sbjct: 528 PRSEMGYILSDSIKNAFWM 546

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 99.8 bits (247), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 107/466 (22%), Positives = 197/466 (42%), Gaps = 41/466 (8%)

Query: 143 MASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF 202
           +AS+ L +F+ ALD  IV T++D +A +F    +  W+ T Y L +A    ++G+ + I 
Sbjct: 40  LASLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASII 99

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
           G +  L+ + L+F  G+LI  ++ ++ +L+ GR VAG+GG GL ++C +    +V  RSR
Sbjct: 100 GFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSR 159

Query: 263 ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPV 322
            L   I +  F             F    V WR  F + +P+  L   AI +FL   K  
Sbjct: 160 PLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGL---AIIMFLLTYKAE 215

Query: 323 DA------HKGAGQRSIPWTTKLR--------------MVDWTG----TVTLVVFLFCFT 358
           +           G  S    +K R                D+ G    +  LV+FL   T
Sbjct: 216 NKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLT 275

Query: 359 LVCSLY----GEDLPHLYLIFVVILLSGSY--FIYHELYVATD-----PILPIRFLENRS 407
              + Y    G+ + +L L  ++ + S  Y  F++ +     D     P+L  R +   +
Sbjct: 276 FGGNKYSWNSGQVITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPA 335

Query: 408 VLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMK 467
           ++  ++  +    G      Y   ++  +        G  ++P   +    ++ +G   K
Sbjct: 336 IIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGVITK 395

Query: 468 RTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFG-SXXXXXXXXXXXXX 526
           + G     L+   ++GV+G   ++ +T + +   Q  + ++PGF                
Sbjct: 396 KLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQ 455

Query: 527 XXPQRHQAATTSISY-AFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
               R +AA   I   AF +   +LG ++GG +     S   ++K+
Sbjct: 456 ITKDRPEAAMDFIEVTAFNTFMKSLGTTLGGVLSTTVFSASFHNKV 501

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 99.4 bits (246), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 89/338 (26%), Positives = 147/338 (43%), Gaps = 41/338 (12%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           V + S+C+ +FL ALD  I  TL D I  EFN+   + W+   Y L +A F  L+G+++ 
Sbjct: 8   VCVTSLCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIAS 67

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
           + G +  L+ S ++F  G+L+ G + ++ +L+  R ++G GG G+ S+     T IV  +
Sbjct: 68  LVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEK 127

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLT--- 317
            RA    +  + +              A+  V WR  F V +P+  ++  A+        
Sbjct: 128 HRARVITVLGIAYMLAEGAGPFVGGGLAEH-VSWRWCFYVNLPIGGVALAALGWGYNPAG 186

Query: 318 -LPKPVDAHKGAGQRSIPWTTKLRMVDW-------------------TGTVTLVVFLFCF 357
             P    A      R+ P+ T L+   W                   +G   LV+    F
Sbjct: 187 RAPGRALARFWVRARAFPYGTLLQAQFWRRAAALMVFRLDIPGLALSSGGFALVMLALTF 246

Query: 358 ----------TLVCS-LYGEDLPHLYLI--FVVILLSGSYFIYHELYVATDPILPIRFLE 404
                     T+VC  ++G  L  L+++  FVV+   G+    +E      P++P R   
Sbjct: 247 GGNQYAWRSATIVCMFVFGAALLALFMLYDFVVLPRVGARIAGYE----PLPLVPWRLAA 302

Query: 405 NRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPT 442
           N  VL +SL  +F          Y+  YY  V+N GPT
Sbjct: 303 NVPVLTSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPT 340

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 109/460 (23%), Positives = 194/460 (42%), Gaps = 38/460 (8%)

Query: 150 VFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLV 209
           +F+ ALD  IV T++D +   F +  +  WI T Y L +A F  L+G++S   G R  +V
Sbjct: 53  MFVTALDVLIVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIV 112

Query: 210 FSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGIC 269
              ++F  G+LI  +++++ +L+ GR V+G+GG GL ++  +    +V  +SR L   + 
Sbjct: 113 ACIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 172

Query: 270 NVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAH-KGA 328
           N  F             F    V WR  F + +P   +   AI  FL    P + +    
Sbjct: 173 NCTFAIASIIGPFIGGAFTTH-VTWRWCFYINLP---IGGVAILTFLCFYNPHNENLLEE 228

Query: 329 GQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVC-SLY--GEDLPHLYLIF---------- 375
           G+++     K +      +  +   LF F +V  +L+  G  L  L L F          
Sbjct: 229 GKKAFKRVLKFKPTSLFSSKAMHQLLFGFDIVSFALFTAGWVLFLLALTFGGQSYSWDSG 288

Query: 376 VVI--------LLSGSYFIYHELYVATD------PILPIRFLENRSVLAASLSNWFCMMG 421
           VVI        L+  S F   +L+ A        P+L  R +   +++ ++ S +F  + 
Sbjct: 289 VVISFLVVGILLILLSLFYDFKLFEAMKSQENIRPLLCWRLMSQPTIVLSNFSGFFSTVA 348

Query: 422 MMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCL 481
                 Y   ++  V        G  ++P   ST   S+ +G   K+TG     L+    
Sbjct: 349 YNVQMIYSVQFFQLVYGFTAWKAGLHLIPILVSTVVFSIMSGVLTKKTGHIKPLLVFGSA 408

Query: 482 VGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQ------AA 535
           +GVLG   ++ +  + +   Q  + ++PG                   + +         
Sbjct: 409 MGVLGGGLMTLLNNTSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKSNSRYGADMLE 468

Query: 536 TTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQ 575
            TS++   +S G+TLG  +   IF   + N++ S+ M L+
Sbjct: 469 VTSVNALLKSLGTTLGSILSTMIFSTSMYNKMKSRGMSLE 508

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 85/164 (51%), Gaps = 3/164 (1%)

Query: 153 AALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSN 212
           AALD  IV TL + I  +FN+   + W+ T Y LSSA F  L+G+++ + G +  L+ S 
Sbjct: 56  AALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSV 115

Query: 213 LVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVF 272
           L+F +G+LI  +S ++ +L+ GR VAG GG G+ S+  I  T +V  RSR +   +    
Sbjct: 116 LIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFA 175

Query: 273 FXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFL 316
           F               + A  WR  F + +P+      A  LFL
Sbjct: 176 FVGSNAGGPILGGALNEHA-SWRWCFFINLPIG--GAAAFMLFL 216

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 144/334 (43%), Gaps = 35/334 (10%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           V + S+ L +FL ALD  I  TL D I   FN+   + W+ T Y L +A    L+G+++ 
Sbjct: 8   VCIFSLSLTLFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIAS 67

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
           + G +  LV S ++F  G+L+  ++ ++ +L+ GR +AG GG G+ ++     T +V  +
Sbjct: 68  LVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEK 127

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320
            RA    I  + +             FA+  V WR  F + +P+  ++  AI  +   P 
Sbjct: 128 HRARVVTILGIAYMLAEGAGPFIGGAFAEH-VSWRWCFFINIPIGGVA-LAILCWGYNPA 185

Query: 321 ---PVDA--HKGAGQRSIPWTTKLRMVDWTGTVTLVVF-LFCFTLVCSLYGEDLPHLYLI 374
              P++A  H     R   W    R+   T  V L ++ L    L+ S  G  L  L L 
Sbjct: 186 GRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGGFALIMLALT 245

Query: 375 F-----------------VVILLSGSYFIYHEL---YVA-------TDPILPIRFLENRS 407
           F                 + I L G + +Y  +   Y+          P++P     N  
Sbjct: 246 FGGNKFAWNSASIICMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLVPWSLACNMP 305

Query: 408 VLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGP 441
           +L +S++ +F          Y+  YY  V N GP
Sbjct: 306 ILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGP 339

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 91/162 (56%), Gaps = 1/162 (0%)

Query: 143 MASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF 202
           + S+ L +FL+ALD  IV+T+++ ++ +FNE  +  W+ T Y L +A    ++G+ + I 
Sbjct: 46  LGSLTLALFLSALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASII 105

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
           G +  ++ S ++F +G+L+  ++ ++ +L+ GR ++G+GG GL ++C +  + +V  RSR
Sbjct: 106 GFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSR 165

Query: 263 ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
            +   + +  F             F    V WR  F + +P+
Sbjct: 166 GMAISVLSCSFAVASIVGPFLGGAFTTH-VTWRWCFYINLPI 206

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (51%), Gaps = 7/191 (3%)

Query: 143 MASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF 202
           M S+ L +FLAALD  I++  ++ I+ +FN+  +  WI + Y L  A    L+G+ + IF
Sbjct: 44  MGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIF 103

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
           G +  L+ S L+F  G+LI  +S ++ VL+ GR VAGIGG G+ S+C +  + +   RSR
Sbjct: 104 GFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSR 163

Query: 263 ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPV 322
            +   + +  +             F    V WR  F + +P+  L   A  + +   KP 
Sbjct: 164 GVAISVLSCAYAVAAVASPFMGSAFTTH-VTWRWCFYINLPIGGL---AFAVLVLTYKP- 218

Query: 323 DAHKGAGQRSI 333
             H+G   RSI
Sbjct: 219 --HEGNSARSI 227

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 89.4 bits (220), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (51%), Gaps = 7/191 (3%)

Query: 143 MASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF 202
           M S+ L +FLAALD  I++  ++ I+ +FN+  +  WI + Y L  A    L+G+ + IF
Sbjct: 44  MGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIF 103

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
           G +  L+ S L+F  G+LI  +S ++ VL+ GR VAGIGG G+ S+C +  + +   RSR
Sbjct: 104 GFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSR 163

Query: 263 ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPV 322
            +   + +  +             F    V WR  F + +P+  L   A  + +   KP 
Sbjct: 164 GVAISVLSCAYAVAAVAGPFMGGAFTTH-VTWRWCFYINLPIGSL---AFAVLVLTYKP- 218

Query: 323 DAHKGAGQRSI 333
             H+G   RSI
Sbjct: 219 --HEGNSARSI 227

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 1/162 (0%)

Query: 143 MASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF 202
           + S+ L +FLAALD  I++  ++ IA +F +  +  WI + Y L+ A    L+G+ + I 
Sbjct: 121 IGSLTLVLFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGRFATII 180

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
           G +  L+ S L+F  G+LI  +S ++ +L+ GR VAGIGG G+ S+C +  + + P RSR
Sbjct: 181 GFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLTPDRSR 240

Query: 263 ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
            +   + +  +                  V WR  F + +P+
Sbjct: 241 VIIISVLSCSYAVAAVVGPFLGGALTTH-VTWRWCFYINLPI 281

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 79/149 (53%), Gaps = 1/149 (0%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV TL + I  +F +  RI W+ T Y L +A F  L+G+L+ I G +  L FS ++F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI  +S ++ +++ GR VAG GG G+ S+  +  T +V  R+R +   +  + F  
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
                      F +  V WR  F + +P+
Sbjct: 143 AFAVGPVIGGAFTEN-VSWRWCFYINLPI 170

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 97/472 (20%), Positives = 195/472 (41%), Gaps = 57/472 (12%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV+T+++ +A +F     I W+ T Y L +A    ++G+++   G +  ++F+ ++F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI  ++ ++ VL+ GR +AG+GG G+ S+  +  +++V   +R +   I +  F  
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLF---------------LTLP- 319
                      F  R V WR  F + +P+  L+     +F               L +P 
Sbjct: 212 ASVVGPFLGGVFTSR-VTWRWCFYINLPIGGLTFFLFLMFCNPDPHTFQETVRNILRIPS 270

Query: 320 ------KPVDAH----KGAGQRSIPWTTKLRMVDWTGTVTLVVFLFC----------FTL 359
                 + V  H    K  G+R+  W  K+ + +      ++ F+ C          FT 
Sbjct: 271 QLIEFVRKVGHHLSKVKELGKRT-SW--KILLTELVFMYDIIEFVLCTAGFTSILLAFTF 327

Query: 360 VCSLYGEDLPHLYLIFVV----ILLSGSY--FIYHELYVAT-----DPILPIRFLENRSV 408
             + Y  D   + ++FV+    ++L+  Y  F++ +  V        P++  R ++   +
Sbjct: 328 GGNRYAWDSAEIIVLFVIGVILVILAAVYDFFVFPKFDVVKTAPRYQPLMSWRNIKRPGI 387

Query: 409 LAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKR 468
              +++ +    G ++   YI  Y+  + N         +V     T   S+  G    +
Sbjct: 388 FTVNIALFLLCTGYISQFTYIVQYFQLIYNDSAWKAAVHLVACIIPTVITSVVCGVITDK 447

Query: 469 TGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPG--FGSXXXXXXXXXXXX- 525
           T +    ++   ++GV+G   ++ +  S S      L ++PG  FG              
Sbjct: 448 TRQIKPIIVISSILGVVGAGLLTLLNNSASNSAHIGLLILPGIAFGGLMQSSMLASQIQL 507

Query: 526 -XXXPQRHQ--AATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPL 574
               P  H    + T+ S   ++ G  LG  I   +F     N+L+   + L
Sbjct: 508 DKESPTFHSDFVSITTFSTFSKNLGQALGGVISNTVFSAAAVNKLHKSNIEL 559

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 108/563 (19%), Positives = 218/563 (38%), Gaps = 69/563 (12%)

Query: 145 SMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGR 204
           S+ L +FLAALD  IV+T+++++A EF +  +  WI   Y L SA    ++G+++ + G 
Sbjct: 60  SLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGF 119

Query: 205 RPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRAL 264
           +  ++ + ++F +G+L+  ++ ++ +L+ GR +AG+GG G+ ++C +  + +V    R L
Sbjct: 120 KSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKRGL 179

Query: 265 YQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDA 324
                   F             F    V WR  F + +P+  L   A   F+    P   
Sbjct: 180 LIACMGSAFGIASVVGPFLGGAFTTH-VTWRWCFWINLPIGGL---AFAFFILFYNP--- 232

Query: 325 HKGAGQRSIPWTTK---------------LRMVDW-----------------TGTVTLVV 352
             G+ Q  + + T                L++  W                   T  LV+
Sbjct: 233 -HGSDQTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHELIYKFDIIEFALCTTGLVL 291

Query: 353 FLFCFTLVCSLYGEDLPHLYLIFV------VILLSGSYFIYHELYVATD-----PILPIR 401
            L   +   + Y  +      +FV      ++ L   + I+  L V  +     P++P+R
Sbjct: 292 ILLALSFGGNKYAWNSGSTIAMFVIGILVTILALVYDFAIFPRLKVVRENPRYQPLIPLR 351

Query: 402 FLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLG 461
             +   +   +++ +F  M  M    YI  ++  + N         ++     T    + 
Sbjct: 352 VAKKFFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKASIHVIACVVPTVITVIT 411

Query: 462 AGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPG--FGSXXXXXX 519
           +G    + G      +      ++G   ++ +T   +      L ++PG  FG+      
Sbjct: 412 SGILNSKFGIVKPINVLGITAAIVGAGLLTLLTNKSTNSEHIGLLILPGVAFGATMQSTL 471

Query: 520 XXXXXXXXXPQRHQ----AATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQ 575
                       H      A T+++   ++ G   G  +   +F   + N+L  K   + 
Sbjct: 472 IGSQIQLDKKSTHYRMDFIAVTTMNNFLKNLGQAFGGVLCNTVFTTSILNKL--KQNDIT 529

Query: 576 SPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVA 635
             +H  S+ L I  +A+H          + +  +L +    + +  F+ CL C  +A + 
Sbjct: 530 IGDHTTSDAL-ISYRASHF---------DGSTSLLGNLISDSIKNVFYMCLGCAAIAFIF 579

Query: 636 CCFIVEYKLHAGNTAPRPQRERT 658
             F    K          Q+E +
Sbjct: 580 GIFSSNKKSELHKPTSDTQKETS 602

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 117/519 (22%), Positives = 202/519 (38%), Gaps = 61/519 (11%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV TL D I  +F++   I W+ T Y LS+A F  L+G+L++I G +  L+ S +VF
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI  +S ++  L+ GR VAG GG G+ S+  +  T IV    R +      + +  
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDA----HKGAGQR 331
                      F +  + WR  F + +P+   +   +    T  +P        K     
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIM 202

Query: 332 SIPWTTKLRMVDWTGTVTLVVFLF----------CFTLV---CSLYGEDLPH-------L 371
           +  +   L+   W  T  ++VF             FTL+    S  G + P         
Sbjct: 203 NYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICF 262

Query: 372 YLIFVVILLSGSYFIYHELYVA--------TDPILPIRFLENRSVLAASLSNWFCMMGMM 423
           + +  ++LL    + +H L ++          P+L      N  +  +S++ +       
Sbjct: 263 FTVGPILLLLFCAYDFHFLSLSGLHYDNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYE 322

Query: 424 TTGFYIPVYYASVLNMGPT----DIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAF 479
               Y+   Y  V    PT     + +  +P+  +T    +   Y   + G     ++  
Sbjct: 323 LQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIAT----MAIAYLNSKYGIIKPAIVFG 378

Query: 480 CLVGVLGQVQISYVTPSISTWRQYCLYMIPG--FGSXXXXXXXXXXXXXXXP----QRHQ 533
            L G++G    + +   +S    Y +  +PG  FGS                    Q   
Sbjct: 379 VLCGIVGSGLFTLINGELSQSIGYSI--LPGIAFGSIFQATLLSSQVQITSDDPDFQNKF 436

Query: 534 AATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAH 593
              T+ +   +S G   G ++G  IF   L NQ+ S    L  P+  + E L      A+
Sbjct: 437 IEVTAFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSS--QLNIPQFTSVETLL-----AY 489

Query: 594 STEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLA 632
           STE  H + P+ +    I+    A    F+  L C  L+
Sbjct: 490 STE--HYDGPQSSLSKFINT---AIHDVFYCALGCYALS 523

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 97/476 (20%), Positives = 201/476 (42%), Gaps = 43/476 (9%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGK 197
           R  V +A++ L  F+ ALD  IV T++D +++      +  W+   Y L ++ F  ++G+
Sbjct: 56  RLYVCVAALVLATFIFALDVFIVNTIIDSVSASLGGYSKSGWLIAGYSLPNSLFSLIWGR 115

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
            + + G +  +  S  +F +G+++   + ++  L++GR +AG+GG GL ++  +  + IV
Sbjct: 116 TASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLVIGSSIV 175

Query: 258 PLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLT 317
             ++RA+   I    F             F    + WR  F + +P+   + TA+  + T
Sbjct: 176 EEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVI-WRWCFWINLPIG--AVTALLFYFT 232

Query: 318 L-PKPVDAHK--GAGQRSIPWTTKLRMVDW-TGTVTLVVFLFCFTLVCSLYG-------- 365
             PK + A     +  +S+   +  ++  W T        LF F +V    G        
Sbjct: 233 YNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVGFATGCAGVCLLL 292

Query: 366 -------EDLPHLYLIFVVILLSG----------SYFIYHEL-----YVATDPILPIRFL 403
                  ED      I +  L+ G           ++I+ ++      ++  P+L    L
Sbjct: 293 LGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNLSFRPMLVKGLL 352

Query: 404 ENRSVLAASLSNWFCMMGMMTTGF--YIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLG 461
            NR +L  +L    C   +  +G+  Y   ++  V+     + G  ++P   ++   ++ 
Sbjct: 353 NNRFILLPNLVT--CASAIAFSGYMLYSVQFFQLVMGSSAWNAGLHLIPLVIASIVSAII 410

Query: 462 AGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXX 521
            G  MK+TG+    +++   + ++G    + +        Q  ++++PGFG         
Sbjct: 411 CGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSGNSMQIGVWILPGFGLGAALQCAL 470

Query: 522 XXXXXXXPQRHQAATTSISY--AFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQ 575
                   +    +   +    AF S   +LG SIGG +     ++ L+SK+  ++
Sbjct: 471 ISSQLQIDKESPNSEIELVEVTAFNSFTKSLGSSIGGVLCTAIFTSSLWSKINAVK 526

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 97/179 (54%), Gaps = 4/179 (2%)

Query: 143 MASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF 202
           + S+ L +FLAALD   V+T+++ ++ +F +  ++ W+ T Y L +A    ++G+++ + 
Sbjct: 46  LGSLVLCLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLV 105

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
           G +   + + ++F +G+L+  ++ ++ +L+ GR +AGIGG G+ S+  + ++ +V  R+R
Sbjct: 106 GFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNR 165

Query: 263 ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKP 321
            L   + +  F             F    V WR  F + +P+  L   A  LFLT   P
Sbjct: 166 GLIIAVMSSSFGIASVVGPFLGGAFTTH-VTWRWCFYINLPVGGL---AFFLFLTFYNP 220

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 75/149 (50%), Gaps = 1/149 (0%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV TL D I  +F++   I W+ T Y LS+A F  L+G+L++I G    L+ S ++F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI  +S  +  L+ GR +AG GG G+ S+  +  T IV    R +      V +  
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
                      F +  + WR  F + +P+
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPI 171

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 88/164 (53%), Gaps = 1/164 (0%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200
           V + ++ L +FLAALD  IV+T+++ +A +      I W+ T Y L +A    ++G+++ 
Sbjct: 62  VSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIGWLFTGYSLPNALLVLIWGRIAT 121

Query: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260
             G +  ++F+ ++F +G+LI  ++ ++ +L+ GR +AGIGG G+ S+  +  + +V   
Sbjct: 122 PIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGSTLVEES 181

Query: 261 SRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
            R +   I +  F             F   +V WR  F + +P+
Sbjct: 182 KRGMLIAILSSSFAIASVVGPFLGGVFTS-SVTWRWCFYINLPI 224

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 118/520 (22%), Positives = 200/520 (38%), Gaps = 63/520 (12%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV TL D I  +F++   I W+ T Y L++A F  L+G+L++I G    L+ S ++F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI  +S ++  L+ GR +AG GG G+ S+  +  T IV    R          +  
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLT----LPKPVDAHKGAGQR 331
                      F +  + WR  F + +P+   +   +    T    LPK     K     
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIM 202

Query: 332 SIPWTTKLRMVDWTGTVTLVVFLF----------CFTLV---CSLYGEDLP-------HL 371
           S  +    +   W     + VF             FTL+    S  G +          L
Sbjct: 203 SYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTIISL 262

Query: 372 YLIFVVILLSGSYFIYHELYVA--------TDPILPIRFLENRSVLAASLSNWFCMMGMM 423
           + +  ++L+    + +H L +         T P+L      N  +  +S++ +F      
Sbjct: 263 FTVGPILLILFCAYDFHFLPLLGLRYENKRTKPLLTWSIASNSGIFTSSVTGFFSCFAYE 322

Query: 424 TTGFYIPVYYASVLNMGPT----DIGKRIVPSFFST-AFGSLGAGYYMKRTGKYYWFLLA 478
               Y+   Y  VL   PT     + +  +P+  +T A   L A Y + +    +     
Sbjct: 323 LQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIATMAIAYLNAKYGIIKPAIVFG---- 378

Query: 479 FCLVGVLGQVQISYVTPSISTWRQYCLYMIPG--FGSXXXXXXXXXXXXXXXP----QRH 532
             L G++G    + +    S    Y +  +PG  FGS                    Q  
Sbjct: 379 -VLCGIVGSGLFTLINGKSSQSIGYSI--LPGLAFGSIFQATLLSSQVQIKSDDPEFQNK 435

Query: 533 QAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAA 592
               T+ +   +S G   G ++G  IF   L NQ+ S  + L  PE  + E L      A
Sbjct: 436 FIEVTAFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSSHLSL--PEFTSVETLL-----A 488

Query: 593 HSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLA 632
           ++TE  H +    ++ +L    + A    F+  L C  L+
Sbjct: 489 YNTE--HYDG---SQSLLSQLINTAIHDVFYCALGCYALS 523

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 102/526 (19%), Positives = 212/526 (40%), Gaps = 49/526 (9%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF-GRRPLLVFSNLV 214
           D  IVTT+++ + + F+   +  WI   Y L +A    L+G+++  F G +  ++ + ++
Sbjct: 74  DIMIVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVI 133

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFX 274
           F +G+LIC ++ ++ +L+ GR +AGIGG G+ S+  +  + +V  R R       +  F 
Sbjct: 134 FEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFG 193

Query: 275 XXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLS----------TTAIQLFLTLPKPVDA 324
                       F    V WR  F + +P+  ++          T   Q+ LT+    + 
Sbjct: 194 IASVIGPFIGGAFTSH-VTWRWCFWINLPVGAVALVIFTWVYNPTGKKQVLLTIHDLKEL 252

Query: 325 HKGAGQRSIP-----WTTKLRMVDWT-GTVTLVVFLFCFTLVCSLYGEDLPHLYLIF--- 375
            +   +            KL ++++   +  +V  L  FT   + +      + L+F   
Sbjct: 253 SEKVKKVRFKDLLKHLLFKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILLFVIG 312

Query: 376 ---VVILLSGSYFIYHEL------YVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTG 426
              V++ L   + I+  L      Y+   P++  + L  R +  AS++ +F  +G M+  
Sbjct: 313 GCLVIVALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRGIFTASMTTFFFCIGYMSQT 372

Query: 427 FYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLG 486
            Y   ++  + N  P      ++     T   ++  G+   + G      +A   + V+G
Sbjct: 373 VYYVQFFQLIYNSSPWKASIHLIAVMIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIG 432

Query: 487 QVQISYVTPSISTWRQYCLYMIPG--FGSXXXXXXXXXXXXXXXP----QRHQAATTSIS 540
              ++ +    ++ +   L ++PG  FG+                    +    A T+++
Sbjct: 433 AGLLTLLDNHSNSAQHIGLLILPGVAFGACNQCTMMAAQIELDKKSPTFKSDFVAVTTLN 492

Query: 541 YAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHK 600
              ++ G  +G  I  ++F   + N++        S      +L  II +A H       
Sbjct: 493 SFLKNCGQAVGSIISASVFGGAVMNKIGKS--SYHSEIRSVDDL--IIYRAEHF------ 542

Query: 601 EAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLHA 646
              + AR +L +    + +  F+  L    LA +   F    K+ A
Sbjct: 543 ---DGARSVLGNMISDSVKDVFYMALGWCALAFLFAIFTSNKKIEA 585

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 109/570 (19%), Positives = 221/570 (38%), Gaps = 51/570 (8%)

Query: 125 EAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAY 184
           +  K  +  +   R  V + ++ L   + ALD  IV T++D ++       +  W+ T Y
Sbjct: 60  DNEKTQSSIMAGMRLYVCLFALVLAQLIVALDVFIVNTVIDVVSKNLGGYAKSGWLITGY 119

Query: 185 LLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGG 244
            L ++    ++G+ + + G +  ++ S  +F +G+++   + ++  LV+GR VAGIGG G
Sbjct: 120 SLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVSATATSMNNLVVGRVVAGIGGSG 179

Query: 245 LTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
           L ++  I    +V  R+R +   +    F             F   A  WR  F + +P+
Sbjct: 180 LQTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGAFTTHAT-WRWCFWISLPV 238

Query: 305 TLLSTTAIQLFLTL-PKPVDAHKGAGQ-----RSIPWTTKLRMVDWTGTVTLVVF---LF 355
               + A   F T  P+ +       +     ++IP      +  +   V  +VF   L 
Sbjct: 239 G--GSAAFLFFFTYNPERLSITARLVRCLKLVKAIPLKQFQYVETYKTIVRNLVFRFDLI 296

Query: 356 CFTLVCS-----LYG-----EDLPHLYLIFVVILLSGSYF----IYHELYV--------- 392
            FTL C+     L G     ED        V  L+ G       + ++ Y+         
Sbjct: 297 GFTLNCTGICLFLLGLTFGSEDNSWKRAFVVCFLVIGGLLVVCSVVYDFYIFDRINPEPA 356

Query: 393 --ATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGF--YIPVYYASVLNMGPTDIGKRI 448
             +  P++    + ++  L A+     C   ++  G+  Y   ++  VL     + G  +
Sbjct: 357 NASYRPLMVRTLIGHKYFLLANTVT--CAAAVVFAGYMVYSVQFFQLVLGYTAWNAGLHL 414

Query: 449 VPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMI 508
           +P   ++   ++  G + K+TG   + ++A   + ++G    + +    +   Q  ++++
Sbjct: 415 IPLVIASLLSAIFCGGFTKKTGHVKYVMIANIALLLIGSGVCTLLDNYSNNSMQIGVWIL 474

Query: 509 PGFGSXXXXXXXXXXXXXXXPQRHQAATTSISY--AFRSTGSTLGVSIGGAIFRNGLSNQ 566
           PGFG                 +    A T +    AF S   +LG SIG  +      + 
Sbjct: 475 PGFGLGATLQCALISSQLQIDKNSPDAKTELVEITAFNSFCKSLGSSIGAVLSTTTFISA 534

Query: 567 LYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCL 626
           L+ K+   +   +   ++  +++    + +    EA E         +  A  Y F  C 
Sbjct: 535 LWRKINKAKLEGYYGKKINELVKYRLQNFDGKSTEAAEI--------FSAAVTYVFWMCY 586

Query: 627 ACMVLATVACCFIVEYKLHAGNTAPRPQRE 656
           A   LA    C     ++       + + +
Sbjct: 587 AFSALAFFCACLSSNRRVETEKKVAQEEHD 616

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 108/493 (21%), Positives = 205/493 (41%), Gaps = 39/493 (7%)

Query: 143 MASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF 202
           +AS+ L +F+ ALD  IV T++D +A +F    +  W+ T Y L +A    L+G+ + I 
Sbjct: 48  LASLTLVLFITALDILIVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRFASII 107

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
           G +  L+ + L+F  G+L+  ++ ++ +L++GR VAG+GG GL ++C +    +V  RSR
Sbjct: 108 GFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVDERSR 167

Query: 263 ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPV 322
            L   I +  F             F    V WR  F + +P+  L+   I   LT     
Sbjct: 168 PLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGLAV--IMFLLTYDAKN 224

Query: 323 DA----HKGAGQR-------SIPWTTKLRMV--------DWTG----TVTLVVFLFCFTL 359
           D      KGA ++        +     LR          D+ G    +  LV+FL   T 
Sbjct: 225 DGIIQQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTF 284

Query: 360 VCSLY----GEDLPHLYLIFVVILLSGSY--FIYHELYVATD-----PILPIRFLENRSV 408
             + Y    G+ + +L L  V+ + S  Y  F++ +     D     P+   R +   ++
Sbjct: 285 GGNKYTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFLRRLVAKPAI 344

Query: 409 LAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKR 468
           +  ++  +    G      Y   ++  +        G  ++P   +    ++ +G   K+
Sbjct: 345 IIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGIITKK 404

Query: 469 TGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFG-SXXXXXXXXXXXXXX 527
            G     L+    +GV+G   ++ +  + ++  Q  + ++PGF                 
Sbjct: 405 LGLVKPLLIFGGFLGVIGAGLMTLMKNNSTSSTQIGVLILPGFSLGFALQASLMSAQLQI 464

Query: 528 XPQRHQAATTSISY-AFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLR 586
              R +     I   AF +   +LG ++GG +     S  L++K+  +    +    +  
Sbjct: 465 NKDRPETPMDFIEITAFNTFMKSLGTTLGGVLSTTVFSTSLHNKVSHVHLEPYAGKTVDE 524

Query: 587 IIEKAAHSTEWVH 599
           +I    H+ +  H
Sbjct: 525 MILYRLHNFDGAH 537

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 113/545 (20%), Positives = 222/545 (40%), Gaps = 63/545 (11%)

Query: 111 TQKPTEVYLTATAVEAAKEDA-GGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIAS 169
           +Q   + Y + T +     D  GG+      + + S+ L +F+ ALD  IV T++D +A 
Sbjct: 8   SQAEVKAYDSDTELNVNSSDERGGISLY---LCLTSLTLVLFITALDILIVGTIIDVVAE 64

Query: 170 EFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLW 229
           +F    +  W+ T Y L +A    ++G+ + I G +  L+ + L+F  G+L+  ++ ++ 
Sbjct: 65  QFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLVAALANSMN 124

Query: 230 VLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFAD 289
           +L++GR VAG+GG GL ++C +    +V  RSR L   I +  F             F  
Sbjct: 125 MLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAIVGPIIGGAFTT 184

Query: 290 RAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSI--------------PW 335
             V WR  F + +P   +   A+ +FL   K    +     R+I              P 
Sbjct: 185 H-VTWRWCFYINLP---IGGFAVIMFLLTYKTKSENILQQTRNILGRISKFELRRLTEPG 240

Query: 336 TTKLRMV------DWTG----TVTLVVFLFCFTLVCSLY----GEDLPHLYL--IFVVIL 379
             +  ++      D+ G    +  LV+FL   T   + Y    G+ + +L L  +  V  
Sbjct: 241 NLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQIITYLVLGILLFVFS 300

Query: 380 LSGSYFIYHELYVATD-----PILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYA 434
           L   +FI+ +     D     P+   R +   +V+  ++  +   +G      Y   ++ 
Sbjct: 301 LIYDFFIFQKFNPEPDNTSYRPLFLKRLVAKPAVIIVNMVTFLLCIGYNGQMIYSVQFFQ 360

Query: 435 SVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVT 494
            +        G  ++P   +    ++ +G   K+ G     L+   ++GV+G   ++ ++
Sbjct: 361 LIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGILGVIGAGLMTLMS 420

Query: 495 PSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAAT------TSISYAFRSTGS 548
            + ++  Q  + ++PG                   +    AT      T+ +   +S G+
Sbjct: 421 NNSTSSTQIGVLILPGLSLGFALQASLMSAQLQIKKDRPEATTDFIEITAFNTFMKSLGT 480

Query: 549 TLGVSIGGAIFRNGLSNQLYSK--------------LMPLQSPEHPASELLRIIEKAAHS 594
           TLG  +   +F   L N++                 L  LQ+ + P S +  I+  +  +
Sbjct: 481 TLGGVLSTTVFSASLRNKVKHAQLEMYVGKTVDDMILYRLQNFDGPHSSIGNILSDSIKN 540

Query: 595 TEWVH 599
             W+ 
Sbjct: 541 VFWMD 545

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 83/166 (50%), Gaps = 4/166 (2%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV+T+++ +A +F    +  WI   Y L +A    L+G+++ I G +  ++ + ++F
Sbjct: 94  DIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI G++ ++ +L+ GR +AG+GG G+ S+  +  +++V  R R L     +  F  
Sbjct: 154 EIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAV 213

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKP 321
                      F   A  WR  F + +P   +   A  LF+    P
Sbjct: 214 ASVIGPFLGGAFTTHAT-WRWCFYINLP---VGGVAFALFVVFYNP 255

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV T+++ +A++FN      W+ T Y L +A    L+G+   + G +  ++ S ++F
Sbjct: 91  DILIVGTIMETVAAKFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIF 150

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI   + ++ +L+ GR ++GIGG G+ ++C + T+ +V  R+R     I +  F  
Sbjct: 151 EVGSLIAAAATSMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAV 210

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
                      FA   V WR  F + +P+
Sbjct: 211 ASVAGPFLGGAFATH-VTWRWCFYINLPI 238

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV T+L+ IA +FN   +I W+ T Y LS+A F  L+G+ + IFG +  L+ S ++F
Sbjct: 36  DIIIVVTILNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIF 95

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+L+  +S ++ +++ GR +AG G  G+ ++     T +V   +R     + ++ +  
Sbjct: 96  EIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAV 155

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
                        +  V WR  F + +P+
Sbjct: 156 ASALGPYIGGALTEY-VTWRWCFYINLPI 183

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 156 DGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVF 215
           D  IV+T+++ +A +F     I W+ T Y L +A    ++G+++   G +  ++F+ ++F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 216 CLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXX 275
            +G+LI  ++ ++ +L+ GR +AG+GG G+ S+  +  + +V    R +   + +  F  
Sbjct: 143 EIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAI 202

Query: 276 XXXXXXXXXXXFADRAVGWRMAFLVQVPL 304
                      F   +V WR  F V +P+
Sbjct: 203 ASVVGPFLGGVFTS-SVTWRWCFYVNLPI 230

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 129/562 (22%), Positives = 216/562 (38%), Gaps = 75/562 (13%)

Query: 122 TAVEAAKEDAGGLGATRRRVVMA-SMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWI 180
           T +E  +E      +TR R ++  S+ L   +AALD T       +  S FN    +S +
Sbjct: 63  TRIEVVREKM----STRVRWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTL 118

Query: 181 ATAYLLSSATFQPLYGKLSDIFGRRPLLVFSN-LVFCLGALICGMSKNLWVLVLGRFVAG 239
             A  +  A  +P   K+SD+   RP+  F   L++ +G +I   S  +   V+G     
Sbjct: 119 TIANSVIGAVCKPFIAKISDL-SSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIA 177

Query: 240 IGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMA-- 297
           IG  G++ M  +   D   L+ R+ +  + +V +               +    WR    
Sbjct: 178 IGQSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINS--NWRWGYG 235

Query: 298 -FLVQVPLTLLSTTAIQLFL------TLPKPV-------------DAHKGAGQRSIPWTT 337
            F +  P+ L     +  +L      T   PV             ++H  +G R      
Sbjct: 236 MFAIITPVALTPAILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHV-SGFREYWELV 294

Query: 338 KLRMVDWTGTVTLVVFLFCFTLV---CSLY-----GEDLPHLYLIFVVILLSGSYFIYHE 389
           K+ +++      L++  F F+L+   CSLY     G + P +  + VV  +    ++  E
Sbjct: 295 KVSLIE-IDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLISYVVFE 353

Query: 390 LYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---------G 440
           ++ A  P+LP R L NR+ +   + ++   M    +  +   Y   VLN+          
Sbjct: 354 VFFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSN 413

Query: 441 PTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTW 500
            T +G      FF   +G+L  G++  R   +    +A  L+G+   V  S    S    
Sbjct: 414 TTTMGL----CFFGVVWGALFRGFH--RYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIG 467

Query: 501 RQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFR 560
                 ++  FG                P +  AAT S+   + S G+ +G +I  AI+ 
Sbjct: 468 LVVAALVVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAIWT 527

Query: 561 NGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAP--EFARHILIDCYHYAG 618
           + L   L SK +P +       E L        +T W   E P     R   ID Y    
Sbjct: 528 DRLPGAL-SKYVPDREKAAAFFESL--------TTVW---EEPWGSANREGAIDAYQ--- 572

Query: 619 RYTFHFCLACMVLATVACCFIV 640
               ++ L CM L   A  FIV
Sbjct: 573 --EVNYTLFCMGLGVSAIMFIV 592

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 129/561 (22%), Positives = 207/561 (36%), Gaps = 73/561 (13%)

Query: 122 TAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA 181
           T +E  KE    +      ++ AS+ L  ++AALD T       +  S FN    +S + 
Sbjct: 64  TRIEVVKEK---MSTKVTWILAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLT 120

Query: 182 TAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV-FCLGALICGMSKNLWVLVLGRFVAGI 240
            A  +  A  +P   K+SD+   RP+  F  L+ + +G +I   S  +   V+G     +
Sbjct: 121 IANSVIGAVCKPFIAKISDL-SSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAV 179

Query: 241 GGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMA--- 297
           G  G+  M  +   D   L+ R+    + +V +                    WR     
Sbjct: 180 GQSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISS--NWRWGYGM 237

Query: 298 FLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTG----------- 346
           F +  P+ L  T AI +   L    +        S P T K R +  +G           
Sbjct: 238 FAIITPVAL--TPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLL 295

Query: 347 --------TVTLVVFLFCFTLV---CSLY-----GEDLPHLYLIFVV--ILLSGSYFIYH 388
                      L++  F F+L+   CSLY     G   P +  + V+  I L  SY I+ 
Sbjct: 296 KTSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLI-SYVIF- 353

Query: 389 ELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM--------- 439
           E++ A  P+LP R L NR+ +   + ++   MG   +  +   Y   VLN+         
Sbjct: 354 EVFFAPFPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLS 413

Query: 440 GPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSIST 499
             T +G      FF   +G L    Y  R   +    +A  L+G+   V  S    S   
Sbjct: 414 NTTTMGL----CFFGVVWGVLFR--YFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGI 467

Query: 500 WRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIF 559
                  ++  FG                P +  AAT S+   + S G+ +G +I  A++
Sbjct: 468 GLIVAALIVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVW 527

Query: 560 RNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGR 619
            N L   L  K +P +       E L +I +    +E          R   I  Y     
Sbjct: 528 TNELPGALL-KYVPDKEKAITFFESLTLIWQEPWGSE---------NREGAIAAYQ---- 573

Query: 620 YTFHFCLACMVLATVACCFIV 640
              ++ L CM L   +  FIV
Sbjct: 574 -EVNYTLFCMGLGVSSIMFIV 593

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 112/487 (22%), Positives = 189/487 (38%), Gaps = 56/487 (11%)

Query: 135 GATRRRVVMASMC--------LGVFL----AALDGTIVTTLLDHIASEFNELPRISWIAT 182
           G TR  VV   M         L +FL    AALD T       +  S FN    +S +  
Sbjct: 61  GVTRIEVVREKMSTKVIWILGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTI 120

Query: 183 AYLLSSATFQPLYGKLSDIFGRRPLLVFSN-LVFCLGALICGMSKNLWVLVLGRFVAGIG 241
           A  +  A  +P   K+SD+   RP+  F   L++ +G +I   S N+   V+G     +G
Sbjct: 121 ANSVIGAVCKPFIAKISDL-SSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVG 179

Query: 242 GGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMA---F 298
             G++ M  +   D   L+ R+ +  + +V +               +    WR     F
Sbjct: 180 QSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINS--NWRWGYGMF 237

Query: 299 LVQVPLTLLSTTAIQLFLTLPK------PVDAHKGAGQRSIPWTTKLR--MVDW------ 344
            +  P+ L     +  +L          P+     A ++      ++R   V W      
Sbjct: 238 AIITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVS 297

Query: 345 ---TGTVTLVVFLFCFTLV---CSLY-----GEDLPHLYLIFVV--ILLSGSYFIYHELY 391
                   L++  F F+L+   CSLY     G + P +  + VV  ILL  SY ++ E++
Sbjct: 298 LIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLI-SYVVF-EVF 355

Query: 392 VATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDI-----GK 446
            A  P+LP R L NR+ +   + ++   M    +  +   Y   VLN+   D        
Sbjct: 356 FAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTT 415

Query: 447 RIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLY 506
            +   FF   +G+L  G++  R   +    +A  L+G+   V  S    S          
Sbjct: 416 TMGLCFFGVVWGALFRGFH--RYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAAL 473

Query: 507 MIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQ 566
           ++  FG                P +  AAT S+   + S G+ +G +I  A++ + L   
Sbjct: 474 VVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTDQLPGA 533

Query: 567 LYSKLMP 573
           L+ K +P
Sbjct: 534 LF-KYVP 539

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 99/437 (22%), Positives = 174/437 (39%), Gaps = 45/437 (10%)

Query: 166 HIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS 225
           +  S +NE   +S I     + S   Q ++ +LSDIFGR  L +   +++ +G +I   +
Sbjct: 104 YATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEA 163

Query: 226 KNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXX 285
           +++    +G      G  G++ +  I  +D+ P + R L+Q     +             
Sbjct: 164 RDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQ-FATSWPCIIICWISGDIV 222

Query: 286 XFADRAVGWRM-----AFLVQVPLTLLSTTAIQLFLTLPKPVDA--------HKGAGQRS 332
             A+ A  WR      AFL   P++ L      L+ T      A        +K    R 
Sbjct: 223 QSANPAKNWRFDIGMWAFL--FPISALPFIIFLLYFTRQASKTAEWKEIQGDNKEPSVRI 280

Query: 333 IPWTTKL-RMVDWTGTVTLVVFLFCFTLVCSLYG---EDL--PHLYLIFVVILLSGSYFI 386
           + W   +   +D  GT  + V L C  +  +L G   +D   P +    VV  +S  +F+
Sbjct: 281 VYWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGFVSFMFFL 340

Query: 387 YHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYI-PVYYASVLNMGPTDIG 445
             ++  A + +LP + L++R V A+  +     +   T   Y+ PV   SV     +   
Sbjct: 341 AWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLYPVLLVSVNESSKSATR 400

Query: 446 KRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQY-- 503
              +P+F +   GS+  G  + RT +    L  + ++GV   +       SI  +  Y  
Sbjct: 401 ILWLPTFVACT-GSIFFGLLVVRTKR----LKIYSIIGVCLWIL------SIGLFYHYRG 449

Query: 504 ---------CLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSI 554
                       ++ G GS                 ++ A+ T + + F   GS  G SI
Sbjct: 450 GASSHSGIIGASVVLGTGSAIFTQSLIVNLQTMTSHKNMASITGLYFMFAQIGSASGASI 509

Query: 555 GGAIFRNGLSNQLYSKL 571
            GAI+   +  QLY +L
Sbjct: 510 SGAIWTQTMYKQLYKRL 526

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 111/501 (22%), Positives = 189/501 (37%), Gaps = 59/501 (11%)

Query: 154 ALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNL 213
            LDG I +    + A+ +   P IS ++    + SA  Q  + +LSD+FGR  L V +  
Sbjct: 72  GLDGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLSDVFGRLSLFVTAIA 131

Query: 214 VFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------G 267
            + +G +I   + ++    +G     IG  G+  M  +  +D   LR R LYQ      G
Sbjct: 132 FYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILLMLILIVSDFSSLRWRLLYQFAPSWPG 191

Query: 268 ICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKG 327
           I N +              ++     W  AF+  +PLT L      L +   K     + 
Sbjct: 192 IINTWIAGTITARSNPQEKWSWNIGMW--AFI--IPLTCLPMILCMLHMRF-KARRTEQW 246

Query: 328 A---GQRSIPWTTKL--------RMVDWTGTVTLVVFLFCFTLVCSLYG-----EDLPHL 371
           A    +RS   T  L          VD  G + +   + C     +L G        P +
Sbjct: 247 AELRNERSYYQTHGLIKTLIELFWKVDVVGILLMTASIGCVLAPLTLAGGTGSKWQNPRV 306

Query: 372 YLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCM--MGMMTTGFYI 429
              FV+  +    F+  E   A DPI+P   +++R+V  ASL++ F +  + MM  G+  
Sbjct: 307 ISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRAVW-ASLNSQFLIGFIYMMAAGYIY 365

Query: 430 PVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL---- 485
            +    V     +     I+ SF +TA  S     ++ R  +   +++A C + +L    
Sbjct: 366 NILIVGVNESIKSATTITILSSFVATA-ASPPFCLWITRCTRMKGYIVAGCGLWMLAMGL 424

Query: 486 ------GQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSI 539
                 G+     +  ++  W         G G                   + A  T++
Sbjct: 425 FYHYRGGEFAHGGIVAAMVVW---------GLGDVLLIYPITVSVQSATSHDNMAMVTAL 475

Query: 540 SYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVH 599
           +Y     G + G +I GAI+   L  +L+ +L          S+  + I      T    
Sbjct: 476 NYTTYRIGLSTGSAISGAIWTQTLYKELFKRLGDATLAVSAYSDPFKFITTYTWGT---- 531

Query: 600 KEAPEFARHILIDCYHYAGRY 620
              PE  R  ++  Y +  RY
Sbjct: 532 ---PE--REAVVQAYRHVQRY 547

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 75/163 (46%), Gaps = 10/163 (6%)

Query: 160 VTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219
           + T LDH    +     I+   +   L S+ F    G  +DIFGR+P ++ SNL+F +GA
Sbjct: 147 IGTDLDHKELTYGNKEFITAATSLGALISSIFA---GISADIFGRKPCILLSNLMFLIGA 203

Query: 220 LICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXX 279
           +I   +   W +V+GRF+ G G G  + +  +  ++I P   R     I +++       
Sbjct: 204 IIQVTAHTFWQMVVGRFIMGFGVGIGSLIAPLYISEIAPKNIRGRLTVINSLWLTGGQLI 263

Query: 280 XXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQL--FLTLPK 320
                   +    GWR    + V L+L+  T IQ   FL LP 
Sbjct: 264 AYGCGAGLSHVNNGWR----ILVGLSLIP-TVIQFSCFLFLPD 301

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 92/447 (20%), Positives = 170/447 (38%), Gaps = 42/447 (9%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG I      +  S ++E   +S I     + SA  Q +Y +LSDI+GR  LLV + ++
Sbjct: 95  LDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSDIYGRMSLLVVAIVL 154

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------GI 268
           + +G +I   + ++     G      G  G+  +  +  +D   LR R  YQ       I
Sbjct: 155 YAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLRWRLFYQFVPTWPFI 214

Query: 269 CNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGA 328
            N +              ++     W  AF+  +    +    I +   +    +  +  
Sbjct: 215 INTWISGNITQKANPLKHWSWDIGMW--AFIFPLSCVPILCCMIHMHWRVRNDPEWKELQ 272

Query: 329 GQRSI----PWTTKLRMVDW----TGTVTLVVFLFCFTLVCSLYG---EDLPHLYLI--F 375
           G+++      W   L+ + W     G + +V  L C  +  +L G       H  +I  F
Sbjct: 273 GEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIGPF 332

Query: 376 VVILLSGSYFIYHELYVATDPILPIRFLENRSVLAA-SLSNWFCMMGMMTTGFYIPVYYA 434
           V+  +    F Y E   AT+P++P + +++R V AA  +S     +  M   +   V   
Sbjct: 333 VLGFVLIPIFSYWEARWATNPLVPYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIV 392

Query: 435 SVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL--------- 485
           +V     +      + SF ST    + A   + R  +    ++  C + +L         
Sbjct: 393 AVHESVKSATRISSLSSFVSTVASPIVA-LALTRVTRMKPVIIVGCSLWLLAMGLLYHFR 451

Query: 486 -GQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFR 544
            G+   S +  ++  W         G G+                  + A  T+++Y   
Sbjct: 452 GGRESHSGIIGALCVW---------GLGTTLFTYPVTVSVQAATNHDNMATVTALNYTLY 502

Query: 545 STGSTLGVSIGGAIFRNGLSNQLYSKL 571
             GS +G ++ GAI+   L  QL  ++
Sbjct: 503 RIGSAVGAAVSGAIWTQTLYKQLLKRI 529

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 86/209 (41%), Gaps = 11/209 (5%)

Query: 151 FLAALDGTIVTTLLDHIASEFNELP----RISWIATAYLLSSATFQPLYGKLSDIFGRRP 206
           FL   D   +++ L  I ++ +  P       +I  A  L +       G  +D+FGR+P
Sbjct: 145 FLFGYDTGYISSALISIGNDLDNRPLTYGDKEFITAATSLGALISSIFAGTAADVFGRKP 204

Query: 207 LLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ 266
            L+FSNL+F +GA++   +   W +  GR V G G G  + +  +   +I P + R    
Sbjct: 205 CLMFSNLMFVVGAIVQITAHKFWQMTAGRLVMGFGVGIGSLIAPLYIGEIAPRKIRGRLT 264

Query: 267 GICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTA-IQLFLTLPKPVDAH 325
            I +++                    GWR    + V L+L+ T      FL LP     +
Sbjct: 265 VINSLWLTGGQLIAYGCGAGLTKVNNGWR----ILVGLSLIPTVVQFTCFLFLPDTPRYY 320

Query: 326 KGAGQRSIPWTTKLRMVDWTGTVTLVVFL 354
              G   +    K+    +TGT   V+ L
Sbjct: 321 VMKGDYDM--ANKVLHRSYTGTADDVINL 347

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/340 (22%), Positives = 140/340 (41%), Gaps = 35/340 (10%)

Query: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK---NLWVLVLG 234
           +W+  ++ L+S +F  + G++ DI+G +   +  N++FC+ +++CG+SK   N+   ++ 
Sbjct: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGW 294
           R   G+G   +         +I  + S  + + I   F              +    V  
Sbjct: 173 RAFQGLGVAFVLPNVMGLVGNIYNVGS--MRKNIVISFIGCMAPVGQTFGGMWGGLIVDS 230

Query: 295 RMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFL 354
                 Q P    + TAI +F+ L   + +       +I     L+M DW G++  V+ L
Sbjct: 231 NKD---QWPWIFFA-TAIAVFINLIMGIYSIPNHVPTNI---YNLKM-DWIGSLLGVIGL 282

Query: 355 FCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAA 411
                V +   + G    ++ +I +V +     F  +EL  A  P+LP    +NR ++  
Sbjct: 283 ILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTI 342

Query: 412 SLSNWFCMMGMMTTGFYIPVYYASVLNM---GPTDIGKRIVPSFFSTAFGSLGA---GYY 465
            +S     +G    G +   YYA  LN+    P   G      F    FGSL A    + 
Sbjct: 343 IIS---LFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGST---HFVFIIFGSLTAITVAFT 396

Query: 466 MKRTGKYYWFLLAFCLVGV---LGQVQISYVTPSISTWRQ 502
           + + G      + FCL  +    G +  S  +P  + WR 
Sbjct: 397 INKVGPS----VLFCLSSIGFTCGNIIFSVTSPDQTYWRN 432

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 101/499 (20%), Positives = 183/499 (36%), Gaps = 57/499 (11%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG++      +  S +++ P IS I     + SA  Q ++ +LSD+FGR  L + + L 
Sbjct: 70  LDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRLSLFITALLF 129

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------GI 268
           + +G +I   + ++     G      G  GL  +  +  +D   LR R +YQ       I
Sbjct: 130 YAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVYQFAPSWPYI 189

Query: 269 CNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLP-------KP 321
            N +F             ++     W  AF+  VPL+ L      L +            
Sbjct: 190 INTWFAGTVTARANPQEHWSWDIAMW--AFI--VPLSALPMIFCMLHMRFKARKTEQWAA 245

Query: 322 VDAHKGAGQRSIPWTTKLRM---VDWTGTVTLVVFLFCFTLVCSLYG-----EDLPHLYL 373
           +   K   Q      T + +   +D  G + + + + C     +L G        PHL  
Sbjct: 246 IKDEKSFFQSHGLIRTLVELFWKLDIVGVLLMTISVGCILAPLTLAGGVKSKWSNPHLIG 305

Query: 374 IFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYY 433
             V+  +    F+  E   A  P++P   +++R+V  A L   F ++G +       +Y 
Sbjct: 306 PLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAVWGA-LGCQF-LIGFIYNAVAGYIYT 363

Query: 434 ASVLNMGPTDIGKRIVPSF--FSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL------ 485
             ++ +  +     ++ S   F +   S     Y+ R  K   +++  C + +L      
Sbjct: 364 ILIVAVNESVKSATVISSLSSFVSTVASTFFSLYITRCTKLKGYIIGGCGIWMLAMGLFY 423

Query: 486 ----GQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISY 541
               G+   S +  ++  W         G G                   + A  T+++Y
Sbjct: 424 HYRGGEFAHSGIVGAMVIW---------GLGDTLLIYPTTISVQSATSHDNMATVTALNY 474

Query: 542 AFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKE 601
                G   G ++ GAI+   L   L S+L  ++      S     I      T      
Sbjct: 475 TLYRIGLATGAAVSGAIWSQTLYKALLSRLQSVEQASAAYSTPFEFILTYTWGT------ 528

Query: 602 APEFARHILIDCYHYAGRY 620
            PE  R+ ++D Y +  RY
Sbjct: 529 -PE--RNAMVDAYRHVQRY 544

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 93/461 (20%), Positives = 173/461 (37%), Gaps = 38/461 (8%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R V++ S  L  +   LDG + +       + ++    +S I     +  A  Q +Y +L
Sbjct: 80  RVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGAASQIVYARL 139

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SD++GR  L V + + + +G +I   + ++     G     IG  G+  +  +  +D   
Sbjct: 140 SDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIVLLILSDFSS 199

Query: 259 LRSRALYQGICNV-FFXXXXXXXXXXXXXFADRAVGWRMAFLVQV-PLTLLSTTAIQLFL 316
           L+ R  Y  +    F                ++   W +A    + PL+ L      L +
Sbjct: 200 LKWRLFYSFVPTWPFIINTWISGNIVDVAKPEQNWSWDIAMWAFIFPLSCLPLLGCMLHM 259

Query: 317 TL-PKPVDAHKGAGQRSIPWTTK---------LRMVDWTGTVTLVVFLFCFTLVCSLYG- 365
               +  +A K    +   + T             +D  G   +++ L C  +  +L G 
Sbjct: 260 KWRARQTEAWKELSSQKTYYQTHGLVQSLVQLFWKLDVIGVFFMIIILGCILVPLTLAGG 319

Query: 366 ----EDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAA-SLSNWFCMM 420
                + PH+   F++  +   +FI  E   A +PI P + L +R + AA  ++     +
Sbjct: 320 ISNKWNNPHIIAPFILGFVLIPFFIAWESKWAREPIAPFKLLRDRGIWAALCIAFLINFI 379

Query: 421 GMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC 480
             M  G+   +   +V     +      V +F ST F    A  ++ R  +   F++A C
Sbjct: 380 FTMAAGYLYTILMVAVNESVTSATRISSVSTFTSTVFSPFFA-LFITRFTRLKPFIIAGC 438

Query: 481 -----LVGVL-----GQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQ 530
                 +G+L     GQ     +  ++  W         G G+                 
Sbjct: 439 SLWMVAMGILFHFRSGQNSDKGIIGALVVW---------GLGTTMFTYPVTVSLQSVTSH 489

Query: 531 RHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
            + A  T++SY     GS +G ++ GAI+   L  QL   L
Sbjct: 490 ENMATVTALSYTMYRIGSAVGSAVSGAIWTQLLYKQLLQHL 530

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 92/452 (20%), Positives = 174/452 (38%), Gaps = 50/452 (11%)

Query: 154 ALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNL 213
            LD  I      ++ + F+E   +S +     + SA  Q +Y +L+D+FGR  L + + +
Sbjct: 110 GLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVYARLADVFGRLTLFITAVV 169

Query: 214 VFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------G 267
            + +G +I   S N+     G     +G  G+  +  +  +D   L+ R  YQ       
Sbjct: 170 FYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSDFSSLKWRLFYQFAPTWPF 229

Query: 268 ICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLP-KPVDAHK 326
           I N +              ++     W   F    PL+ +      L +    +  +  K
Sbjct: 230 IINTWISGNITSRANPQENWSWDIGMWAFIF----PLSCVPLICCMLHMWWKARRTEEWK 285

Query: 327 GAGQRSIPWTTK---------LRMVDWTGTVTLVVFLFCFTLVCSLYG-----EDLPHLY 372
              +    + T             +D  GT  + V L C  +  +L G      D   + 
Sbjct: 286 ILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQII 345

Query: 373 --LIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAA-SLSNWFCMMGMMTTGFYI 429
             L+  V+LL     I +EL  A +PILP + +++R+V A+ S+S  +  +  M   +  
Sbjct: 346 GPLVLGVVLL--PMLIVYELKWAREPILPWKLIKDRAVWASMSISFLYDFIFYMAYDYLY 403

Query: 430 PVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC-----LVGV 484
            V   +V     +      + +F ST F    A  Y+ R  +   +++A C      +G+
Sbjct: 404 TVMIVAVDESVKSATRISSLSAFVSTVFSPFFA-LYITRVTRLKPYIIAGCGLWMVAMGL 462

Query: 485 L-----GQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSI 539
           L     G+   S +   +  W         G G+                  + A  TS+
Sbjct: 463 LYHFRGGKSSHSGIIGGLCVW---------GVGTTMFTYPVNVSVQSATSHENMATVTSL 513

Query: 540 SYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
           +Y     GS +G+++ G I+   L ++++ ++
Sbjct: 514 NYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRV 545

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 12/126 (9%)

Query: 146 MCLGVFLAALDGTIVTTLL--DHIASEFNELPR------ISWIATAYLLSSATFQPLYGK 197
           + LGVFL   D  +++  L   +  + FN   R      +S +    L+SS     L G+
Sbjct: 112 VSLGVFLFGYDQGVMSGCLTGHYFKNHFNNPSRAAIGNMVSILEIGALVSSL----LVGR 167

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L + +GRR  + + +L+F +G L  G +  +  L++GR ++G+G G L+++  I  ++I 
Sbjct: 168 LGEKWGRRRTIKYGSLIFVIGGLFQGFADKMMHLIIGRTISGLGVGLLSTIVPIYQSEIS 227

Query: 258 PLRSRA 263
           P  +R 
Sbjct: 228 PPHNRG 233

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 63/142 (44%), Gaps = 5/142 (3%)

Query: 180 IATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAG 239
           I  A  L +     + G  +DIFGRRP L+FSN++F +GA++   +   W + +GR + G
Sbjct: 155 ITAATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAILQITAHKFWQMAVGRLIMG 214

Query: 240 IGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFL 299
            G G  + +  +  ++I P   R     I +++                    GWR    
Sbjct: 215 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWR---- 270

Query: 300 VQVPLTLLSTT-AIQLFLTLPK 320
           + V L+L+ T      FL LP 
Sbjct: 271 ILVGLSLIPTVLQFSFFLFLPD 292

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 46/89 (51%), Gaps = 4/89 (4%)

Query: 551 GVSIGGA--IFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARH 608
           GV+I GA  +F   L   L++ L  L S EHP  +L +I+ +A  S+ W+   APEFA+ 
Sbjct: 582 GVAITGASILFNVALRKSLWTALEQLVSEEHPQEQLQQILHRALESSHWIQHSAPEFAQE 641

Query: 609 ILIDCYHYAGRYTFHFCLACMVLATVACC 637
            +   + +   +T  F  A  +L T   C
Sbjct: 642 TIYASFRH--NFTTLFLAAITLLTTSLFC 668

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 151 FLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVF 210
           F+  LD  ++ +    I+S++N+          YL   AT   L  ++S     R  ++ 
Sbjct: 282 FITGLDLMMIWSRSALISSDYNKFLSYFLFPALYLFPIATSHFLRSRIS--LSIRSNMLM 339

Query: 211 SNLVFCLGALICGMSKNLWVLVLGRFVAGIG 241
           S L+  +G LI  + ++  V++LGRF  G+G
Sbjct: 340 SQLLSIVGFLITALGRHFSVILLGRFFIGLG 370

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 107/471 (22%), Positives = 174/471 (36%), Gaps = 44/471 (9%)

Query: 111 TQKPTEVYLTATAVEAAKEDAGGLGATRRRVVMASMCL-GVFLAALDGTIVTTLLDHIAS 169
           T+K   V++     E+  +D          V+    C+ G  L     T+  + +  +  
Sbjct: 36  TEKEAPVFVEEP--ESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLER 93

Query: 170 EFNELP-RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK-- 226
           E +    + SW+  ++ L S +F  + G+L DI+G + +L+   +   + +LICG+S   
Sbjct: 94  ELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFS 153

Query: 227 -NLWVLVLGRFVAGIG-GGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXX 284
            N    +  R   G+G    L ++  I      P   R   + I                
Sbjct: 154 HNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRR---KNIVISLIGMCAPIGATFG 210

Query: 285 XXFADRAV-----GWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKL 339
             FA   V      W  AF        L+T      +    PV+ +K A           
Sbjct: 211 GLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFA----------- 259

Query: 340 RMVDWTGTVTLVVFLFCFTLV---CSLYGEDLPHLY-LIFVVILLSGSYFIYHELYVATD 395
             +DW G+   V  L  F  V    ++ G    ++  L+ V I L   +FI+ E+  A  
Sbjct: 260 --MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIF-EIKYAKV 316

Query: 396 PILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVL---NMGPTDIGKRIVPSF 452
           P+LP    E+RS++    S    M G  + G +I  Y+  VL   N  P   G       
Sbjct: 317 PLLPKEVTESRSIIMILAS---LMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVS 373

Query: 453 FSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCL--YMIPG 510
                 +L  G+ +KR G     LL F ++       I  VTP   T+ + CL   +I  
Sbjct: 374 IVGCIAALTVGFSIKRVGPAV--LLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILS 431

Query: 511 FGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRN 561
           FG                  ++Q    S+     +   +L + IGG I R 
Sbjct: 432 FGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQ 482

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 125/573 (21%), Positives = 210/573 (36%), Gaps = 62/573 (10%)

Query: 118 YLTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRI 177
           Y+    +E  K+   G  A  R  ++AS  L  F   LD    +    + A+ + +   +
Sbjct: 44  YMKVKEMEIIKDVCSGNLA--RVFLLASAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLL 101

Query: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFV 237
           S I     +     Q  + +LSD+FGR  + V   +++ +G +I   + ++ V  +G   
Sbjct: 102 STIQVINSVVGVGAQISFARLSDVFGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIF 161

Query: 238 AGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWR-- 295
              G  G++ +  +  +D+ PLR R  YQ   + F               A+    W   
Sbjct: 162 YNTGFVGVSLLLILVLSDMSPLRWRLFYQFTAS-FPCIIISWISGDIVEAANPMKNWSWD 220

Query: 296 ---MAFLVQVPLTLLSTTAIQLFLT-----------LPKPVDAHKGAGQRSIPWTTK--L 339
               AF+   PL+ L       + T           L   V+ HK    R+I    K   
Sbjct: 221 IGMWAFI--FPLSSLPFITYLFYATHISSKTKKWKDLRNKVETHK----RNIILVVKDIF 274

Query: 340 RMVDWTGTVTLVVFLFCFTLVCSLYGE-----DLPHLYLIFVVILLSGSYFIYHELYVAT 394
             +D  GTV +   L    +  +L G        P +    V+ +     F++ E   A 
Sbjct: 275 NQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFWEAKFAK 334

Query: 395 DPILPIRFLENRSVLAASLSNWF-CMMGMMTTGFYIPVYYASVLNMGPTDIGKRIV--PS 451
           +  LP   L++R V A+ ++ +   M+  M + +  PV   SV     +    RIV  P+
Sbjct: 335 NAALPFNLLKDRGVWASIVAAFLEKMIYAMISDYLYPVLLVSVNETNKS--ATRIVWLPT 392

Query: 452 FF----STAFGSLGAGYYMKRT----GKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQY 503
           F     S  FG L       +     G + W +     +G+  Q +    + S       
Sbjct: 393 FMACLCSVFFGLLVVSVQRLKVFTICGTFLWII----SIGLFYQFRGGESSHSGIIGASI 448

Query: 504 CLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGL 563
            L    GFGS                  + A+ T + + F   G+  G SI GAI+   +
Sbjct: 449 VL----GFGSAIFTQSIIVTLQAMASHDNMASITGLYFMFAQVGAATGASISGAIWTQTM 504

Query: 564 SNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFH 623
             QL   L  L+  +   +      E  A S  W  KE     R ++I  Y +  + T  
Sbjct: 505 YKQL---LKQLKDSDLTMAVFASPYEFIA-SYAWGTKE-----RDLVIQAYRHVQKVTML 555

Query: 624 FCLACMVLATVACCFIVEYKLHAGNTAPRPQRE 656
             L   V   V+  F  + KL    ++     +
Sbjct: 556 VSLILTVPLLVSVLFTKDRKLSDSVSSDASHED 588

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 56/104 (53%), Gaps = 3/104 (2%)

Query: 160 VTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219
           + T LDH A  + +   I+   +   L S+ F    G  +DI+GR+P L+FSNL+F +GA
Sbjct: 128 IGTDLDHRALTYGDKEIITAATSLGALISSIFA---GTSADIWGRKPCLMFSNLLFTVGA 184

Query: 220 LICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           ++   +++ W + +GR + G G G  + +  +   +I P   R 
Sbjct: 185 VLQISARSFWQMAVGRLIMGFGVGIGSLISPLFIGEIAPKNIRG 228

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 160 VTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219
           + T LD+    + E   I+  AT+  L +  F  + G   DIFGR+P L+FSN++F +GA
Sbjct: 101 IGTDLDNKELTYGE-KEITTAATS--LGALIFALVAGFSVDIFGRKPCLMFSNIMFLIGA 157

Query: 220 LICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP--LRSR 262
           ++   +   W +  GRF+ G G G  + +  +  ++I P  +R R
Sbjct: 158 ILQVTAHKFWQMTAGRFIMGFGVGIGSLIAPLYISEIAPKMIRGR 202

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 55/104 (52%), Gaps = 3/104 (2%)

Query: 160 VTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219
           + T LD+ A  + +   I+   +   L SA F    G  +DIFGR+P L+FSN++F +GA
Sbjct: 89  IGTDLDNKALTYGDKEIITAATSLGALISAVFA---GISADIFGRKPCLMFSNILFVIGA 145

Query: 220 LICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
            +   + + W + +GR + G G G  + +  +  ++I P   R 
Sbjct: 146 ALQVSAHSFWQMAVGRLIMGFGVGIGSLLAPLFISEIAPKHIRG 189

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 101/499 (20%), Positives = 187/499 (37%), Gaps = 59/499 (11%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG        +  S + +   +S I     + SA  Q +Y +LSD++GR  L   S ++
Sbjct: 107 LDGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARLSDVYGRFALFCVSIVL 166

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQG------I 268
           + +G +I   + ++     G      G  G+  +  +  +D   LR R +YQ       I
Sbjct: 167 YSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPFI 226

Query: 269 CNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGA 328
            N +              ++     W  AF+  +    L    I ++    K  +  + +
Sbjct: 227 INTWISGNVTSRANPLKNWSWDIGMW--AFIFPLSCVPLLCVMIHMWWLARKTEEWQELS 284

Query: 329 GQRSIPWTTKLR--------MVDWTGTVTLVVFLFCFTLVCSLYG-----EDLPHLYLIF 375
            +++      L+         +D  G   + + L C  +  +L G      +  H+   F
Sbjct: 285 KEKTFYQKHGLKDTIVELFWKIDAMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPF 344

Query: 376 VVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPV-YYA 434
           V+  +     +  E   A DPI+P + +++R V A+     F +  ++   +Y+   Y  
Sbjct: 345 VLGFVLIPILVLWEYKFARDPIIPYKLVKDRGVWAS-----FAISFLIDFIYYMAADYLY 399

Query: 435 SVLNMGPTDIGK---RIVP-SFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVL----- 485
           +VL +G  +  K   RI   S F +  GS      + R  +   F++  C + +L     
Sbjct: 400 TVLIVGVNESVKSATRISSLSTFVSTVGSPIFSLLITRFSRLKPFIICGCGLWMLAMGLL 459

Query: 486 -----GQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSIS 540
                G    S +  ++  W         G G+                  H A  T+++
Sbjct: 460 YHYRGGAESHSGIIGALCVW---------GVGTTLFTYPVNVSVQAATSHEHMATVTALN 510

Query: 541 YAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHK 600
           Y F   GS +G ++ GAI+    +  LY +L+        A+E      K   +  W   
Sbjct: 511 YTFYRIGSAVGAAVSGAIW----TQTLYKQLLKRVGDAALATEAYASPYKFIVTYTW--- 563

Query: 601 EAPEFARHILIDCYHYAGR 619
           + PE  R  ++  Y Y  R
Sbjct: 564 DTPE--RQAVVQAYRYVQR 580

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGRRP L+FSNL+F +GA++   +   W +  GR V G G G  + +  +  ++
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLVMGFGVGIGSLISPLFISE 229

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 230 IAPKMIRGR 238

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 104/476 (21%), Positives = 180/476 (37%), Gaps = 38/476 (7%)

Query: 122 TAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA 181
           T + AA+ D+       R +++ S  +  F   LD  I      +  S + +   +S +A
Sbjct: 50  TEILAAQYDSW----YYRVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVA 105

Query: 182 TAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIG 241
               L SA  Q  Y +LSD+FGR  L V S + + +G +I   + ++     G     IG
Sbjct: 106 IINNLLSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIG 165

Query: 242 GGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRM----- 296
             GL  +  +  +D   L+ R  YQ      F              A+    W       
Sbjct: 166 YVGLFLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISR-ANPIENWSWGIGMW 224

Query: 297 AFLVQVPLTLLSTTAIQLFLTLP--KPVDAHKGAGQRSIPWTTKLRM--------VDWTG 346
           AF+   PLT L      L +     K  +    + Q+S   T  +          +D  G
Sbjct: 225 AFIF--PLTCLPILFCMLHMRFKARKTPEWQDLSSQKSFFQTHGIVQALVQLFWKLDVVG 282

Query: 347 TVTLVVFLFCFTLVCSLYG---------EDLPHLYLIFVVILLSGSYFIYHELYVATDPI 397
              + + L C  +  +L G         E +  L L FV++ +    FIY E   A DP+
Sbjct: 283 IFIMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVLVPV----FIYWESKWAKDPL 338

Query: 398 LPIRFLENRSVLAASLSNWFC-MMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTA 456
            P   L++R + A+   N+    +  M  G+  PV   +V     +      + SF ST 
Sbjct: 339 APFELLKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLASFVSTV 398

Query: 457 FGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGS-XX 515
             S   GY + R+ +   ++++ C +  L    + +    + +       ++        
Sbjct: 399 -ASPFMGYAVSRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTL 457

Query: 516 XXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
                           + A+ T+++Y     G  +GV++ GAI+   L N L  +L
Sbjct: 458 SIYPINVSAQSLTSHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKRL 513

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGRRP L+FSNL+F +GA++   +   W +  GR + G G G  + +  +  ++
Sbjct: 170 GTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISE 229

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 230 IAPKMIRGR 238

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGRRP L+FSNL+F +GA++   +   W +  GR + G G G  + +  +  ++
Sbjct: 172 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGFGVGIGSLISPLFISE 231

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 232 IAPKMIRGR 240

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGRRP L+FSNL+F +GA++   +   W +  GR + G G G  + +  +  ++
Sbjct: 178 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGFGVGIGSLISPLFISE 237

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 238 IAPKMIRGR 246

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 56/105 (53%), Gaps = 5/105 (4%)

Query: 160 VTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219
           + T LD+    + E   I+   +   L +A F    G  +D+FGR+P ++FSNL+F +GA
Sbjct: 96  IGTDLDNKTLTYGEKEIITAATSLGALITAVFA---GVSADLFGRKPCIMFSNLLFVIGA 152

Query: 220 LICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP--LRSR 262
           ++   +   W + +GR V G G G  + +  +  ++I P  +R R
Sbjct: 153 ILQVSAHTFWQMAIGRLVMGFGVGIGSLISPLFISEIAPKMIRGR 197

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D++GR+P L+FSN++F +GA++   + N W + +GR + G G G  + +  +  ++
Sbjct: 141 GVAADMYGRKPCLMFSNVMFLIGAILQISASNFWQMTVGRLIMGFGVGIGSLISPLFISE 200

Query: 256 IVP--LRSR 262
           I P  LR R
Sbjct: 201 IAPKMLRGR 209

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 69/151 (45%), Gaps = 7/151 (4%)

Query: 151 FLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL-----SDIFGRR 205
           FL   D   +++ L  + ++     ++++    Y+ S+ +   L   L     +D+FGRR
Sbjct: 78  FLFGYDTGYISSALQSVGTDLGH--QLTYRDKEYITSATSLGALIAALGAGICADLFGRR 135

Query: 206 PLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALY 265
             ++FSN++F +G ++   + N W +V+GR V G G G  + +  +  ++I P   R   
Sbjct: 136 KCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGIGFGSLISPLFISEIAPKMIRGRL 195

Query: 266 QGICNVFFXXXXXXXXXXXXXFADRAVGWRM 296
             I +++              F     GWR+
Sbjct: 196 TVINSLWLTGGQLIAYACGAGFQHVKHGWRI 226

>SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]
           {ON} similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 730

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 12/126 (9%)

Query: 146 MCLGVFLAALDGTIVTTLLD--HIASEFNELPRI------SWIATAYLLSSATFQPLYGK 197
           + LGVFL   D  +++ ++   +    F+E  R+      S +    L+SS     + G+
Sbjct: 126 VSLGVFLFGYDQGVMSGIITGPYFKQHFHEPSRVAIGNMVSILEVGALVSSL----MVGR 181

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L + +GRR  + + +L+F  G  I   +  +  L++GR V+G+G G L+++  I  ++I 
Sbjct: 182 LGEKWGRRRTIKYGSLIFVFGGAIQTFASRMSDLIIGRIVSGLGVGLLSTIVPIYQSEIS 241

Query: 258 PLRSRA 263
           P  +R 
Sbjct: 242 PPHNRG 247

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 92/459 (20%), Positives = 170/459 (37%), Gaps = 42/459 (9%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R +++A+  L  F  +LD T+ +T   +  + + E   +S I     + S   Q ++ +L
Sbjct: 54  RALMIATAFLCGFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRL 113

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SD FGR  L V + +++ +G ++   + ++ +   G      G  G+T +  +  +D   
Sbjct: 114 SDYFGRVELFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSDFSS 173

Query: 259 LRSRALYQGICNV-FFXXXXXXXXXXXXXFADRAVGWRMAFLVQV-PLTLLSTTAIQLFL 316
           L+ R LYQ +    F                ++   W +A    + PL+ L    + +++
Sbjct: 174 LKWRILYQYVPYWPFIIIPWISGNIVTAANPEKDWSWDIAMWAFIFPLSALPMICLLVYM 233

Query: 317 TLPKPVDAHKGAGQRSIPWTTKLRM--------------VDWTGTVTLVVFLFCFTLVCS 362
                  + K    +++   T ++               +D  G + + V L C  +  +
Sbjct: 234 MY----KSSKTPEWKALKERTHIKKNQGFLKNTVFLFWELDSIGIILITVSLGCVLVPLT 289

Query: 363 LYG--EDLPHLYLIFVVILLSG---SYFIYHELYVATDPILPIRFLENRSV---LAASLS 414
           L        H   I   ++  G     F++ E   A +P+LP + L +R +   L  +  
Sbjct: 290 LANGVSQKWHSSKIIGTLVFGGVLFCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFF 349

Query: 415 NWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYW 474
           N+F     +   F  PV   S+     T      +P F          G  + +  +   
Sbjct: 350 NYFTF--FIACDFLYPVLLVSMNESSTTATRILNLPDFVGATLSPF-YGILVAKARR--- 403

Query: 475 FLLAFCLVGVLGQVQIS------YVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXX 528
             L F +VG      IS      Y   S S        +I G                  
Sbjct: 404 --LKFSVVGGCAAWMISMGLFYQYRGGSESHGGAIAASVIMGMSGLLCSNSVIVSLQAMT 461

Query: 529 PQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQL 567
                A  TSI + F   G+ +G S+ GA++   + NQL
Sbjct: 462 THGRMAVITSIYFTFSKVGAAVGASVSGAVWTQIMPNQL 500

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 63/129 (48%), Gaps = 4/129 (3%)

Query: 144 ASMCLGVFLAA----LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 199
           A +  G F+ +    LD  +      + AS + +   +S I     ++SAT Q +Y + S
Sbjct: 114 ALLLFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRAS 173

Query: 200 DIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPL 259
           DIFGR  LL+ + + + +G +I   + ++     G F   +G  G++ + ++  +D   L
Sbjct: 174 DIFGRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSL 233

Query: 260 RSRALYQGI 268
           + R  YQ I
Sbjct: 234 KWRFFYQAI 242

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 7/127 (5%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGR+P L+FSN++F +GA++   S   W +  GR + G G G  + +  +  ++
Sbjct: 198 GTAADVFGRKPCLMFSNVMFVVGAILQISSHTFWQMCAGRLIMGFGVGIGSLISPLFISE 257

Query: 256 IVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQL- 314
           I P   R     I ++               F     GWR    + V L+L+  T IQ  
Sbjct: 258 IAPKMIRGRLTVINSLCLTGGQLIAYGCGAGFNYVNNGWR----ILVGLSLIP-TVIQFT 312

Query: 315 -FLTLPK 320
            FL LP 
Sbjct: 313 CFLFLPD 319

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 120/305 (39%), Gaps = 19/305 (6%)

Query: 136 ATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLY 195
           +T + V++ ++ L  +   L G I  ++  + A+ F +  ++  I T   + S+     Y
Sbjct: 55  STLKTVLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPY 114

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
            ++SD FGR    +F+ +++ +G +I   + N   L  G  +   G  G   + +  T D
Sbjct: 115 ARMSDRFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGD 174

Query: 256 IVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAV--GWRMA---FLVQVP---LTLL 307
           +  LR R     I  +                A       WR     F + VP   L L+
Sbjct: 175 LSGLRDRTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILV 234

Query: 308 STTAIQLFL-----TLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS 362
              A   ++     TLP      KG   R   W      ++  G +    FL    L  +
Sbjct: 235 LPYAYAQYISWRNGTLPPFKLKEKGQNLRQTIWKFA-EDINLIGIILFTAFLVLVLLPLT 293

Query: 363 LYG---EDLPHLYLIFVVIL--LSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWF 417
           + G         Y+I ++++    G  F+  EL  A +P +P  +L + ++  A L  + 
Sbjct: 294 IAGGATSKWREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFV 353

Query: 418 CMMGM 422
             +G+
Sbjct: 354 WRLGL 358

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 57/126 (45%), Gaps = 5/126 (3%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +DIFGR+P L+FSN++F +GA++   +   W +  GR + G G G  + +  +  ++
Sbjct: 148 GTAADIFGRKPCLMFSNVLFVIGAILQITAHRFWQMNAGRLIMGFGVGIGSLISPLFISE 207

Query: 256 IVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTT-AIQL 314
           I P   R     I +++                    GWR    + V L+L+ T      
Sbjct: 208 IAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNGWR----ILVGLSLIPTVLQFSF 263

Query: 315 FLTLPK 320
           FL LP 
Sbjct: 264 FLFLPD 269

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGR+P L+FSN++F +GA++   +   W +  GR + G G G  + +  +  ++
Sbjct: 159 GTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQMAAGRLIMGFGVGIGSLISPLFISE 218

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 219 IAPKMIRGR 227

>KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]
           {ON} similar to uniprot|P43562 Saccharomyces cerevisiae
           YFL040W Hypothetical ORF
          Length = 502

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITT 253
           L+G ++D  GR P      L++ +G++I     N+W+L+ GRF+ GI  G  + +  +  
Sbjct: 68  LFGIMTDKLGRAPTFRVLALIWIIGSIISAAVLNVWMLIAGRFIRGIAVGSFSVLLPVYI 127

Query: 254 TDIVPLRSRAL 264
            ++VP + R L
Sbjct: 128 GEVVPEQRRGL 138

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 91/239 (38%), Gaps = 16/239 (6%)

Query: 126 AAKEDAGGLGATRRR---------VVMASMCLGVFLAALDGTIVTTLLDHIASEFN-ELP 175
           AA + + G+   RRR         + MA + LG     L+   V ++++ +   +  E  
Sbjct: 8   AAPKLSEGIYNLRRRCQNSKYQLIINMALIFLGCTFDLLNVAGVISVIEDLGETYGLEYT 67

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGR 235
             SW  T+Y ++ A      G+L DI G   L   S   F L  L+C +  N     + R
Sbjct: 68  TASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPAFAVLR 127

Query: 236 FVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWR 295
            + GI   GL          +       L+  + +  F             FA   VG++
Sbjct: 128 ALQGIAAAGLVPCGYALIPTLADPEDVQLFFAVVSCGFSSTIGIGLIIGGAFALTNVGYK 187

Query: 296 MAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQR---SIPWTTKLRMVDWTGTVTLV 351
             F +     LL + A   F      ++ HK A Q    SI    K+  +D+ G++  +
Sbjct: 188 GIFYLSFAGMLLVSIAAFFF---TYRIEEHKFAEQDYEGSIHRPGKVASLDFVGSLIFI 243

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G L+DIFGR+P+ + SN++F +GA++   +++ W +  GR + G G G  + +  +  ++
Sbjct: 139 GTLADIFGRKPVTMSSNVMFLIGAILQACTRSFWQMAAGRLLMGFGIGIGSLLSPLFISE 198

Query: 256 IVPLRSRA 263
           I P   R 
Sbjct: 199 IAPSEYRG 206

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 100/248 (40%), Gaps = 8/248 (3%)

Query: 148 LGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRP 206
           LG     L+   + +L+D +A ++N      SW  T+Y ++ A F    G+L DI G   
Sbjct: 36  LGCTFDLLNVASMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSV 95

Query: 207 LLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ 266
           L   S   F + +L+C +  N     + R + GI   GL          + P      Y 
Sbjct: 96  LFTISCSCFAILSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYF 155

Query: 267 GICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHK 326
            I +  F             FA   +G+R  F +   +  L  + I  F T    V+   
Sbjct: 156 SIVSCGFSSTIGLGLIIGGAFAATKIGYRGIFYLTFAVMSL-ISVIAFFFTY--NVENFD 212

Query: 327 GAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGE--DLPHLYLIFVV-ILLSGS 383
              Q+ I   T ++ +D+ G++  V       +  +  GE  + P  Y+  ++ ILL   
Sbjct: 213 KKPQK-IQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVTLIIGILLFFG 271

Query: 384 YFIYHELY 391
           +F+++  Y
Sbjct: 272 FFVWNCTY 279

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 5/128 (3%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITT 253
           + G  +D++GR+P ++FSN++F +GA++   +   W +  GR + G G G  + +  +  
Sbjct: 179 MAGTAADMYGRKPCIMFSNIMFLVGAILQVSAHKFWQMAAGRLIMGFGVGIGSLISPLFI 238

Query: 254 TDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTT-AI 312
           ++I P   R     I +++              F     GWR    + V L+L+ T    
Sbjct: 239 SEIAPKMIRGRLTVINSLWLTGGQLIAYGLGAAFNHVNNGWR----ILVGLSLVPTVLQF 294

Query: 313 QLFLTLPK 320
             FL LP 
Sbjct: 295 CFFLFLPD 302

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 85/218 (38%), Gaps = 15/218 (6%)

Query: 140 RVVMASMCLGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKL 198
            V +A + LG     L+   + +L+D +A +++      SW  T+Y ++ A F    G+L
Sbjct: 28  NVNVALIFLGCTFDLLNVASMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRL 87

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
            DI G   L   S   F + +L+C +  N     + R + GI   GL          + P
Sbjct: 88  GDIVGNSILFTVSCFFFAILSLLCAVMPNFPAFAVFRAIQGISAAGLVPCAYALIPMLAP 147

Query: 259 LRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLT- 317
                 Y  I +  F             FA   +G++  F +   +  L  + +  F T 
Sbjct: 148 EEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYKGIFYLTFAVMFL-ISIVAFFFTY 206

Query: 318 ----LPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLV 351
               L +P         R    T ++R +D+ G++  V
Sbjct: 207 GVENLSEP--------PRKDQATNRVRSLDFIGSLIFV 236

>Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199C -
           Hypothetical ORF [contig 27] FULL
          Length = 723

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 12/126 (9%)

Query: 146 MCLGVFLAALDGTIVTTLLD--------HIASEFNELPRISWIATAYLLSSATFQPLYGK 197
           + LGVFL   D  +++ ++         H  S F     +S +    L+SS     + G+
Sbjct: 120 VSLGVFLFGYDQGVMSGIITGPLFKDYFHDPSRFAIGNMVSILEIGALISSL----MVGR 175

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L + +GRR  + + + VF +G L    +  L  L++GR ++G+G G L+++  I  ++I 
Sbjct: 176 LGEKWGRRRTIRYGSFVFIIGGLFQTSATKLSHLIIGRVISGLGVGLLSTIVPIYQSEIS 235

Query: 258 PLRSRA 263
           P  +R 
Sbjct: 236 PPHNRG 241

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 62/133 (46%), Gaps = 3/133 (2%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLYG 196
            + +  A +CL      L  +I    +  I+ +++ +  ++ +  T Y+L  A    LY 
Sbjct: 190 EKTITCAILCLDCITITLGSSIFAPGVTQISEQYDIITVVAILGITLYVLGFAASPVLYA 249

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
            LS+I+GR+ +LV S   F L       ++NL  +++ RF +G+ GG   ++      D+
Sbjct: 250 PLSEIYGRKLILVISGFGFALFQFAVATAENLQTIMICRFFSGLIGGAPMAVVPAVFADM 309

Query: 257 VPLRSRALYQGIC 269
                R   + IC
Sbjct: 310 FDTNFRG--KAIC 320

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/379 (20%), Positives = 146/379 (38%), Gaps = 41/379 (10%)

Query: 230 VLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFAD 289
           +L++GR VA +GG GL ++C +    +V  RSR L   I +  F             F  
Sbjct: 3   MLIVGRVVASVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTT 62

Query: 290 RAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDA------HKGAGQRSIPWTTKLR--- 340
             V WR  F + +P+  L   AI +FL   K  +           G  S    +K R   
Sbjct: 63  H-VTWRWCFYINLPIGGL---AIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQV 118

Query: 341 -----------MVDWTG----TVTLVVFLFCFTLVCSLY----GEDLPHLYLIFVVILLS 381
                        D+ G    +  LV+FL   T   + Y    G+ + +L L  ++ + S
Sbjct: 119 NFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLFIFS 178

Query: 382 GSY--FIYHELYVATD-----PILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYA 434
             Y  F++ +     D     P+L  R +   +++  ++  +    G      Y   ++ 
Sbjct: 179 LVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQFFQ 238

Query: 435 SVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVT 494
            +        G  ++P   +    ++ +G   K+ G     L+   ++GV+G   ++ +T
Sbjct: 239 LIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMT 298

Query: 495 PSISTWRQYCLYMIPGFG-SXXXXXXXXXXXXXXXPQRHQAATTSISY-AFRSTGSTLGV 552
            + +   Q  + ++PGF                    R +AA   I   AF +   +LG 
Sbjct: 299 NTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGT 358

Query: 553 SIGGAIFRNGLSNQLYSKL 571
           ++GG +     S   ++K+
Sbjct: 359 TLGGVLSTTVFSASFHNKV 377

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 96/458 (20%), Positives = 172/458 (37%), Gaps = 64/458 (13%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG I      +  S + E   +S I     ++SA  Q +Y + SD+FGR  L + S + 
Sbjct: 128 LDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASDVFGRLSLFIVSVVF 187

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------GI 268
           + +G +I   + ++     G F   IG  G+  +  +  +D   L+ R  YQ       I
Sbjct: 188 YAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSLKWRLFYQFAPTWPYI 247

Query: 269 CNVFFXXXXXXXXXXXXXFADRAVGWRMAF-LVQVPLTLL---------STTAIQLFLTL 318
            N +              ++     W   F L  +P+ L           T   +L    
Sbjct: 248 INTWISGNITSAANPLKHWSWDIGMWAFIFPLSSIPIILCLIHMRWMASKTKEWKLLKQE 307

Query: 319 PKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSL---------YGEDLP 369
              +  H          T     +D  G + +   L C  +  +L         +G  + 
Sbjct: 308 KSYIQQHTFVSAI----TDLFWRLDVIGVLLMGASLGCILVPLTLAGGTSSKWNHGNIIA 363

Query: 370 HLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYI 429
              L FV+I +    F + E   +  P++P + +++R+V ++       +  ++   FY+
Sbjct: 364 PFALGFVLIPI----FTFWEWKFSKSPLIPSKLVKDRAVWSS-----MAISFLIDFIFYM 414

Query: 430 PV-YYASVLNMGPTDIGK---RI--VPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVG 483
            V Y  +VL +G  +  K   RI  + SF ST  GS      + R  +   F++A C + 
Sbjct: 415 AVDYLYTVLIVGVNESVKSATRISSLSSFVSTV-GSPIFALLITRFTRLKPFIVAGCALW 473

Query: 484 VL----------GQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQ 533
           +L          G    + +  S+  W         G G+                    
Sbjct: 474 MLSMGLLYHYRGGASSHNGIIASLCVW---------GVGTTLFTYPINVSVQAAVSHADM 524

Query: 534 AATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
           A  T+++Y     GS +G ++ GAI+   L  QL+ ++
Sbjct: 525 ATVTALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRM 562

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 106/498 (21%), Positives = 177/498 (35%), Gaps = 37/498 (7%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           +  +  S+ L  F+  LD  +  ++  +  + + +   +S +     +++A   PLY +L
Sbjct: 74  KSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLYSRL 133

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SD+FGR  L+V S L++  G +IC  + ++     G  +   G  GL  +  +   D   
Sbjct: 134 SDVFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFGLCGLAILFKVIAADFSN 193

Query: 259 LRSRALYQGICNVFFXXXXXXXXXXXXXFADR----AVG-WRMAFLV-QVPLTLLSTTAI 312
           L  R     I    F               D      +G W +   V  +PL L     I
Sbjct: 194 LNWRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAICLPVATIPLVL---CFI 250

Query: 313 QLFLTLPKPVD---------AHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSL 363
            +     K  D          +K  G +          +D  G ++L++ L       +L
Sbjct: 251 HMQYLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLSLMIILGLILTPLTL 310

Query: 364 YGEDLPHLYLIFVVILLSGSY-----FIYHELYVATDPILPIRFLENRSV---LAASLSN 415
            G +        V++ L   +     F + E  +AT PI P     +R V   L   +  
Sbjct: 311 AGGETAEWRTAKVIVPLILGFCWIPVFAFWENRIATHPIAPTDMFRDRGVYCALGIGILI 370

Query: 416 WFC--MMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSF-FSTAFGSLGAGYYMKRTGKY 472
            FC  M G       +   + SV +        RI   + FST    L  G  + +  K 
Sbjct: 371 DFCWYMQGDYLYTILVVAIHESVKS------ATRINSLYSFSTIITGLCVGLAISKVRKM 424

Query: 473 YWFLL-AFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQR 531
             F++   C+  V   + I Y   S S        ++ GFG                   
Sbjct: 425 KCFIVFGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQASLQAYVNHE 484

Query: 532 HQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKA 591
             A  T++       GS +G S+ GAI+   L N++  +           S  L  I+K 
Sbjct: 485 RMATITTLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAYSAPLSFIKKY 544

Query: 592 AHSTEWVHKEAPEFARHI 609
              T  +  E  E  RH+
Sbjct: 545 TWGTP-LRMELVEAYRHV 561

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 98/502 (19%), Positives = 184/502 (36%), Gaps = 61/502 (12%)

Query: 154 ALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNL 213
           +LD +I    + +  + +N    +S I+   ++ SA  Q  +  LSD+FGR  L++ + L
Sbjct: 88  SLDSSIRYVYMTYATNSYNTHSLLSTISIINMMISAVAQLFFAGLSDVFGRLRLMIVAIL 147

Query: 214 VFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------G 267
            + +G +I   + ++     G     IG  G+    S+   D   L+ R LY        
Sbjct: 148 FYVVGTVIQSQAYDIQRYAAGSVFYNIGVVGVMLQVSLFLADNSSLKWRLLYSFVPAWPA 207

Query: 268 ICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKG 327
           I N++              ++     W  AF++ +    L    + +     K  +  + 
Sbjct: 208 IINMWVSGNIVKAANPLVNWSWNIAMW--AFILPLSCVPLLCCVVHMRWKASKTPEWQEL 265

Query: 328 AGQRSI--------PWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYG---EDLPHLYLIFV 376
             + +                 VD  G + L   + C  +  ++ G   E   +  +I  
Sbjct: 266 ESELTFYQKHGFVHTIVEVFWKVDIVGLLLLTASMGCILVPLTIAGGISEQWNNGKIIGP 325

Query: 377 VILLSGSYFI----YHELYVATDPILPIRFLENRSVLA-ASLSNWFCMMGMMTTGFYIPV 431
           ++L  G + +    Y E   A  P  P   L++R + A  S+    C +  M  G+   +
Sbjct: 326 LVL--GVFLVPLTIYWESNWAKVPFAPFLLLKDRGIWAPMSIMFLVCFIYQMAAGY---L 380

Query: 432 YYASVLNMGPTDIGKRIVPSFFSTAFGSLGA--GYYMKRTGKYYWFLLAFCLVGVL---- 485
           Y   +++M  T++    + + +S   G      G+ + RTG+   F+L  C +  L    
Sbjct: 381 YTILLVSMNQTELSATRIMNLYSFVAGIYSPIFGFVVARTGRLKSFMLVGCCLYFLVMGL 440

Query: 486 ------GQVQISYVTPSISTWR-QYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTS 538
                 G    S +  ++  W    C+Y  P                      + A  T+
Sbjct: 441 FYRYRGGLGAESGIIGAMVVWGIASCMYTYP----------VTTSAQSVTSHENMATVTA 490

Query: 539 ISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWV 598
           +       G  +G S+ GAI+ N L  +L   L  ++      +  L  I     +TE  
Sbjct: 491 MLLTIFRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAAYTAPLTFIVSHPWNTE-- 548

Query: 599 HKEAPEFARHILIDCYHYAGRY 620
                   R  +ID Y +  +Y
Sbjct: 549 -------VRTAMIDAYRHVQKY 563

>NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa]
           {ON} Anc_4.30
          Length = 567

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 3/133 (2%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLYG 196
           ++ +    +CL     ++  +I  + +  I   +  +  ++ +  T Y+L  A    +Y 
Sbjct: 125 KKVITCVILCLNCICISMGSSIFASAVPQICEIYGVIQVVAILGVTLYVLGFAISPIVYA 184

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
            LS+I+GRR +LV S+  FCL       ++NL  +++ RF  G+ G    ++      D+
Sbjct: 185 PLSEIYGRRGVLVISSFGFCLFQFAVATAENLQTIMICRFFGGLMGAAPFAVVPAAMADM 244

Query: 257 VPLRSRALYQGIC 269
               +R   + IC
Sbjct: 245 FDTNTRG--KAIC 255

>CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1
          Length = 577

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 138 RRRVVMAS-MCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLY 195
           R++V++   +CL      +  +I  T +  I   ++ +P ++ +  T Y+L  A    +Y
Sbjct: 134 RKKVMLCIILCLNCISITMGSSIFATGIRQICEIYHVIPVVAILGITLYVLGFAASPVIY 193

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGG 242
             LS+I+GRR +LV S+  F L       +K+L  +++ RF AG  G
Sbjct: 194 APLSEIYGRRGVLVISSFGFALFNFAVATAKDLQTIMICRFFAGFIG 240

>KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.30
           YLL028W
          Length = 567

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 56/107 (52%), Gaps = 1/107 (0%)

Query: 137 TRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLY 195
           T++ ++   +CL     ++  +I  + +  I   ++ +  ++ +  T Y+   A    +Y
Sbjct: 124 TKKTIICLILCLDCICISMASSIFASGVTQICEIYHVIQVVAILGVTLYVFGFAASPIIY 183

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGG 242
             LS+I+GRR +LV S+L FC+       ++NL  +++ RF  G+ G
Sbjct: 184 APLSEIYGRRGVLVLSSLGFCIFQFAVATAENLQTIMICRFFGGLIG 230

>KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} similar
           to uniprot|P39932 Saccharomyces cerevisiae YDR536W STL1
           Glycerol proton symporter of the plasma membrane,
           subject to glucose-induced inactivation, strongly but
           transiently induced when cells are subjected to osmotic
           shock
          Length = 677

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query: 146 MCLGVFLAALDGTIVTTLLD--HIASEFNELPRISWIAT-------AYLLSSATFQPLYG 196
           + LGVFL   D  +++ ++   +  + FN  P  + I T         L+SS     L  
Sbjct: 123 VSLGVFLFGYDQGVMSGIITGPYFKTYFNN-PTAATIGTMVSILEIGALVSSL----LVS 177

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
            + + FGRR  + + +L+F LG L+   S  +  ++ GR ++GIG G L+++  I  ++I
Sbjct: 178 NIGEKFGRRFTIKYGSLIFILGGLVQTFSWEMGHMIFGRIISGIGVGLLSTIVPIYQSEI 237

Query: 257 VPLRSRA 263
            P  +R 
Sbjct: 238 SPPHNRG 244

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 95/445 (21%), Positives = 166/445 (37%), Gaps = 38/445 (8%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG I      +  S ++E   +S I     + SA  Q +Y +LSD+FGR  L + + ++
Sbjct: 90  LDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVIL 149

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFX 274
           + +G +I   + ++     G      G  G+  +  I  +D   L+ R LYQ +    F 
Sbjct: 150 YVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFVPTWPFI 209

Query: 275 XXXXXXXXXXXXFADRAVGWR-----MAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAG 329
                        A+  V W       AF+  +    +    + +     K  + H   G
Sbjct: 210 INTWIAGNITSR-ANPVVNWSWDVGMWAFIFPLSCVPIVLCMLHMQWRARKTPEWHALKG 268

Query: 330 QRS-------IPWTTKL-RMVDWTGTVTLVVFLFCFTLVCSLYG-----EDLPHLYLIFV 376
           Q+S       I    +L  M+D  G + +   L C  +  +L G      +   L   FV
Sbjct: 269 QKSYYQEHGFIKILKQLFWMLDVVGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFV 328

Query: 377 VILLSGSYFIYHELYVATDPILPIRFLENRSVLAA-SLSNWFCMMGMMTTGFYIPVYYAS 435
           +  +        E   A DPILP R +++R+V ++  +S     +  M   +   V   +
Sbjct: 329 LGFVLIPILWIWEYRFARDPILPYRLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVA 388

Query: 436 VLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMK--RTGKYYWFLLAFCLV--GVL-----G 486
           V     +      + SF ST      A    +  R   +  F  A  +V  G+L     G
Sbjct: 389 VNESVKSATRIATLSSFVSTVASPFFALLVTRCTRLKPFIMFGCALWMVAMGLLYHFRGG 448

Query: 487 QVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRST 546
               S +  ++  W         G G+                  + A  T+++Y     
Sbjct: 449 SQSHSGIIGALCVW---------GVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLYRI 499

Query: 547 GSTLGVSIGGAIFRNGLSNQLYSKL 571
           GS +G ++ GAI+   L  Q+  ++
Sbjct: 500 GSAVGSAVSGAIWTQTLYKQILKRM 524

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALIC--GMSKNLWVLVLGRFVAGIGGGGLTSMCSITTT 254
           K+ DI+GR+  ++F N+++ +G LIC   M    +   +GR ++G+  GG  ++  I   
Sbjct: 210 KIGDIYGRKIGIIFMNVIYIIGQLICITSMKHKWYQYTIGRIISGLAVGGFMTLIPIFLA 269

Query: 255 DIVPLRSRAL 264
           +  P   R L
Sbjct: 270 ETAPKHLRGL 279

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 100/249 (40%), Gaps = 10/249 (4%)

Query: 148 LGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRP 206
           LG     L+   + +L+D +A  +N      SW  T+Y ++ A F    G+L DI G   
Sbjct: 36  LGCTFDLLNVASMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSV 95

Query: 207 LLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ 266
           L   S   F + +L+C +  N     + R + GI   GL          + P      Y 
Sbjct: 96  LFTISCSCFAVLSLLCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYF 155

Query: 267 GICNVFFXXXXXXXXXXXXXFADRAVGWRMAF-LVQVPLTLLSTTAIQLFLTLPKPVDAH 325
            I +  F             FA   +G+R  F L    +TL+S  A   F    + ++  
Sbjct: 156 SIVSCGFSSTIGLGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAF-FFTYGVEKLNKK 214

Query: 326 KGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGE--DLPHLYLIFVV-ILLSG 382
               Q S    T ++ +D+ G++  V       +  +  GE  + P  Y+  V+ I+L  
Sbjct: 215 PQKDQAS----TSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVTLVIGIILFF 270

Query: 383 SYFIYHELY 391
            +F+++  Y
Sbjct: 271 GFFVWNCTY 279

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 127/298 (42%), Gaps = 46/298 (15%)

Query: 162 TLLDHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGAL 220
           ++++ IA +F +E  + +W+  ++ L S +F  + G+  DI+G + +L+    +  + ++
Sbjct: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159

Query: 221 ICGM-----SKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPL-----RSRALYQGICN 270
           ICG+     S +    ++ +   G+G        S    +I+ L        ++ + I  
Sbjct: 160 ICGLTHYTHSDDF--FIVAKAFQGLG-------VSFILPNIIGLVGTIYEPGSMKKNITI 210

Query: 271 VFFXXXXXXXXXXXXXFADRAV-----GWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAH 325
            F              F+   V      W   F     ++ L    +  +  +P  V  +
Sbjct: 211 SFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFL--VGVTCYFFVPDNVPTN 268

Query: 326 KGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVV-ILLS 381
                     T  L+M DW G+   VV L  F+ V +   + G D  ++ ++ V+ ++L 
Sbjct: 269 ----------TNNLKM-DWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILI 317

Query: 382 GSYFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM 439
            ++FIY E+  A  P+LP     NR ++   L+     MG  T G +   Y++  LN+
Sbjct: 318 IAFFIY-EINYAEVPLLPKAITGNRHIIMILLA---IFMGWGTFGIWSFYYFSFSLNL 371

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 114/287 (39%), Gaps = 28/287 (9%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG I      +  + ++E   +S I     +  A  Q +Y +L+D FGR  L + + + 
Sbjct: 78  LDGNIRYIYTGYATNAYSEHSLLSTIGVVNNVIGAASQLVYARLADTFGRLSLFITAIVF 137

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------GI 268
           + +G +I   + ++     G     IG  G+  +  +  +D   LR R LY        I
Sbjct: 138 YAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILVLLLMLSDFSSLRWRLLYTIVPTWPFI 197

Query: 269 CNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK-------P 321
            N +              ++     W   F    PL+ +   A  + + +          
Sbjct: 198 INTWISGNITSAAKPETNWSWDIGMWAFIF----PLSCVPLIACMIHMRIKARKTPEWIA 253

Query: 322 VDAHKGAGQRSIPWTTKLRM---VDWTGTVTLVVFLFCFTLVCSLYG-----EDLPHLYL 373
           +   K   Q +  W T + +   +D  G + L+  L C  +  +L G      + PH+  
Sbjct: 254 LKQEKSYFQTNGLWDTLVELFWKLDVVGVLLLIATLGCILVPLTLAGGYNSKWNNPHIIG 313

Query: 374 IFVVILLSGSYFIYHELYVATDPILPIRFLENRSV---LAASLSNWF 417
            FV+  +     ++ E+  A DP++P   +++R V   LA S  N+F
Sbjct: 314 PFVLGFVLVPILMFWEMRWARDPLVPYGLIKDRGVWSALAISFLNYF 360

>KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly
           similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 733

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 66/126 (52%), Gaps = 12/126 (9%)

Query: 146 MCLGVFLAALDGTIVTTLLDHIASE--FNELPR------ISWIATAYLLSSATFQPLYGK 197
           + LGVFL   D  +++ ++     +  F++  R      +S +    L+SS     + G+
Sbjct: 129 VSLGVFLFGYDQGVMSGIITGPLFKLYFDDPSRAAIGNMVSILEVGALVSSL----MVGR 184

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L + +GRR  + + + VF LG LI   +  +  L++GR ++G+G G L+++  I  ++I 
Sbjct: 185 LGEKWGRRRTIRYGSFVFILGGLIQTSATRMLHLIIGRVISGLGVGLLSTIVPIYQSEIS 244

Query: 258 PLRSRA 263
           P  +R 
Sbjct: 245 PPHNRG 250

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
           {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%)

Query: 545 STGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPE 604
           +T +   + + G  F+  +   L  +L      +H   EL   I+KA  S EW+ +++P+
Sbjct: 523 TTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSPD 582

Query: 605 FARHILIDCYHYAGRYTFHFCLAC 628
                +  CY  + RY F F L C
Sbjct: 583 LISTSIFSCYLDSIRYVFIFNLFC 606

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 107/286 (37%), Gaps = 31/286 (10%)

Query: 7   GLKTKQRDRLREFAKRKERQRALAG-----------QNQAGVGQDXXXXXXXXXXXXGEQ 55
           G K KQR RLR+F + KE QR                N   +  +               
Sbjct: 2   GKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETILANAIPIKLETKLNATLPTAKKEPD 61

Query: 56  SGLLEASRGT---LVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQ 112
             L    +GT   L S   +  + L  ++L +   + +     A + +          ++
Sbjct: 62  HELQRIKKGTESCLFSPKLTTSNPLRETDLSLSTNERIIDKSVAITTSLRESHSLELGSE 121

Query: 113 KPTEVYLTATAVE----AAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIA 168
             +  +  + A +      +     + ATR   ++A +C+ +     D +        I+
Sbjct: 122 YGSIDFENSVAKDGNFNVCQAHQIKISATRLHFIIACICISMLSLGADFSFTLVSSPSIS 181

Query: 169 SEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLL---VFSNLVFCLGALICGMS 225
           SEF+ L     I   YLL+     P+   ++ +  ++  +   + SNL+  + +L C   
Sbjct: 182 SEFDHLADFFIIFGIYLLA----IPIAFYVTSLTIKKYFISSTILSNLLALISSLSCTYF 237

Query: 226 KNLWVLVLGRFVAGIGGGGLTSMCSITTT---DIVPLRSRALYQGI 268
           K L +LVL R + G   G   S C I  T    +VP  ++  Y  I
Sbjct: 238 KGLNMLVLSRILFGAACG---SCCYIDLTLCEKLVPTNTKNKYSNI 280

>ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 592

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 1/119 (0%)

Query: 146 MCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATA-YLLSSATFQPLYGKLSDIFGR 204
           +CL     A+  +I  + ++ I   ++ +P ++ +  A Y+L  A    +Y  LS+++GR
Sbjct: 158 LCLDCIAIAMGSSIFASGVEQICEIYHVIPVVAILGIALYVLGFAASPIIYAPLSELYGR 217

Query: 205 RPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           R +LV S+  F +       +K+L  +++ RF AG  G    ++     TD+     R 
Sbjct: 218 RGVLVISSFGFAIFHFAVATAKDLQTIMICRFFAGFIGAAPMAVVPAAFTDMFDTNFRG 276

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 94/242 (38%), Gaps = 27/242 (11%)

Query: 188 SATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTS 247
           SA  Q  Y + SDIFGR P+L+ S L + +G LI   + ++     G  +  +G  G   
Sbjct: 104 SAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALGYAGSVL 163

Query: 248 MCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAF--------L 299
           +  +  +D   L+ R +      V F               D    W+  F        L
Sbjct: 164 VTQVLVSDYSTLKWRLVSS---TVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFIFPL 220

Query: 300 VQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQ-RSIPWTTKLRMV-----DWTGTVTLVVF 353
             +P  LL   A   +L +    D      + RSI W   L  +     D  G + LV F
Sbjct: 221 ASIP--LLCCLAHMKYLAIKNKEDVKLTISKPRSISWARHLYDIFFWKLDMLGLILLVAF 278

Query: 354 ----LFCFTLVCSLYGEDLPHLYLIFVVIL---LSGSYFIYHELYVATDPILPIRFLENR 406
               L   TL   L+ E       I   +L   L+   F+  EL  A++PI P+  +++R
Sbjct: 279 FALILVPLTLAKGLH-EGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDR 337

Query: 407 SV 408
            +
Sbjct: 338 GI 339

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLYG 196
           ++ ++   +CL     ++  +I  + +  I   ++ +  ++ +  T Y+L  A    +Y 
Sbjct: 197 KKVILCVVLCLDCIGISMGSSIFGSAVLQICEIYDVIQVVAILGITLYVLGFAVSPVIYA 256

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
            LS+I+GRR +LV S   FC+       ++NL  +++ RF +G+ G    ++      D+
Sbjct: 257 PLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMICRFFSGVIGSAPMAVVPAAFADM 316

Query: 257 VP--LRSRAL 264
               LR +A+
Sbjct: 317 FDTNLRGKAI 326

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 66/152 (43%), Gaps = 6/152 (3%)

Query: 123 AVEAAKEDAGGLGA--TRRRVVMASMCLGVFL----AALDGTIVTTLLDHIASEFNELPR 176
           AV A    AG   A   R + +  ++ + +FL      L G I  ++  + A+ F + P+
Sbjct: 39  AVNATLSRAGSFTAFGVRFQTLKIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQ 98

Query: 177 ISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRF 236
           I  I T   + +A     Y +LSD FGR    +F+ +++ +G +I   +     L  G  
Sbjct: 99  IGSINTVKSVVAAAVAVPYARLSDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVV 158

Query: 237 VAGIGGGGLTSMCSITTTDIVPLRSRALYQGI 268
           +   G  G   + +  T DI  LR R     I
Sbjct: 159 IQQFGYSGFRLLATALTADISGLRDRTFAMNI 190

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 108/279 (38%), Gaps = 21/279 (7%)

Query: 151 FLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVF 210
           F  +LD T+ +T   +  + ++E   +S +     + S   Q +Y +LSD FGR  L + 
Sbjct: 71  FGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRLFLV 130

Query: 211 SNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICN 270
           + + + +G +I   +  L +   G      G  G   + ++  +D   L+ R  YQ   +
Sbjct: 131 ATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQ-YAS 189

Query: 271 VFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQ 330
            +               A+    W     +   +  LST  I +FL L     + K A  
Sbjct: 190 YWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPI-IFLILYMKYKSSKTAEW 248

Query: 331 RSIPWTTK--------------LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLY-LIF 375
           RS+    +                 +D  G + + V L C  +  +L  E     +    
Sbjct: 249 RSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILVPLTLANETSQKWHNSKI 308

Query: 376 VVILLSGS----YFIYHELYVATDPILPIRFLENRSVLA 410
           +  L+SG      F+Y E   A  P+LP + L +R + A
Sbjct: 309 IATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGIWA 347

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%)

Query: 530 QRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIE 589
               A  T I Y F   G+ +G S+ GAI+   + NQLY  L          ++ L  I 
Sbjct: 468 HSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNL---------GNDTLAEIA 518

Query: 590 KAAHST-----EWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMV 630
            A+  T      W    +PE  R  +++ Y Y  R      LAC V
Sbjct: 519 YASPYTFISDYPW---GSPE--RDAVVESYRYVQRIIMTVGLACTV 559

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 118/297 (39%), Gaps = 31/297 (10%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           + V++ S+ L  +   LDG++ +    +  + ++    +S I+   L+  A+ Q  + +L
Sbjct: 67  KAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQVFFARL 126

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SD+FGR  LL+ + + + +G +I   + ++     G     +G  G+     +  +D   
Sbjct: 127 SDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGLVGVVLQVILILSDFSS 186

Query: 259 LRSRALYQ------GICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLL----- 307
           LR R  Y        I N++              ++     W   F    PLT L     
Sbjct: 187 LRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAFIF----PLTCLPLVCC 242

Query: 308 --------STTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTL 359
                   S T     L L K      G  Q  I    KL +V   G + L V L C  +
Sbjct: 243 ILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQLFWKLDVV---GVLLLTVTLGCILV 299

Query: 360 VCSLYG-----EDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAA 411
             +L G      + PH+   FV+  +    F+  E   A DPI P   L++R V +A
Sbjct: 300 PLTLAGGVSQKWNNPHVIAPFVLGFVLLPIFVVWESKWALDPIAPFELLKDRGVWSA 356

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 5/136 (3%)

Query: 135 GATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFN---ELPRISWIATAYLLSSATF 191
           G T + +++       F +++ G I   +L  I  +FN   EL  I+ +   Y +     
Sbjct: 95  GRTEKSLLIIQCAFTGFFSSVAGAIYYPVLTVIEKKFNITEELVNITVVV--YFIFQGLA 152

Query: 192 QPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSI 251
               G L+D  GRRP+++FS LV+C   +   +S+N   +V+ R +   G   + ++ S 
Sbjct: 153 PSFMGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSG 212

Query: 252 TTTDIVPLRSRALYQG 267
              DI     R  Y G
Sbjct: 213 ICGDITTRAERGAYVG 228

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           GKL DI+GRR  L+ + ++F +G LI   S + W    +GR +AGIG G +  +  +  +
Sbjct: 134 GKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAVLSPMLIS 193

Query: 255 DIVPLRSRA 263
           ++ P   R 
Sbjct: 194 EVAPKELRG 202

>TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 529 PQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRII 588
           P+  QA  TS  Y FRS GS  GV++   + +      L S L  L   E   +EL+  I
Sbjct: 64  PKSRQATATSTLYLFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLD-EDKINELVTKI 122

Query: 589 EKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEY 642
              +   E +H E     + ++ID    A + T H     + L  +A C I E+
Sbjct: 123 TSNSSYIEKLHGE----LKDVVIDVLILARKKT-HLLSTILSLLALAFCVIKEF 171

>YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}
           ITR1Myo-inositol transporter with strong similarity to
           the minor myo-inositol transporter Itr2p, member of the
           sugar transporter superfamily; expression is repressed
           by inositol and choline via Opi1p and derepressed via
           Ino2p and Ino4p
          Length = 584

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 160 VTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219
           + T LDH    + E   ++   +   L ++ F    G  +DIFGR+  L+ SNL+F +GA
Sbjct: 114 IGTDLDHKVLTYGEKEIVTAATSLGALITSIFA---GTAADIFGRKRCLMGSNLMFVIGA 170

Query: 220 LICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP--LRSR 262
           ++   +   W + +GR + G G G  + +  +  ++I P  +R R
Sbjct: 171 ILQVSAHTFWQMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRGR 215

>CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1 polyamine transport protein
          Length = 567

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 62/132 (46%), Gaps = 3/132 (2%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLYGK 197
           + ++   +CL     ++  +I  + +  I   ++ +P ++ +  T Y+   A    +Y  
Sbjct: 126 KTIICIVLCLNCICISMGSSIFASGVPQICKIYHVIPVVAILGVTLYVFGFAASPVIYAP 185

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           LS+++GRR +LV S   F +       SK+L  +++ RF  G+ G    ++      D+ 
Sbjct: 186 LSEVYGRRGVLVISAFGFAVFQFAVATSKDLQSIMICRFFGGLIGAAPMAVVPAAFADMF 245

Query: 258 PLRSRALYQGIC 269
            +R R   + IC
Sbjct: 246 DVRVRG--KAIC 255

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 98/459 (21%), Positives = 169/459 (36%), Gaps = 64/459 (13%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LD  I      +  S ++E   +S +     + SA  Q +Y +LSD FGR  L V + ++
Sbjct: 83  LDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARLSDAFGRFRLFVVAIVL 142

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ------GI 268
           + +G +I   + ++     G      G  G+  +  +  +D+  LR R  YQ       I
Sbjct: 143 YSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMSTLRWRLFYQFVPTWPYI 202

Query: 269 CNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLP-------KP 321
            N +              ++     W   F    PL+ L   A  + +          K 
Sbjct: 203 INTWISGNITSAANPIENWSWDVGMWAFIF----PLSCLPILACMIHMQWRARKTQEWKD 258

Query: 322 VDAHKGAGQR--------SIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYG------ED 367
           +   K   Q+        S+ W      +D  G + +   L C  +  +L G       D
Sbjct: 259 LKTQKTYYQQHGLMKSLVSLFWK-----IDIIGVLLMAASLGCILVPLTLAGGTSSKWRD 313

Query: 368 LPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAA-SLSNWFCMMGMMTTG 426
              + +  +  +L   +FI+ + + ATDPI+P + +++R V A+  +S     +  M   
Sbjct: 314 SRIIGVFVLGFVLIPIFFIWEKKF-ATDPIVPYKLVKDRGVWASLGISFLIDFIYYMAAD 372

Query: 427 FYIPVYYASVLNMGPTDIGKRIVPSFFSTA---FGSLGAGYYMKRT-----GKYYWFL-- 476
           +   V   +V            + SF ST    F SL    + +       G   WFL  
Sbjct: 373 YLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFTRLKPFIIFGCCLWFLAM 432

Query: 477 -LAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAA 535
            L +   G  G    S +   +  W         G GS                    A 
Sbjct: 433 GLLYHFRG--GASSHSGIIGGLCVW---------GLGSTFFTYPVTVSVQAAVSHEQMAT 481

Query: 536 TTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPL 574
            ++++Y F   GS +G ++ GAI+    + +LY KL+ L
Sbjct: 482 VSALNYTFYRIGSAVGAAVSGAIW----TQKLYKKLLSL 516

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 2/111 (1%)

Query: 140 RVVMASMCLGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKL 198
            V +A + LG  +  ++ + + +L+D ++++++      SW  T+Y ++ A F    G+L
Sbjct: 28  NVNVALIFLGCSIDLINVSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRL 87

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMC 249
            DI G   L   S   F + +L+CG+  N     + R + GI   GL  MC
Sbjct: 88  GDIVGNSRLFTVSCGCFAILSLLCGLMPNFEAFAVMRALQGIAAAGLV-MC 137

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSIT 252
           L+ +L DI+GRR  LVF  +V+ +G +I   S + W    +GR ++G+G GG+     + 
Sbjct: 136 LFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMGVGGIAVYSPLL 195

Query: 253 TTDIVPLRSRA 263
            +++ P   R 
Sbjct: 196 ISEVSPKHVRG 206

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 50/113 (44%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG +  T      S FN     S +     ++S+  Q  + + SDIF R   +V S L 
Sbjct: 91  LDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSREFSMVISILF 150

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQG 267
           + +G +I   + ++    +G  + GIG  G+  +C I   D   L  R + + 
Sbjct: 151 YVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLNWRVVAEN 203

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG I      +  S ++E   +S I     + SA  Q +Y +LSD+FGR  L + + ++
Sbjct: 95  LDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVIL 154

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ 266
           + +G +I   + ++     G      G  G+  +  I  +D   L+ R LYQ
Sbjct: 155 YVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLIILSDFSSLKWRLLYQ 206

>TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 67/144 (46%), Gaps = 18/144 (12%)

Query: 127 AKEDAGGLGATRRRVVMASMCL---GVFLAALDGTIVTTL-LDHIASEF--------NEL 174
           A ED  G   ++ R ++  M +   GV      GTI   L +D +   F        +E 
Sbjct: 10  ADEDIRG---SKARAILIGMFVAFGGVLFGYDTGTISGILTMDFVKKTFTDSGEFTASET 66

Query: 175 PRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLG 234
             I+ I +A     A   PL    +D  GRR  L  S ++FC+G ++  ++    +L++G
Sbjct: 67  SLITSILSAGTFVGAMLAPLA---TDTLGRRLGLFISCIIFCVGVILQTIATEQALLIVG 123

Query: 235 RFVAGIGGGGLTSMCSITTTDIVP 258
           R VAG G G L+S+  +  ++  P
Sbjct: 124 RVVAGFGVGVLSSIVPLYQSEAAP 147

>TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432
          Length = 554

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%)

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
           K SD FGRR  L      + +GA+I   S+N+ +LV GR ++GIG G  +S   +  +++
Sbjct: 91  KFSDAFGRRVSLHLCAAFWIIGAIIQCASQNVGMLVAGRVISGIGIGFGSSTAPVYCSEV 150

Query: 257 VPLRSRALYQGI 268
            P + R    GI
Sbjct: 151 SPPKIRGTIAGI 162

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG I      +  S ++E   +S I     + SA  Q +Y +LSD+FGR  L + + ++
Sbjct: 90  LDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVIL 149

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ 266
           + +G +I   + ++     G      G  G+  +  I  +D   L+ R LYQ
Sbjct: 150 YVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQ 201

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 107/281 (38%), Gaps = 25/281 (8%)

Query: 151 FLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVF 210
           F  +LD T+ +T   +  + ++E   +S +     + S   Q +Y +LSD FGR  L + 
Sbjct: 71  FGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRLFLV 130

Query: 211 SNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICN 270
           + + + +G +I   +  L +   G      G  G   + ++  +D   L+ R  YQ    
Sbjct: 131 ATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQYASY 190

Query: 271 V-FFXXXXXXXXXXXXXFADRAVGWRMAFLVQV-PLTLLSTTAIQLFLTLPKPVDAHKGA 328
             +                 +   W +A    + PL+ L      +FL L     + K A
Sbjct: 191 WPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSALPI----IFLILYMKYKSSKTA 246

Query: 329 GQRSIPWTTK--------------LRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLY-L 373
             RS+    +                 +D  G + + V L C  +  +L  E     +  
Sbjct: 247 EWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILVPLTLANETSQKWHNS 306

Query: 374 IFVVILLSGS----YFIYHELYVATDPILPIRFLENRSVLA 410
             +  L+SG      F+Y E   A  P+LP + L +R + A
Sbjct: 307 KIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGIWA 347

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 19/106 (17%)

Query: 530 QRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELLRIIE 589
               A  T I Y F   G+ +G S+ GAI+   + NQLY  L          ++ L  I 
Sbjct: 468 HSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNL---------GNDTLAEIA 518

Query: 590 KAAHST-----EWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMV 630
            A+  T      W    +PE  R  +++ Y Y  R      LAC V
Sbjct: 519 YASPYTFISDYPW---GSPE--RDAVVESYRYVQRIIMTVGLACTV 559

>YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma
           membrane low glucose sensor that regulates glucose
           transport; contains 12 predicted transmembrane segments
           and a long C-terminal tail required for induction of
           hexose transporters; also senses fructose and mannose;
           similar to Rgt2p
          Length = 884

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 65/130 (50%), Gaps = 21/130 (16%)

Query: 138 RRRVVMASMCLGVFLA------ALDGTIVTTLLD------HIASEFNELPRISWIATAYL 185
           +++ +M S+C+GVF+A        D  ++ ++        H+A   +             
Sbjct: 90  QKQSMMMSICVGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPNHDSFTAQQMSILVSF 149

Query: 186 LSSATFQPLYGKL-----SDIFGRRPLLVFSNL-VFCLGALICGMSKNLWVLVLGRFVAG 239
           LS  TF   +G L     SD +GR+P ++FS + +F +G  +   +  + +L++GR ++G
Sbjct: 150 LSLGTF---FGALTAPFISDSYGRKPTIIFSTIFIFSIGNSLQVGAGGITLLIVGRVISG 206

Query: 240 IGGGGLTSMC 249
           IG G ++++ 
Sbjct: 207 IGIGAISAVV 216

>TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.396
           YHR096C
          Length = 587

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTTD 255
           K  D++GRR  LVF  +++ +G LI   S + W    +GR ++G+G GG+T M  +  ++
Sbjct: 152 KAGDLYGRRLGLVFVVVIYTVGILIQICSFDKWYQYFIGRIISGLGVGGITVMSPMLISE 211

Query: 256 IVPLRSRA 263
           + P ++R 
Sbjct: 212 VAPKQTRG 219

>TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4.30
           YLL028W
          Length = 615

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 61/133 (45%), Gaps = 3/133 (2%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLYG 196
           R+ +    +C+     +L  +I    +  I+ ++  +  ++ +  T Y+L  A    LY 
Sbjct: 173 RKFITCCVLCIDCISISLGSSIYAPGVTQISEDYGVITVVAILGVTLYVLGFAASPVLYA 232

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
            LS+++GRR +LV S L F +       ++NL  +++ RF  G+ G    ++      D+
Sbjct: 233 PLSELYGRRGVLVLSGLGFAIFQFAVATAENLQTIMICRFFGGLIGAAPMAVVPAVFADM 292

Query: 257 VPLRSRALYQGIC 269
                R   + IC
Sbjct: 293 FDTNFRG--KAIC 303

>KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weakly
           similar to uniprot|Q12300 Saccharomyces cerevisiae
           YDL138W RGT2 Plasma membrane glucose receptor
          Length = 513

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 67/144 (46%), Gaps = 18/144 (12%)

Query: 127 AKEDAGGLGATRRRVVMASMCL---GVFLAALDGTIVTTL-LDHIASEF--------NEL 174
           A+ED  G   ++ R V   + +   G+      GTI   L +D++   F        NE 
Sbjct: 10  AEEDIQG---SKFRAVFIGLFVAFGGILFGYDTGTISGVLAMDYVKEHFTSRGHFTANET 66

Query: 175 PRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLG 234
             I+ I +A     A   PL    SD  GRR  L+ S L+F +G ++   +    +L++G
Sbjct: 67  SLITAILSAGTFCGAMLAPL---ASDTLGRRLGLIISTLIFAVGVILQVAATGQDLLIVG 123

Query: 235 RFVAGIGGGGLTSMCSITTTDIVP 258
           R VAG G G L+++  +  ++  P
Sbjct: 124 RVVAGAGVGVLSAIVPLYQSEASP 147

>TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 632

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 2/102 (1%)

Query: 136 ATRRRVVMAS-MCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQP 193
           + R + +  S +CL     AL  +I    +  +  ++N +  +  +  T Y+L  A    
Sbjct: 187 SVRDKTITCSILCLDCITIALGSSIFAPGIPQLCEQYNIITVVEILGVTLYVLGFAAVPV 246

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGR 235
           LY  LS+++GR+ +LV S L FCL  +    ++NL  +++ R
Sbjct: 247 LYAPLSELYGRKGVLVLSGLRFCLIQIAVATAENLQTIMICR 288

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R   + + + L  A    L+ KL D +GRR  LV   LV+ +G +IC  + + W    +G
Sbjct: 103 RTGLVVSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIG 162

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           R  AG+G GG+     +  ++  P   R 
Sbjct: 163 RVFAGLGVGGIAVYSPLLISEASPKHLRG 191

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGG 243
           G  +DI+GR+P L+ SNL F +GA++   +   W + +GR + G G G
Sbjct: 131 GTCADIWGRKPCLMISNLFFVIGAVLQVSASTFWQMAVGRLIMGFGVG 178

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R   + + + L  A    L+ KL D +GRR  LV   LV+ +G +IC  + + W    +G
Sbjct: 104 RTGLVVSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIG 163

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           R  AG+G GG+     +  ++  P   R 
Sbjct: 164 RVFAGLGVGGIAVYSPLLISEASPKHLRG 192

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 14/93 (15%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSIT 252
           ++ +L+D  GRR  +V   LV+ +GA+I   S + W    +G+ + G+G GG + +C + 
Sbjct: 125 IFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPML 184

Query: 253 TTDIVPLRSR----ALYQ---------GICNVF 272
            ++I P   R    +LYQ         G C+V+
Sbjct: 185 LSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY 217

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R   + + + L  A    L+ KL D +GRR  LV   LV+ +G +IC  + + W    +G
Sbjct: 106 RTGLVVSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIG 165

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           R  AG+G GG+     +  ++  P   R 
Sbjct: 166 RVFAGLGVGGIAVYSPLLISEASPKHLRG 194

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%)

Query: 173 ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLV 232
           E    SW  TAY ++ A F    G++ DI G   L V S  +F + +LIC +  N     
Sbjct: 58  EFTTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGTFA 117

Query: 233 LGRFVAGIGGGGL 245
           + R + GI   G+
Sbjct: 118 VFRALQGIAAAGI 130

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 14/93 (15%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSIT 252
           ++ +L+D  GRR  +V   LV+ +GA+I   S + W    +G+ + G+G GG + +C + 
Sbjct: 125 IFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPML 184

Query: 253 TTDIVPLRSR----ALYQ---------GICNVF 272
            ++I P   R    +LYQ         G C+V+
Sbjct: 185 LSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY 217

>TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {ON}
           Anc_5.469 YDR387C
          Length = 549

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           LSD +GRR  L F + +F +G +   +SK+L +L++GR V G+  G       +  +++ 
Sbjct: 115 LSDTYGRRKTLAFCSAIFIVGGIWMALSKSLSLLIMGRLVVGVAIGIAAQCVPVFLSEVS 174

Query: 258 PLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAF 298
           P   R     + ++                AD    WR  F
Sbjct: 175 PASIRGTVLTLNSLAITGGQFLSYVAAYMLADLKHSWRYLF 215

>TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {ON}
           Anc_3.84 YDR497C
          Length = 585

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITT 253
           + G  +D++GR+  ++FSN++F +GA++   + + W + +GR + G G G  + +  +  
Sbjct: 147 MAGTAADLYGRKACIMFSNVMFLVGAILQATAFSFWQMAVGRLIMGFGVGIGSLISPLFI 206

Query: 254 TDIVP--LRSR 262
           ++I P  +R R
Sbjct: 207 SEIAPKMIRGR 217

>TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON} 
          Length = 577

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G++ D++GRR  +VF+  +F +G +I   S   W   ++GR VAG+G G    +C +  +
Sbjct: 130 GRVGDLYGRRIGIVFATTIFIVGTIIQIASVKAWYQYMIGRIVAGVGCGLFPVLCPMLIS 189

Query: 255 DIVPLRSRA 263
           ++ P   R 
Sbjct: 190 EVSPKHLRG 198

>YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putative
           hexose transporter that is nearly identical to Hxt11p,
           has similarity to major facilitator superfamily (MFS)
           transporters, expression of HXT9 is regulated by
           transcription factors Pdr1p and Pdr3p
          Length = 567

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R+  I + + +  A    +  K+ DI+GRR  L+    ++ +G LI   S N W    +G
Sbjct: 110 RMGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIG 169

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA----LYQGICNV 271
           R ++G+G GG+  +  +  +++ P + R     LYQ +C +
Sbjct: 170 RIISGLGVGGIAVLSPMLISEVAPKQIRGTLVQLYQLMCTM 210

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 14/92 (15%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + +L+D  GRR  +V   LV+ +GA+I   S + W    +G+ + G+G GG + +C +  
Sbjct: 129 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 254 TDIVPLRSR----ALYQ---------GICNVF 272
           ++I P   R    +LYQ         G C+V+
Sbjct: 189 SEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY 220

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 14/92 (15%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + +L+D  GRR  +V   LV+ +GA+I   S + W    +G+ + G+G GG + +C +  
Sbjct: 129 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 254 TDIVPLRSR----ALYQ---------GICNVF 272
           ++I P   R    +LYQ         G C+V+
Sbjct: 189 SEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVY 220

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R+  + + + +  A      GKL D++GRR  L+F   +F +G +I   S + W    +G
Sbjct: 122 RMGLLVSIFNIGCAIGSVFLGKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIG 181

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           R +AGIG G +  +  +  +++ P   R 
Sbjct: 182 RIIAGIGMGVIAVLSPMLISEVAPKELRG 210

>NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + +L DI+GRR  LVF  +V+ +G +I   S + W    +GR ++G+G GG+     +  
Sbjct: 138 FSRLGDIYGRRKALVFVTIVYMVGLVISIASIDKWYQYFIGRIISGMGVGGIAVYSPLLI 197

Query: 254 TDIVPLRSRA 263
           +++ P   R 
Sbjct: 198 SEVSPKHVRG 207

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 10/121 (8%)

Query: 151 FLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVF 210
           F   LD  I    + +   ++ E   +S +    L+ SA  Q  +  LSD+FGR  L V 
Sbjct: 81  FAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNVVSLMISAVGQIFFAGLSDVFGRLSLFVV 140

Query: 211 SNLVFCLGALICGMSKNLWVLVLGRFVAG-----IGGGGLTSMCSITTTDIVPLRSRALY 265
           + + + +G +I   + +     +GR+VAG     IG  G     +I  +D   L+ R  Y
Sbjct: 141 AIIFYVVGTIIQSQAYD-----VGRYVAGSIFYNIGLVGAIFQVTIILSDCSSLKWRLFY 195

Query: 266 Q 266
            
Sbjct: 196 N 196

>KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 175 PRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVL 233
           PR+  I   + +  A     + +L DI+GRR  LV+  +V+ +G +I   S + W    +
Sbjct: 100 PRMGLIVAIFNIGCAIGGLAWSRLGDIYGRRLALVWVTIVYMIGLVISIASIDKWYQYFI 159

Query: 234 GRFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           GR ++G G GG+     +  +++ P   R 
Sbjct: 160 GRIISGCGVGGIAVYSPLLISEVSPKHVRG 189

>Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]
           {ON} YDL138W (RGT2) - glucose permease [contig 160] FULL
          Length = 511

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 58/116 (50%), Gaps = 6/116 (5%)

Query: 149 GVFLAALDGTIVTTL-LDHIASEFNELPRISWIATAYLLSSATFQPLYGKLS-----DIF 202
           G+      GTI   L +DH+ + F +    +   T+ + S  +    +G +S     D  
Sbjct: 33  GILFGYDTGTISGILAMDHVKTTFTDRGHFTAGETSLITSILSAGTFFGSMSAPLVSDNL 92

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           GRR  L+ S ++F +G ++   +    +L++GR +AG+G G L+++  +  ++  P
Sbjct: 93  GRRYGLIVSTVIFTIGVILQVAATTQELLIVGRVIAGVGVGVLSAIVPLYQSEAAP 148

>ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conserved
           hypothetical protein
          Length = 682

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 12/126 (9%)

Query: 146 MCLGVFLAALDGTIVTTLL--DHIASEFNELPR------ISWIATAYLLSSATFQPLYGK 197
           + +GVFL   D  +++  L   +    F++  R      +S +    L+SS     +  +
Sbjct: 115 VSIGVFLFGYDQGVMSGCLTGKYFKRHFHDPSRAAIGIMVSILEIGALVSSL----VTSR 170

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L +  GRR  + + +LVF +G L    +  +  L+ GR ++G+G G L+++  I  ++I 
Sbjct: 171 LGEKLGRRRTIKYGSLVFIIGGLFQAFAGGIGYLIAGRLISGVGVGLLSTIVPIYQSEIS 230

Query: 258 PLRSRA 263
           P  +R 
Sbjct: 231 PPHNRG 236

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R  +  S+ L  +   LDG I  T   +  S +++   +S +     + +A  Q  + +L
Sbjct: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SDIFGR  +LV S + + +G +I   + N+    +G     +G  G+  +  +  +D   
Sbjct: 130 SDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189

Query: 259 LRSRAL 264
           L  R L
Sbjct: 190 LNWRLL 195

>KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 175 PRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVL 233
           PR+  I   + +  A     + +L DI+GRR  LV+  +V+ +G +I   S + W    +
Sbjct: 106 PRMGLIVAIFNIGCAIGGLAWSRLGDIYGRRLALVWVTIVYMIGLVISIASIDKWYQYFI 165

Query: 234 GRFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           GR ++G G GG+     +  +++ P   R 
Sbjct: 166 GRIISGCGVGGIAVYSPLLISEVSPKHVRG 195

>KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12300 Saccharomyces cerevisiae
           YDL138W RGT2 Plasma membrane glucose receptor
          Length = 513

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 68/146 (46%), Gaps = 22/146 (15%)

Query: 127 AKEDAGGLGATRRRVVMASMCL---GVFLAALDGTIVTTL-LDHIASEF--------NEL 174
           A+ED  G   ++ R +   + +   G+      GTI   L +D++   F        NE 
Sbjct: 10  AEEDIQG---SKFRAIFIGLFVAFGGILFGYDTGTISGVLAMDYVKEHFTSRGHFTANET 66

Query: 175 PRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGAL--ICGMSKNLWVLV 232
             I+ I +A     A   PL    SD  GRR  L+ S L+F +G +  I    +NL  L+
Sbjct: 67  SLITAILSAGTFCGAMLAPL---ASDTIGRRLGLIISTLIFAVGVVLQIAATGQNL--LI 121

Query: 233 LGRFVAGIGGGGLTSMCSITTTDIVP 258
           +GR +AG G G L+++  +  ++  P
Sbjct: 122 VGRVIAGAGVGVLSAIVPLYQSEASP 147

>KAFR0E03650 Chr5 (733164..734660) [1497 bp, 498 aa] {ON} Anc_5.469
           YDR387C
          Length = 498

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 1/110 (0%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           ++D  GR   L   + +F   +++  +S  LW+LVLGRF+ G+  G  +    +  +++ 
Sbjct: 101 MADTHGRLKTLHICSWIFIASSIVTSLSFRLWILVLGRFIIGVAIGIGSQCVPLYLSEVS 160

Query: 258 PLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWR-MAFLVQVPLTL 306
           P + R L   I ++               F + A  WR + FL  +P  L
Sbjct: 161 PAKIRGLAITINSMCITMGQLLAYLFVVPFINTANSWRFLVFLAILPAIL 210

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 1/132 (0%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNE-LPRISWIATAYLLSSATFQPLYG 196
           RR + +  +    F+     +I+      +A EFN  L  IS++    +L+ A    +  
Sbjct: 76  RRDIALLVVGWHCFVGGGQTSILAAGSRSLAEEFNRSLSDISYLVGGMMLALAFGSIIAS 135

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
             + +FG+R L +   +VF  G++ C +S +   L+  R V+G+G   + S+ S T  +I
Sbjct: 136 PSAVLFGKRILYLIGIIVFFFGSIGCSVSHSYESLLASRIVSGLGVATIESLPSATVAEI 195

Query: 257 VPLRSRALYQGI 268
                RA   G+
Sbjct: 196 YFAHERAYRLGV 207

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + +L+D  GRR  +V   LV+ +GA+I   S + W    +G+ + G+G GG + +C +  
Sbjct: 126 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 185

Query: 254 TDIVPLRSRALYQGICNVF 272
           ++I P   + L  G+ ++F
Sbjct: 186 SEIAP---KDLRGGLVSLF 201

>Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGR+  L+ SNL+F +GA++   +   W + +GR + G G G  + +  +  ++
Sbjct: 147 GTAADLFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLIAPLFISE 206

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 207 IAPKMIRGR 215

>Smik_4.41 Chr4 complement(79517..81580) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSI 251
           +Y  + + + R+ +L  S +++  GA+I  ++ N W L+LGRFV G+G G   +M  I
Sbjct: 180 VYSGILETYSRKKMLQISTMIYFWGAIIQVLALNQWCLLLGRFVLGVGMGFAFAMAVI 237

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 71/151 (47%), Gaps = 13/151 (8%)

Query: 78  VASELEVQRQQEVCAAVTAESMATXXXXXXXXXTQKPTEVYLTATAVEAAKEDAGGLGAT 137
           V  ++ ++ + +V  +   E + T         + K T+V     + ++  +D     + 
Sbjct: 18  VIDKISMKAEDKVVVSSEDEDVTTVAS------SNKSTQV-----SNDSPWQDPTYFSSF 66

Query: 138 RRRVVMASMC-LGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLY 195
            R ++    C L   L     T   T+++ ++  FN E  + +W+  ++ L + +F  + 
Sbjct: 67  GRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILIS 126

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSK 226
           G+L DI+G + +L+   +   + +LICG+SK
Sbjct: 127 GRLGDIYGLKKMLMIGYVTIIVWSLICGLSK 157

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 95/241 (39%), Gaps = 23/241 (9%)

Query: 331 RSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSL-----YGEDLPHLYLIFVVILLSGSYF 385
            +IP       +DWTG+V  V+ L  F  V +      +G       LI  V  L  ++F
Sbjct: 255 NNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLV-AFF 313

Query: 386 IYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GPT 442
           +Y E+  A  P+LP    +NR ++   L+     +G  + G +   Y +  LN+    P 
Sbjct: 314 VY-EVKYAKVPLLPHAVTKNRHMIMILLA---VFLGWGSFGIWTFYYMSFQLNLRHYSPV 369

Query: 443 DIGKRIVPSFFSTAFGSLGA---GYYMKRTGKYYWFLLAFCLVGV-LGQVQISYVTPSIS 498
             G      F    FG++ A      +KR G    FLL F LV   +G +  S +    S
Sbjct: 370 WTGGTY---FVFVIFGTIAAFMVALSIKRVGPA--FLLCFALVAFDVGSIMFSVLPVKQS 424

Query: 499 TWR-QYCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGA 557
            W+  + +  I  FG                P  +Q    S+     +  ++L + +G  
Sbjct: 425 FWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGAT 484

Query: 558 I 558
           +
Sbjct: 485 V 485

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 162 TLLDHIASEF--NELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219
           ++++ IA+ F  NE  R +W+  ++ L S +F  + G+L DI+G + +L    +V  + +
Sbjct: 92  SIMNIIANSFGSNENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150

Query: 220 LICGMSK 226
           LICG++K
Sbjct: 151 LICGLTK 157

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 74/170 (43%), Gaps = 27/170 (15%)

Query: 331 RSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIY 387
            +IP   +   +DW G+   V+ L     V +   + G D  ++ ++ V+ ++    FI 
Sbjct: 255 NNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFII 314

Query: 388 HELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKR 447
           +E   A  P+LP   L++R ++   L+ +F   G  + G +   Y+   LN+        
Sbjct: 315 YENRFAKSPLLPRAVLKDRHMIQIMLALFF---GWGSFGIFTFYYFQFQLNI-------- 363

Query: 448 IVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSI 497
                    + ++ AG      G Y+ FL+   +  +L  + I  V+PS+
Sbjct: 364 -------RHYSAVWAG------GTYFMFLIWGIIAALLVGIYIKKVSPSV 400

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 93/243 (38%), Gaps = 33/243 (13%)

Query: 405 NRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGY 464
           +R  L   L N F M+ ++ T  Y+PVY   V N     +  R++P + S     L    
Sbjct: 362 SRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQAR 421

Query: 465 YMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXX 524
           Y K   KY   LL   LVG++G  Q+  +  S   W  +    IP  G            
Sbjct: 422 YAK---KYNTSLLG-SLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVIM------ 471

Query: 525 XXXXPQRHQAATTSISYAFRSTGSTLGVSIGGA--------IFRNGLSNQLYSKLMPLQS 576
                     A T     F      +G+ +GG+        +F   L + L   L+ LQS
Sbjct: 472 ----------ANTKNMRDF-----AVGILVGGSATIILCQGLFTRTLHDTLRDNLLKLQS 516

Query: 577 PEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVAC 636
                 ELL+I+EK   + +W   +AP   R  + + +  A    F   L   +   ++ 
Sbjct: 517 EGLKKKELLKILEKTIKNPQWALIDAPAITRGAITNSFALAIHQIFLSLLVISIFIIISS 576

Query: 637 CFI 639
           C +
Sbjct: 577 CLV 579

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 7  GLKTKQRDRLREFAKRKERQRALAGQ 32
          G K KQR +LREFAK KE+QR L  +
Sbjct: 2  GRKDKQRKKLREFAKLKEKQRLLENK 27

>TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.155
           YBR241C
          Length = 481

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 1/100 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G+L+D +GRR +  F++++  +G+++   S +    ++GR V GI  G    +  +   +
Sbjct: 105 GRLADRYGRRKVTFFTSMIGIIGSMMLFGSNSYTGFIVGRIVVGIASGASIVVTPLIINE 164

Query: 256 IVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWR 295
           I P   R     +  VF              FAD +  WR
Sbjct: 165 IAPPEWRGALGSMNQVFINLGILLTQSLALKFAD-SYRWR 203

>Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W
           (REAL)
          Length = 890

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 64/130 (49%), Gaps = 21/130 (16%)

Query: 138 RRRVVMASMCLGVFLA------ALDGTIVTTLLD------HIASEFNELPRISWIATAYL 185
           +R+ +M S+ +GVF+A        D  ++ ++        H+A   +             
Sbjct: 90  QRQSMMMSIYVGVFVAVGGFLFGYDTGLINSITSMNYVKSHLAPNHDSFTAKQMSILVSF 149

Query: 186 LSSATFQPLYGKL-----SDIFGRRPLLVFSNLV-FCLGALICGMSKNLWVLVLGRFVAG 239
           LS  TF   +G L     SD +GR+P ++FS +V F +G  +   +  L +L++GR ++G
Sbjct: 150 LSLGTF---FGALTAPFISDTYGRKPTIIFSTIVIFSIGNSLQVGAGGLTLLIVGRVISG 206

Query: 240 IGGGGLTSMC 249
           IG G ++++ 
Sbjct: 207 IGIGAISAVV 216

>Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON}
           complement(9070..10740) [1671 nt, 557 aa]
          Length = 556

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 192 QPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSI 251
            PL+   SD+FGRR  L   +  + +GA +   S++L +LV+GR V+GIG G  +++  +
Sbjct: 89  SPLF---SDVFGRRVSLHICSTFWLIGATLQCASQDLAMLVVGRLVSGIGIGFGSAVAPV 145

Query: 252 TTTDIVPLRSRALYQGI 268
             +++ P + R    G+
Sbjct: 146 YCSEVAPPKIRGAIAGL 162

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 64/140 (45%), Gaps = 4/140 (2%)

Query: 126 AAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYL 185
           A K D   L A    + + S  +  F   LD +I  T + +  + ++    IS ++   L
Sbjct: 60  AKKYDTWQLKA----IFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVL 115

Query: 186 LSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGL 245
           + SA  Q ++G LSDIFGR  L + S +++ +G +I   + ++     G     +G  G+
Sbjct: 116 MISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLVGV 175

Query: 246 TSMCSITTTDIVPLRSRALY 265
                +  +D   L+ R  Y
Sbjct: 176 MLQVVLMLSDNSSLKWRLFY 195

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G+L D++GRR  L+ + ++F +G +I   S   W   ++GR VAG+G G +  +  +  +
Sbjct: 135 GRLGDMYGRRIGLIVAAVIFIVGNIIQIASIRAWYQYMIGRIVAGVGAGLIAILSPMLIS 194

Query: 255 DIVPLRSRA 263
           ++ P  SR 
Sbjct: 195 EVAPKNSRG 203

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 1/123 (0%)

Query: 146 MCLGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGR 204
           M +  F ++L   I    L  +  +FN +  +++     YLL       + G L+D++GR
Sbjct: 96  MTITGFWSSLGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGR 155

Query: 205 RPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRAL 264
           RP+++   L+F + ++    + +  V+V  R +  IG     ++ S   +D    R R  
Sbjct: 156 RPVILGGMLIFVVASIGIAKAPSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERGT 215

Query: 265 YQG 267
           + G
Sbjct: 216 FVG 218

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R   I + + +  A    ++ KL D +GRR  LV   +V+ +G LI   S + W    +G
Sbjct: 103 RTGLIVSIFCIGCAIGGIVFSKLGDQYGRRIALVIVTIVYMVGILISIASIDKWYQYFIG 162

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA 263
           R +AG+G GG+     +  +++ P   R 
Sbjct: 163 RIIAGLGVGGIAVYSPLLISEVSPKHLRG 191

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G+L DI+GRR  L+ ++++F +G++I   S   W   ++GR VAGIG G +  +  +  +
Sbjct: 137 GRLGDIYGRRIGLIVASVIFIIGSVIQIASVKAWYQYMIGRIVAGIGCGLIAILSPMLIS 196

Query: 255 DIVPLRSRA 263
           ++ P   R 
Sbjct: 197 EVSPKNMRG 205

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%)

Query: 154 ALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNL 213
            LDG I      +  S +++   +S I     + SA  Q +Y +LSD+FGR  L + + +
Sbjct: 93  GLDGNIRYIYTGYATSSYSKHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVI 152

Query: 214 VFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ 266
           ++ +G +I   + ++     G      G  G+  +  I  +D   L+ R LYQ
Sbjct: 153 LYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQ 205

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 74/181 (40%), Gaps = 29/181 (16%)

Query: 119 LTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTL--LDHIASEFNELP- 175
           L    VEA K   G LG     ++   +  G FL   D  I      +D+    F     
Sbjct: 39  LKGDTVEAPKR--GLLGYLTIYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKH 96

Query: 176 ----------RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS 225
                     R+  +   + +  A    ++ + +D  GRR  +V   LV+ +GA+I   S
Sbjct: 97  STGEYYLSNVRMGLLVAMFSVGCAIGGLIFARFADKLGRRLAIVIVVLVYMVGAIIQISS 156

Query: 226 KNLWV-LVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR----ALYQ---------GICNV 271
            + W    +G+ + G+G GG + +C +  ++I P   R    +LYQ         G C+V
Sbjct: 157 SHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNMTFGIFLGYCSV 216

Query: 272 F 272
           +
Sbjct: 217 Y 217

>Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar to
           Saccharomyces cerevisiae YDR387C
          Length = 557

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 43/105 (40%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L+D +GR+P+L+ S  V    ++I  +S +L VLV GR ++G+  G           +I 
Sbjct: 124 LTDRYGRKPILLSSGFVIVFSSVIMALSNSLEVLVCGRLISGVAVGVAAQCTPAYWGEIS 183

Query: 258 PLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQV 302
           P   R        V               F  + V WR  F + V
Sbjct: 184 PASLRGSIMASQTVALAGAQVIAYLISVYFMSKDVAWRYLFGIGV 228

>Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGG 243
           +Y  + + + R+ LL    +++ LGALI   + N W L+LGRF+ G+G G
Sbjct: 180 VYSGVLETYSRKKLLQIGTMIYSLGALIQVSALNQWCLLLGRFILGVGVG 229

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R  +  S+ L  +   LDG I  T   +  S +++   +S +     + +A  Q  + +L
Sbjct: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SDIFGR  +++ S + + +G +I   + N+    +G     +G  G+  +  +  +D   
Sbjct: 130 SDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189

Query: 259 LRSRAL 264
           L  R L
Sbjct: 190 LNWRLL 195

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +D+FGR+  L+ SNL+F +GA++   +   W +  GR + G G G  + +  +  ++
Sbjct: 147 GTAADVFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAAGRLIMGFGVGIGSLIAPLFISE 206

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 207 IAPKMIRGR 215

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 67/164 (40%), Gaps = 13/164 (7%)

Query: 112 QKPTEVYLTATAVEAAKEDAGGLGAT-------------RRRVVMASMCLGVFLAALDGT 158
            K  E   +  A +  ++D   +G T             +R ++ +S+ L  +  +LD T
Sbjct: 15  NKVNETSYSLEAHDVPEDDYYNVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLDST 74

Query: 159 IVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLG 218
           +  T      + F+E   +S++     + SA  +  + + +DIFGR  +     + + +G
Sbjct: 75  LRKTFKTDATNSFSEHSLVSFVNCFSAIVSAIGELFFARSADIFGRTSIFYICLVFYVVG 134

Query: 219 ALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSR 262
            +I   SK +     G  +   G  G+  +  +  +D   L  R
Sbjct: 135 TIIVATSKGISQFAAGYCIYSFGESGIDMVMQLLVSDFSHLNWR 178

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 158 TIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCL 217
           +I+  L D   S+ N     SW+  ++ L S +F  + G++ DIFG + +L+   ++  +
Sbjct: 102 SIMNILADSFGSDANSR---SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIII 158

Query: 218 GALICGMSK 226
            +LICG++K
Sbjct: 159 WSLICGLTK 167

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 74/170 (43%), Gaps = 27/170 (15%)

Query: 331 RSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIY 387
            +IP       +DW G+   V+ L    LV +   + G +  ++ ++ ++ +L    F  
Sbjct: 265 NNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGV 324

Query: 388 HELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKR 447
           +E++ A  P+LP   +++R ++   LS +F   G  + G +   Y+   LN+      + 
Sbjct: 325 YEIHFAKSPLLPQAVMKDRHMIQIMLSLFF---GWGSFGIFTFYYFQFQLNI------RH 375

Query: 448 IVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSI 497
             P         L AG      G Y+ FL+   +  +L    I  V+PS+
Sbjct: 376 YTP---------LWAG------GSYFMFLIWGIIAALLVGFSIKRVSPSV 410

>NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALIC-GMSKNLWVLVLGRFVAGIGGGGLTSMCSIT 252
           L+ +L D++GRR  LVF   V+ +G +I     K+ +   +GR ++G+G GG+     + 
Sbjct: 137 LWSRLGDMWGRRKALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISGLGVGGIAVYSPLL 196

Query: 253 TTDIVPLRSRA 263
            +++ P   R 
Sbjct: 197 ISEVAPKHVRG 207

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R  +  S+ L  +   LDG I  T   +  S +++   +S +     + +A  Q  + +L
Sbjct: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SDIFGR  +++ S + + +G +I   + N+    +G     +G  G+  +  +  +D   
Sbjct: 130 SDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189

Query: 259 LRSRAL 264
           L  R L
Sbjct: 190 LNWRLL 195

>AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL156W
           (HXT11)
          Length = 547

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           +SD FGRR  L   + ++ +GA++   ++N  +L +GR VAG+G G  +S+  + T ++ 
Sbjct: 91  ISDAFGRRVSLHMCSSLWIIGAVLQTAAQNQAMLFVGRIVAGLGVGFGSSVAPVYTAEVS 150

Query: 258 PLRSRALYQGI 268
           P + R    G+
Sbjct: 151 PPKIRGAVGGL 161

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 100/238 (42%), Gaps = 21/238 (8%)

Query: 332 SIPWTTKLRM----VDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSY 384
           SIP T  + +    +DWTG+V  V+ L  F  V +   + G +  ++ ++ +  LL    
Sbjct: 264 SIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVV 323

Query: 385 FIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GP 441
           F  +E+  A  P+LP     N +++   LS  F  MG  + G +   YYA +LN+    P
Sbjct: 324 FFIYEIKFAKSPLLPQAVTHNHNIIMI-LSAMF--MGWGSFGIWTFYYYAFLLNLRGYTP 380

Query: 442 TDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFC--LVGVLGQVQISYVTPSIST 499
            + G             +    + +KR G     +L FC  +   +G + +S +TP   T
Sbjct: 381 LEAGASHCMFILWGTIAAFTVAFTIKRVGPS---VLLFCSMVAFTVGSIMLS-ITPVHQT 436

Query: 500 -WRQ-YCLYMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIG 555
            W+  + + +I  FG                P  +Q    S+     +  ++L + +G
Sbjct: 437 YWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMG 494

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 158 TIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFC 216
           T  T+ ++ I S FN +    +W+  ++ L S +F  + G++ DI+G +  ++   +V  
Sbjct: 100 TQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMI 159

Query: 217 LGALICGMSK 226
           + +LICG + 
Sbjct: 160 IWSLICGFAN 169

>Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON}
           complement(10929..12629) [1701 nt, 567 aa]
          Length = 566

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L+D +GR+  L   ++ F + A+   +S +L +L+LGRF+ GI  G       I  ++I 
Sbjct: 115 LADKYGRKTTLAVCSVGFIISAVWLALSMSLTILILGRFLVGIAVGIAAQCVPIYLSEIS 174

Query: 258 PLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAF 298
           P R R     + ++                +D +  WR  F
Sbjct: 175 PTRIRGTILALNSIAITSGQLIAYIVSYLISDFSQSWRFLF 215

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 14/92 (15%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + + +D  GRR  +V   LV+ +GA+I   S + W    +G+ + G+G GG + +C +  
Sbjct: 198 FARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 257

Query: 254 TDIVPLRSR----ALYQ---------GICNVF 272
           ++I P   R    +LYQ         G C+V+
Sbjct: 258 SEIAPKDLRGGLISLYQLNMTFGIFLGYCSVY 289

>YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON}
           Putative transporter, member of the sugar porter family
          Length = 687

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 31/49 (63%)

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSI 251
            R+ +L  S +++ LGA++  ++ N W L+LGRF+ G+G G   SM  I
Sbjct: 189 SRKKMLQISTMIYSLGAIVQVLALNQWCLLLGRFLLGVGMGFAFSMVII 237

>KNAG0D05370 Chr4 (984855..986225) [1371 bp, 456 aa] {ON} 
          Length = 456

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + +L DI+GRR  LV+   V+ +G +I   S N W    +GR ++G G GG+     +  
Sbjct: 19  WSRLGDIYGRRLALVWVTTVYMIGLIISIASINKWYQYFIGRIISGCGVGGIAVYSPLLI 78

Query: 254 TDIVPLRSRA 263
           +++ P   R 
Sbjct: 79  SEVSPKHVRG 88

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G+L DI+GRR  L+ + ++F +G +I   S + W    +GR +AGIG G +  +  +  +
Sbjct: 137 GRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIGMGVIAVLSPMLIS 196

Query: 255 DIVPLRSRA 263
           ++ P   R 
Sbjct: 197 EVSPKDMRG 205

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 14/92 (15%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + + +D  GRR  +V   LV+ +GA+I   S + W    +G+ + G+G GG + +C +  
Sbjct: 129 FARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 254 TDIVPLRSR----ALYQ---------GICNVF 272
           ++I P   R    +LYQ         G C+V+
Sbjct: 189 SEIAPKDLRGGLISLYQLNMTFGIFLGYCSVY 220

>Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)
          Length = 881

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 65/130 (50%), Gaps = 21/130 (16%)

Query: 137 TRRRVVMASMCLGVFLA------ALDGTIVTTLLD------HIASEFNELPRISWIATAY 184
           ++++ +M S+ +GVF+A        D  ++ ++        H+A   +            
Sbjct: 89  SQKQSMMMSIYVGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPNHDSFTAQQMSILVS 148

Query: 185 LLSSATFQPLYGKL-----SDIFGRRPLLVFSNLV-FCLGALICGMSKNLWVLVLGRFVA 238
            LS  TF   +G L     SD +GR+P ++FS LV F +G  +   +  + +L++GR ++
Sbjct: 149 FLSLGTF---FGALTAPFISDSYGRKPTIIFSTLVIFSIGNSLQVGAGGITLLIVGRVIS 205

Query: 239 GIGGGGLTSM 248
           GIG G ++++
Sbjct: 206 GIGIGAISAV 215

>TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {ON}
           Anc_5.469 YDR387C
          Length = 574

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 148 LGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGK-----LSDIF 202
           LG  L   D  I++ +L  +  +     R++      + S  +    +G      L+D F
Sbjct: 61  LGGLLFGYDTGIISGILSSLKPQDLSRTRLTDFDKELVTSMTSIGSFFGSILGFPLADKF 120

Query: 203 GRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMC 249
           GR+  L   N +F   +L   +S NL +L+LGRF  GI   GL++ C
Sbjct: 121 GRKKTLTICNFLFIFASLWMALSINLPLLILGRFFIGI-AIGLSAQC 166

>Suva_4.49 Chr4 complement(89704..91767) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%)

Query: 194 LYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGG 243
           +Y  + + + R+ +L  S + + LGA I   + N W L+LGRF+ G+G G
Sbjct: 180 VYSGVLEAYSRKKMLQVSTITYSLGAFIQVFALNQWYLLLGRFILGVGMG 229

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 48/91 (52%), Gaps = 1/91 (1%)

Query: 137 TRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLY 195
           T   + + S  +  F++    T   ++++ +A E N E  R +W+  ++ LS  +F  + 
Sbjct: 96  THEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVS 155

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSK 226
           G+L DI+G + +L+    +  + +LICG S 
Sbjct: 156 GRLGDIYGLKKVLLGGYAILTIWSLICGFSS 186

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 158 TIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCL 217
           +I+  L D   SE N     SW+  ++ L S +F  + G+L DI+G + +L+   ++  +
Sbjct: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147

Query: 218 GALICGMSK 226
            +LICG++K
Sbjct: 148 WSLICGITK 156

>TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 69/156 (44%), Gaps = 11/156 (7%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G++ D++GRR  L+ + ++F  G +I   S + W    +GR +AGIG G +  +  +  +
Sbjct: 139 GRVGDVYGRRLGLIMATIIFVAGVVIQIASTDKWYQYFIGRIIAGIGMGVIAVLSPMLIS 198

Query: 255 DIVPLRSR----ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTT 310
           ++ P   R    + YQ +  + F               D ++ WR+   +Q    L    
Sbjct: 199 EVSPKHLRGAMVSCYQLM--ITFGIFLGNCCNYGTKTYDNSIQWRVGLGLQFAWCLFMVG 256

Query: 311 AIQLFLTLPKPVDAHKGA---GQRSIPWTTKLRMVD 343
           A+ LF+         KG     +RSI  + K+ + D
Sbjct: 257 AM-LFVPESPRFLVEKGKIEEAKRSIARSNKVSIDD 291

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G+L DI+GRR  L+ ++++F +G +I   S   W   ++GR +AG+G G +  +  +  +
Sbjct: 139 GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGRIIAGLGCGLIAILSPMLIS 198

Query: 255 DIVPLRSRA 263
           ++ P   R 
Sbjct: 199 EVSPKNMRG 207

>KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 5/78 (6%)

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTTD 255
           KL D++GR+  L    +++ +G +IC  S + W    +GR VAG+G GG+  +  +  ++
Sbjct: 129 KLGDMYGRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVGGIAVLSPMLISE 188

Query: 256 IVPLRSR----ALYQGIC 269
             P   R    + YQ +C
Sbjct: 189 TSPKHLRGTLVSCYQLMC 206

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 95/236 (40%), Gaps = 13/236 (5%)

Query: 331 RSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIY 387
            +IP       +DW G+ T V+ L  F  V +     G +  +L ++ V+ +++   F  
Sbjct: 240 NNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGI 299

Query: 388 HELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM---GPTDI 444
           +EL  A +P+LP   + NR ++    +  F   G  + G +   Y++ VLN+    P   
Sbjct: 300 YELRYAENPLLPSEIIRNRQLIMILTAMTF---GWGSFGIWTFYYFSFVLNLRNYSPLWA 356

Query: 445 GKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYC 504
           G        S    ++  G+ MK+       LL F +VG      I  VTP   T+ +  
Sbjct: 357 GGSYFIFVISGTITAISCGFLMKKIRPA--VLLTFSMVGFNLGCIIFSVTPVHQTYFRNI 414

Query: 505 L--YMIPGFGSXXXXXXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAI 558
           L   +I   G                P +HQ    S+     +  ++L + I G +
Sbjct: 415 LGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTV 470

>KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {ON}
           Anc_4.30 YLL028W
          Length = 589

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 60/133 (45%), Gaps = 3/133 (2%)

Query: 138 RRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIA-TAYLLSSATFQPLYG 196
           R+ +    +CL      L   I  + +  I +EF+ +  ++ +  T Y+L  A    ++ 
Sbjct: 147 RKIIPCFILCLNCICITLGSAIYASGVLQICAEFHIIQVVAILGITLYVLGFAASPVIFA 206

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDI 256
            LS+++GR+ +LV S   F +       +K+L  L++ RF AG  G    ++      DI
Sbjct: 207 PLSEVYGRKGVLVVSAFGFTIFNFAVATAKDLQTLLICRFFAGFIGAAPLAVVPAAFADI 266

Query: 257 VPLRSRALYQGIC 269
                R   + IC
Sbjct: 267 FDTNVRG--KAIC 277

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 64/142 (45%), Gaps = 1/142 (0%)

Query: 127 AKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNE-LPRISWIATAYL 185
           +K D       RR   +  +    F+     +I+      +A EF+  L  IS++    +
Sbjct: 69  SKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVGGMM 128

Query: 186 LSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGL 245
           L+ A    +    + IFG+R + +   ++F  G++ C +S+N   L+  R V+G+G   +
Sbjct: 129 LALALGSIIASPCAVIFGKRIVYLVGIIIFFFGSIGCAVSQNYESLLASRIVSGLGVSTI 188

Query: 246 TSMCSITTTDIVPLRSRALYQG 267
            S+ S T  +I     RA   G
Sbjct: 189 ESLPSATVAEIYFAHERAYRLG 210

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 63/157 (40%), Gaps = 3/157 (1%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L++ FGR+  ++ S + + +GA++C  S +  ++  GRF+ G+G G       I  ++ V
Sbjct: 163 LNEWFGRKASIIISCVWYTVGAILCAASHDHHLMYAGRFMLGVGVGIEGGCVGIYISESV 222

Query: 258 PLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLT 317
           P   R     +                  F D   GWR  F+V   L   +   I LF  
Sbjct: 223 PSSVRGNLVSLYQFNIALGELFGYIIGVIFFDVKGGWR--FMVGSSLVFSTALLIGLFF- 279

Query: 318 LPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFL 354
           LP+        G+    W    R+ D +     V FL
Sbjct: 280 LPESPRWLVHKGRIGEAWNVWKRLRDISVDSNKVEFL 316

>Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W
           (REAL)
          Length = 884

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 64/130 (49%), Gaps = 21/130 (16%)

Query: 138 RRRVVMASMCLGVFLA------ALDGTIVTTLLD------HIASEFNELPRISWIATAYL 185
           +++ +M S+ +GVF+A        D  ++ ++        H+A   +             
Sbjct: 89  QKQSMMMSIYVGVFVAVGGFLFGYDTGLINSITSMKYVKSHVAPNHDSFTAKEMSILVSF 148

Query: 186 LSSATFQPLYGKL-----SDIFGRRPLLVFSNLV-FCLGALICGMSKNLWVLVLGRFVAG 239
           LS  TF   +G L     SD +GR+P ++FS LV F +G  +   +  + +L++GR ++G
Sbjct: 149 LSLGTF---FGALTAPFISDSYGRKPTIIFSTLVIFSIGNSLQVGAGGITLLIVGRVISG 205

Query: 240 IGGGGLTSMC 249
           IG G ++++ 
Sbjct: 206 IGIGAISAVV 215

>Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W
           (REAL)
          Length = 546

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G+L DI+GRR  L++  LV+ +G +I   S + W    +GR V+G+G GG+  +     +
Sbjct: 118 GRLGDIYGRRIGLMWVILVYVVGIVIQIASTDKWYQYFIGRIVSGMGVGGVAVLSPTLIS 177

Query: 255 DIVPLRSRALYQGICNVFF 273
           +I P   R    G C  F+
Sbjct: 178 EISPKHLR----GTCVSFY 192

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 10/131 (7%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R ++  S+ L  +   LDG I  T   +  S +++   +S +     + +A  Q  + + 
Sbjct: 57  RVLLFFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARA 116

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAG-----IGGGGLTSMCSITT 253
           SDIFGR  +L+ + L + +G +I   + N     + RF AG     +G  G   +  +  
Sbjct: 117 SDIFGRLTMLIIAILFYVVGTIIESQATN-----VARFTAGGCFYQVGYTGAMLIVEVIA 171

Query: 254 TDIVPLRSRAL 264
           TD   L  R L
Sbjct: 172 TDFSNLNWRLL 182

>TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {ON}
           Anc_4.30 YLL028W
          Length = 582

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 66/130 (50%), Gaps = 6/130 (4%)

Query: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATA-YLLSSATFQPLYGKLS 199
           VV+   C+ + +A+   +I  + ++ I + ++ +P ++ +  + ++L  A    +Y  LS
Sbjct: 146 VVLGLNCISIAMAS---SIFASGVEQICAIYHVIPVVAILGVSLFVLGFAASPIVYAPLS 202

Query: 200 DIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPL 259
           +++GRR +LV S   F L       +K+L  +++ RF AG+ G    ++      D+   
Sbjct: 203 ELYGRRGVLVISAFGFTLFHFAIATAKDLQTIMICRFFAGLIGAAPMAVVPAAFADMFDT 262

Query: 260 RSRALYQGIC 269
            +R   + IC
Sbjct: 263 NTRG--KSIC 270

>YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putative
           hexose transporter that is nearly identical to Hxt9p,
           has similarity to major facilitator superfamily (MFS)
           transporters and is involved in pleiotropic drug
           resistance
          Length = 567

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R+  I + + +  A    +  K+ DI+GRR  L+    ++ +G LI   S N W    +G
Sbjct: 110 RMGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIG 169

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA----LYQ 266
           R ++G+G GG+  +  +  +++ P   R     LYQ
Sbjct: 170 RIISGLGVGGIAVLSPMLISEVAPKHIRGTLVQLYQ 205

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 149 GVFLAALDGTIVTTLLDHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPL 207
           G+ LA++   IV  L+  I + FN    +  W  T+Y+++ A F   +G++ DI G   +
Sbjct: 33  GLDLASVGAMIV--LVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIM 90

Query: 208 LVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLT 246
           +   +++F + +L+C +  N     + R   G+ G G+ 
Sbjct: 91  MCVFSVIFGIFSLLCAVVPNFIAFTVFRAFQGMAGAGIV 129

>KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 197 KLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTTD 255
           KL D++GR+  L    +++ +G +IC  S + W    +GR VAG+G GG+  +  +  ++
Sbjct: 126 KLGDMYGRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVGGIAVLSPMLISE 185

Query: 256 IVPLRSR----ALYQGICN 270
             P   R    + YQ +C 
Sbjct: 186 TSPKHLRGTLVSCYQLMCT 204

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%)

Query: 155 LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLV 214
           LDG I      +  S + E   +S +     + SA  Q +Y +LSD FGR  L V + ++
Sbjct: 86  LDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAIVL 145

Query: 215 FCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQ 266
           + +G +I   + ++     G      G  G+  +  +  +D   L+ R  YQ
Sbjct: 146 YVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQ 197

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 105/469 (22%), Positives = 183/469 (39%), Gaps = 54/469 (11%)

Query: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198
           R  +  S+ L  +   LDG + ++L  +  S +     ++ I     + +A  Q  + + 
Sbjct: 63  RVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLATINCVKAVIAAAGQICFARA 122

Query: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258
           SDIFGR  +L  + +++ +G +I   + N+     G  +  +G  G+  +  I   D   
Sbjct: 123 SDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQLGYTGIILILEIIAMDFSN 182

Query: 259 LRSRALYQGICNVFFXXXXXXXXXXXXXFADRAVGWR-----MAFLVQVPLTLLSTTAIQ 313
           L  R +   +  + F                  + W+      AF+  VPL+ +   A  
Sbjct: 183 LNWRLMASFVPALPFIINTWISGNALEAL---GMNWKWGIGMWAFI--VPLSCVPLFACI 237

Query: 314 LFLTLPKPVDAHKGAGQ---------RSIPWTTKL------RMVDWTGTVTLVVF---LF 355
           L +       AHK A           + +PW+  L      R+      +  VVF   L 
Sbjct: 238 LHMRFL----AHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGLLLVCVVFGCILV 293

Query: 356 CFTLVCSLYGEDLPHLYLIFVVI--LLSGSYFIYHELYVATDPILPIRFLENRSVLAASL 413
            FTL  SL  +      ++  VI   ++   F+  E   +  P++P   +++R + +A +
Sbjct: 294 PFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLVKDRGIWSALI 353

Query: 414 SNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGK---RIVP--SFFSTAFGSL--GAGYYM 466
                 + +    +    Y  +VL +   +  K   RI    SF S   G L  G   Y 
Sbjct: 354 ----IAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITGFLLGGVIVYA 409

Query: 467 KRTGKYYWFLLA--FCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSXXXXXXXXXXX 524
           +RT K+  F +A  F   G+L    + Y   S S         + GFG+           
Sbjct: 410 RRTKKFILFGIACWFVAFGLL----VHYRGDSSSHSGIVGSLCLLGFGA-GFFTYTTQTS 464

Query: 525 XXXXPQRHQ--AATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571
                + HQ  A  T++  +  + GS LG SI GAI+ N L  +L  ++
Sbjct: 465 IQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRI 513

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/289 (20%), Positives = 122/289 (42%), Gaps = 29/289 (10%)

Query: 162 TLLDHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGAL 220
           +L++ ++  F+    + +W+  ++ L S +F  + GK+ DI+G +  L+   +V  + +L
Sbjct: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135

Query: 221 ICGMSK---NLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFXXXX 277
           ICG++    ++   ++ R   G+G        +    +I+ +        + N++     
Sbjct: 136 ICGLTSYTSSVEFFIISRAFQGLG-------IAFILPNIMGI--------VGNIYVAGTT 180

Query: 278 XXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWT- 336
                     A   +G  M  L    +  LS      F         + G     IP T 
Sbjct: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTI 240

Query: 337 -TKLR--MVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHEL 390
            T +R   +DW G+   ++ +  F  V +   + G D  ++ ++ +V + +   F  +E 
Sbjct: 241 PTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYET 300

Query: 391 YVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM 439
             A DP++P   + N  +L   L+ +F   G  + G +   Y+  VLN+
Sbjct: 301 KYANDPLIPRPAMHNHRLLMTLLAVFF---GWGSFGIWTFYYFCFVLNL 346

>Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {ON}
           YDR497C (REAL)
          Length = 579

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTD 255
           G  +DI+GR+  L+ SN +F +GA++   +   W + +GR + G G G  + +  +  ++
Sbjct: 143 GTAADIYGRKRCLMGSNFMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLISPLFISE 202

Query: 256 IVP--LRSR 262
           I P  +R R
Sbjct: 203 IAPKMIRGR 211

>Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)
          Length = 208

 Score = 39.7 bits (91), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLG 234
           R+  I + + +  A    +  K+ D++GRR  L+    ++ +G LI   S + W    +G
Sbjct: 41  RMGLIVSIFNIGCAIGGIVLSKVGDVYGRRIGLITVTAIYVVGILIQITSIDKWYQYFIG 100

Query: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRA----LYQ 266
           R ++G+G GG+  +  +  +++ P   R     LYQ
Sbjct: 101 RIISGLGVGGIAVLSPMLISEVSPKHIRGTLVQLYQ 136

>TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 69/156 (44%), Gaps = 11/156 (7%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G++ D++GRR  L+ + ++F  G +I   S + W    +GR +AGIG G +  +  +  +
Sbjct: 138 GRVGDVYGRRLGLIMATIIFVAGVVIQIASTDKWYQYFIGRIIAGIGMGVIAVLSPMLIS 197

Query: 255 DIVPLRSR----ALYQGICNVFFXXXXXXXXXXXXXFADRAVGWRMAFLVQVPLTLLSTT 310
           ++ P   R    + YQ +  + F               D ++ WR+   +Q    L    
Sbjct: 198 EVSPKHLRGAMVSCYQLM--ITFGIFLGNCCNYGTKTYDNSIQWRVGLGLQFAWCLFMVG 255

Query: 311 AIQLFLTLPKPVDAHKGA---GQRSIPWTTKLRMVD 343
           A+ LF+         KG     +RSI  + K+ + D
Sbjct: 256 AM-LFVPESPRFLVEKGKIEEAKRSIARSNKVSIDD 290

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 5/79 (6%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G+L DI+GRR  L+   LV+ +G +I   S N W    +GR ++G+G GG+  +     +
Sbjct: 125 GRLGDIYGRRIGLMCVVLVYIVGIVIQIASSNKWYQYFIGRIISGMGVGGIAVLSPTLIS 184

Query: 255 DIVPLRSRALYQGICNVFF 273
           +  P   R    G C  F+
Sbjct: 185 ETAPKHIR----GTCVSFY 199

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254
           G+L D++GRR  L+ +  +F +G +I   S   W   ++GR VAG+G G +  +  +  +
Sbjct: 128 GRLGDMYGRRIGLIIATTIFIVGTIIQVASVKAWYQYMIGRIVAGVGCGVIAMLSPMLIS 187

Query: 255 DIVPLRSRA 263
           ++ P   R 
Sbjct: 188 EVSPKHLRG 196

>KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITT 253
           + KL D +GRR  LV   +V+ +G +I   S + W    +GR +AG+G GG+     +  
Sbjct: 133 FSKLGDQYGRRIALVIVTIVYIVGIVISIASIDKWYQYFIGRIIAGLGVGGIAVYSPLFI 192

Query: 254 TDIVPLRSRA 263
           ++I P   R 
Sbjct: 193 SEISPKHLRG 202

>CAGL0M01672g Chr13 (186088..187731) [1644 bp, 547 aa] {ON} similar
           to uniprot|Q04162 Saccharomyces cerevisiae YDR387c
          Length = 547

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           L+D +GRR  L    ++F + AL   ++ NL +LV GRFV GI  G       +   +I 
Sbjct: 114 LADKYGRRITLAIFCVLFIVAALWMALASNLVLLVFGRFVVGIAVGTAAQCTPVYLCEIS 173

Query: 258 PLRSR 262
           P + R
Sbjct: 174 PAKIR 178

>TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {ON}
           Anc_1.432
          Length = 559

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%)

Query: 198 LSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIV 257
           +S+ FGRR  L      + +GA+I   S N+ +LV GR ++GIG G  +S   +  ++I 
Sbjct: 93  ISEAFGRRVSLHLCATFWIIGAVIQCASHNVAMLVCGRLISGIGVGFGSSAAPVYCSEIA 152

Query: 258 PLRSRAL 264
           P + R L
Sbjct: 153 PPKIRGL 159

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 83/401 (20%), Positives = 150/401 (37%), Gaps = 41/401 (10%)

Query: 176 RISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMS--KNLWVLVL 233
           ++SW A+A+ L+  TF  + G+L D FG +   V   L + L +++ G S   N      
Sbjct: 68  QLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDC 127

Query: 234 GRFVAGIGGG-GLTSMCSITTTDIVPLRSRALYQGICNVFFXXXXXXXXXXXXXFADRAV 292
            R   GIG    L +  +I      P R + +   +                   ++ A 
Sbjct: 128 CRAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFA- 186

Query: 293 GWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVV 352
            W  A+ +      L   A  L +    P+   +          + +  +D  G+VT VV
Sbjct: 187 WWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKC--------SLVERIDVAGSVTGVV 238

Query: 353 FLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYV---ATDPILPIRFLENR 406
            L  F    +   + G +  + Y + +V    GS F+    ++   A  P+LP+R L + 
Sbjct: 239 GLILFNFAWNQGPVVGWETSYTYALLIV----GSAFLAAFGFIESRAKHPLLPVRKLSSD 294

Query: 407 SVLAASLSNWFCMMGMMTTG---FYIPVYY-----ASVLNMGPTDIGKRIVPSFFSTAFG 458
           ++          +MG +  G   F I VYY     A++ +  P     + VP   S    
Sbjct: 295 TIF---------VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCA 345

Query: 459 SLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQ-YCLYMIPGFGSXXXX 517
           ++   + + RT      ++A     V G + ++ V  S + W Q +   ++  +G     
Sbjct: 346 AMSTEFLLTRTSPSTVMIIAMIAFTV-GSILVATVPVSQTYWAQTFVSIIVMPWGMDMSF 404

Query: 518 XXXXXXXXXXXPQRHQAATTSISYAFRSTGSTLGVSIGGAI 558
                      P  HQ    S+     +   ++G+   G I
Sbjct: 405 PAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTI 445

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,133,847
Number of extensions: 2298807
Number of successful extensions: 8177
Number of sequences better than 10.0: 743
Number of HSP's gapped: 7947
Number of HSP's successfully gapped: 818
Length of query: 686
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 570
Effective length of database: 40,180,143
Effective search space: 22902681510
Effective search space used: 22902681510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)