Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGL196C8.324ON93593548330.0
Ecym_42558.324ON93793634950.0
SAKL0H15532g8.324ON94194034810.0
Suva_10.2228.324ON94393934460.0
Smik_12.1928.324ON94394134230.0
NCAS0C032608.324ON98395834180.0
Skud_12.1988.324ON94394134150.0
NDAI0G025808.324ON95895933960.0
TDEL0F045008.324ON93893733860.0
YLR129W (DIP2)8.324ON94394133770.0
Kpol_1036.698.324ON93694033440.0
Kwal_56.239208.324ON93793733410.0
KLTH0G12276g8.324ON93793633390.0
ZYRO0F10406g8.324ON93893833190.0
TPHA0C008108.324ON93793833180.0
CAGL0M04279g8.324ON94094032830.0
TBLA0A039508.324ON93693532470.0
KAFR0H022608.324ON93894032180.0
KNAG0G024508.324ON94294232020.0
KLLA0D16390g8.324ON93693930090.0
Suva_10.3168.435ON8186833471e-32
YLR222C (UTP13)8.435ON8176713452e-32
Skud_12.2858.435ON8176733425e-32
KNAG0A025108.435ON8496803391e-31
TDEL0B020108.435ON8056403363e-31
NCAS0C027108.435ON8156243344e-31
CAGL0C00737g8.435ON8166433327e-31
ZYRO0A09636g8.435ON8086633319e-31
Ecym_41348.435ON8105933282e-30
TPHA0L010808.435ON8356783193e-29
NDAI0E034408.435ON8576883184e-29
KAFR0H017508.435ON7836633141e-28
SAKL0H12760g8.435ON8416663112e-28
AGR180W8.435ON8066473103e-28
Smik_12.2798.435ON8176762988e-27
TBLA0I025708.435ON8486772827e-25
KLTH0E10120g8.435ON8266182532e-21
Kpol_1031.498.435ON7605632523e-21
KLLA0F13244g8.435ON8142692471e-20
SAKL0F15972g7.534ON4702712431e-20
Kwal_27.115858.435ON8232672425e-20
TBLA0F042406.363ON7273072407e-20
Kpol_1013.377.534ON4682742368e-20
ZYRO0D01122g7.534ON4663152323e-19
Ecym_25236.363ON6462802353e-19
CAGL0C03608g6.363ON6433442343e-19
TDEL0H003707.534ON4653262323e-19
KNAG0D002506.363ON6553742343e-19
KAFR0A005102.431ON3192302254e-19
AEL246C8.544ON8152642344e-19
TPHA0M020006.363ON6993512326e-19
AGL234W6.363ON6292802317e-19
Skud_3.1566.363ON7133182319e-19
NCAS0A151707.534ON4742802289e-19
KLLA0F10263g6.363ON6822512301e-18
YCR084C (TUP1)6.363ON7132822301e-18
KNAG0A037008.544ON8172952301e-18
NCAS0D047806.363ON6212262282e-18
Suva_3.1216.363ON7002582282e-18
Smik_3.1836.363ON7092822254e-18
TBLA0H036208.544ON8122172264e-18
TPHA0L016908.544ON8322192255e-18
SAKL0A00660g6.363ON6602892245e-18
TDEL0A077806.363ON6572582237e-18
NCAS0A055206.363ON6714162229e-18
ZYRO0A12980g8.544ON8242552231e-17
NDAI0C054908.544ON8592292231e-17
AEL269C7.534ON4552692181e-17
NDAI0K023506.363ON7933472211e-17
Kpol_1028.236.363ON7442832211e-17
Ecym_70388.544ON8002162202e-17
KAFR0B003707.534ON4612922172e-17
NDAI0H027102.431ON3182332103e-17
SAKL0H09988g8.544ON7492162183e-17
CAGL0E00561g6.363ON8362552183e-17
NCAS0F018502.431ON3182372086e-17
KLTH0D04466g2.431ON3192362087e-17
KAFR0C047406.363ON6652842149e-17
CAGL0M05335g8.544ON8062502141e-16
Smik_2.3388.544ON8002162141e-16
Kwal_23.64296.363ON7502842131e-16
YBR198C (TAF5)8.544ON7982162131e-16
TPHA0I018808.544ON10342092132e-16
Kwal_27.120538.544ON7552162122e-16
Skud_2.3248.544ON8022162122e-16
KAFR0E031808.544ON8142162122e-16
KLTH0A07282g6.363ON7252852112e-16
NCAS0A042702.431ON3182372032e-16
KLTH0E12606g8.544ON7552162113e-16
Suva_13.2952.431ON3192302033e-16
Skud_13.2752.431ON3192302033e-16
Smik_13.3052.431ON3192302033e-16
YMR116C (ASC1)2.431ON3192302033e-16
Kpol_1024.428.544ON8432162103e-16
Kwal_23.53517.534ON4742762064e-16
Suva_4.4528.544ON8002162085e-16
ZYRO0D08206g6.340ON5152902056e-16
TPHA0G023802.431ON3182291997e-16
TDEL0B030208.544ON8312622078e-16
TPHA0M018306.340ON5154212041e-15
KLLA0E23453g8.544ON8261732061e-15
KNAG0E023102.431ON3192301981e-15
TBLA0B091002.431ON3172301981e-15
Kpol_1048.598.544ON8502172051e-15
ZYRO0D17292g6.363ON7182692041e-15
KLTH0A00880g7.534ON4712742012e-15
AFR199C2.431ON3342311972e-15
SAKL0E03960g2.431ON3202321952e-15
Ecym_24986.340ON5424242003e-15
NCAS0B022008.544ON8222312005e-15
SAKL0A03872g6.239ON8783001996e-15
Kpol_297.72.431ON3182331926e-15
Skud_3.1456.340ON5153431951e-14
NCAS0D046106.340ON5152831951e-14
AER263C6.340ON5134231941e-14
TPHA0G016108.672ON4141511921e-14
Ecym_60982.431ON3182281892e-14
Suva_3.1096.340ON5153431942e-14
KLLA0C08547g6.340ON5152861923e-14
Smik_3.1726.340ON5153431896e-14
Ecym_28087.534ON4652981886e-14
AFL118W6.239ON8323001907e-14
TBLA0F041306.340ON5142951897e-14
TBLA0F005206.363ON6632601897e-14
SAKL0F08404g7.231ON6431821898e-14
YCR072C (RSA4)6.340ON5153431888e-14
TDEL0A020702.431ON3192301831e-13
TPHA0I032407.534ON4772181871e-13
ADL082C7.231ON5691911881e-13
ZYRO0F07282g8.672ON4271581851e-13
Kwal_23.63246.340ON5142881861e-13
KAFR0F043506.340ON5152841852e-13
TDEL0A075506.340ON5152861852e-13
KLTH0A06754g6.340ON5142861852e-13
ZYRO0G20152g2.431ON3192301802e-13
Suva_9.1547.231ON6381821852e-13
NDAI0I003506.340ON5152831842e-13
Smik_9.1447.231ON6301821853e-13
YIL046W (MET30)7.231ON6401821843e-13
CAGL0J03476g6.340ON5172871833e-13
Ecym_24018.672ON4261541823e-13
Skud_9.1237.231ON6391821834e-13
TDEL0H021307.231ON5841911825e-13
KLTH0H03608g6.239ON8752731826e-13
KAFR0I018807.231ON5911821817e-13
CAGL0L00781g7.231ON6732011817e-13
Suva_16.5107.534ON4653041807e-13
ZYRO0D16742g7.231ON6082651818e-13
Kpol_1070.117.231ON6661841809e-13
Ecym_43437.231ON5832821791e-12
KNAG0D016907.231ON6542681791e-12
NDAI0G038303.25ON5102971781e-12
Ecym_55015.631ON3272331741e-12
NDAI0J003307.534ON4722741771e-12
SAKL0A01276g6.340ON5152831772e-12
KNAG0I028406.340ON5192841772e-12
NCAS0B078401.247ON5892061772e-12
Kpol_1028.416.340ON5124271763e-12
TPHA0C011507.231ON6871921773e-12
TDEL0A004403.25ON4512951753e-12
KLTH0A04114g7.231ON6582701763e-12
Kpol_1014.193.25ON4522951735e-12
KNAG0J016808.672ON3981511725e-12
KLTH0D11132g8.672ON4371581725e-12
NDAI0B051901.247ON6682171745e-12
ZYRO0E04620g1.399ON3032171695e-12
TPHA0P014903.25ON4592921726e-12
NCAS0I011703.344ON5462251736e-12
KLLA0E07085g3.25ON4523031726e-12
KLLA0F27511g7.231ON6232801728e-12
ZYRO0E07392g6.239ON8972731738e-12
TPHA0J025406.239ON8662721738e-12
ZYRO0C03124g3.25ON4452951709e-12
TPHA0B011201.247ON7192001721e-11
TDEL0E054806.239ON8812731721e-11
Kpol_1031.361.247ON7061751711e-11
NCAS0A134307.231ON6082811701e-11
Kpol_487.71.399ON3032541651e-11
Suva_14.223.25ON4692951682e-11
TDEL0A061808.672ON4341531672e-11
TBLA0D041307.231ON5741681682e-11
KAFR0A069906.239ON8852731692e-11
Suva_14.3421.399ON3032541642e-11
Skud_14.223.25ON4672951673e-11
KLTH0F16764g5.631ON3312381643e-11
Skud_14.3211.399ON3032541633e-11
Suva_7.1276.239ON8912731683e-11
NDAI0A026107.231ON7671821683e-11
Smik_7.1356.239ON8872731683e-11
TBLA0A060606.239ON8882731683e-11
TDEL0F002701.534ON7051411673e-11
KNAG0C062405.631ON3552491644e-11
KNAG0F018406.239ON9112761684e-11
Kwal_23.57697.231ON6271821664e-11
Smik_14.3221.399ON3032541624e-11
YNL006W (LST8)1.399ON3032541624e-11
CAGL0M08646g5.631ON3372321625e-11
CAGL0G09845g7.534ON5002151655e-11
NCAS0A139407.322ON12051581675e-11
Smik_2.1124.106ON8412271666e-11
Kwal_55.215595.631ON3512421626e-11
YGL137W (SEC27)6.239ON8892731666e-11
YKR036C (CAF4)1.247ON6432281656e-11
TBLA0C018408.672ON4231891636e-11
Skud_11.2711.247ON6462291657e-11
KNAG0F038707.534ON4652661637e-11
ACR137W8.672ON4251511628e-11
TBLA0F022307.322ON12161761658e-11
SAKL0C13266g3.25ON4593371638e-11
Suva_11.2681.247ON6452301648e-11
KLTH0A06380g6.325ON9155691658e-11
CAGL0H03729g1.399ON3033161599e-11
YNL317W (PFS2)3.25ON4652951629e-11
Kwal_0.2121.399ON3032011591e-10
KAFR0H024508.672ON4171511611e-10
KNAG0H016901.399ON3033021581e-10
Ecym_80727.322ON12011581641e-10
Ecym_36191.534ON7112261631e-10
Skud_7.1356.239ON8972731631e-10
KLLA0E12277g2.431ON3262421582e-10
NDAI0I008806.239ON8882861622e-10
Skud_2.1034.106ON8402261622e-10
YBL008W (HIR1)4.106ON8402271622e-10
KAFR0H031401.399ON3032911572e-10
Suva_2.1174.106ON8402261622e-10
NCAS0D044806.325ON9155261612e-10
YPL151C (PRP46)8.672ON4511511592e-10
CAGL0H08932g6.239ON9022761612e-10
Kwal_26.87768.672ON4331581592e-10
ADL184W3.25ON4493751592e-10
Suva_4.997.322ON12011771612e-10
TDEL0B059701.399ON3032571562e-10
NDAI0A020907.322ON12001581613e-10
Skud_4.1097.322ON12011581603e-10
KLTH0B00924g1.534ON7141371603e-10
Ecym_20936.325ON9232741603e-10
SAKL0A10406g1.534ON7111941593e-10
AAR057W6.325ON9222111603e-10
KAFR0H005505.631ON3542571563e-10
Smik_4.907.322ON12011581603e-10
TDEL0C048603.344ON5132081583e-10
YDL145C (COP1)7.322ON12011811603e-10
KNAG0B016101.247ON6741671594e-10
KLLA0F21406g1.247ON7051201584e-10
NCAS0A034704.106ON8162251584e-10
Smik_14.143.25ON4661651574e-10
Kpol_1072.178.672ON4331511564e-10
KLLA0F11231g8.672ON4341511565e-10
NCAS0C039908.67ON7302741575e-10
Kpol_1055.644.275ON9382421585e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL196C
         (935 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1866   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1350   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1345   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1332   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1323   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1321   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1320   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1312   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1308   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1305   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1292   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1291   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1290   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1283   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1282   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1269   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1255   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1244   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1238   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1163   0.0  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   138   1e-32
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   137   2e-32
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   136   5e-32
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   135   1e-31
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   134   3e-31
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   133   4e-31
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   132   7e-31
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   132   9e-31
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   130   2e-30
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....   127   3e-29
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   127   4e-29
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   125   1e-28
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   124   2e-28
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   124   3e-28
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   119   8e-27
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   113   7e-25
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   102   2e-21
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   101   3e-21
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   100   1e-20
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    98   1e-20
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    98   5e-20
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    97   7e-20
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    96   8e-20
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    94   3e-19
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    95   3e-19
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    95   3e-19
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    94   3e-19
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    95   3e-19
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    91   4e-19
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    95   4e-19
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    94   6e-19
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    94   7e-19
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    94   9e-19
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    92   9e-19
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    93   1e-18
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    93   1e-18
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    93   1e-18
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     92   2e-18
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    92   2e-18
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    91   4e-18
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    92   4e-18
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    91   5e-18
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    91   5e-18
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    91   7e-18
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    90   9e-18
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    91   1e-17
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             91   1e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    89   1e-17
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    90   1e-17
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    90   1e-17
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    89   2e-17
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    88   2e-17
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    86   3e-17
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    89   3e-17
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    89   3e-17
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    85   6e-17
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    85   7e-17
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    87   9e-17
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    87   1e-16
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    87   1e-16
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    87   1e-16
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    87   1e-16
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    87   2e-16
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    86   2e-16
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    86   2e-16
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    86   2e-16
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    86   2e-16
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    83   2e-16
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    86   3e-16
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    83   3e-16
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    83   3e-16
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    83   3e-16
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    83   3e-16
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    86   3e-16
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    84   4e-16
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    85   5e-16
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    84   6e-16
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    81   7e-16
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    84   8e-16
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    83   1e-15
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    84   1e-15
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    81   1e-15
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    81   1e-15
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    84   1e-15
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    83   1e-15
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    82   2e-15
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    80   2e-15
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    80   2e-15
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    82   3e-15
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    82   5e-15
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    81   6e-15
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    79   6e-15
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    80   1e-14
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     80   1e-14
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    79   1e-14
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    79   1e-14
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    77   2e-14
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    79   2e-14
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    79   3e-14
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    77   6e-14
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    77   6e-14
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    78   7e-14
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    77   7e-14
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    77   7e-14
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    77   8e-14
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    77   8e-14
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    75   1e-13
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    77   1e-13
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    77   1e-13
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    76   1e-13
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    76   1e-13
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    76   2e-13
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    76   2e-13
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    76   2e-13
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    74   2e-13
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    76   2e-13
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       75   2e-13
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    76   3e-13
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    75   3e-13
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    75   3e-13
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    75   3e-13
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    75   4e-13
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    75   5e-13
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    75   6e-13
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    74   7e-13
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    74   7e-13
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    74   7e-13
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    74   8e-13
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    74   9e-13
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    74   1e-12
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    74   1e-12
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      73   1e-12
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    72   1e-12
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      73   1e-12
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    73   2e-12
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    73   2e-12
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    73   2e-12
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    72   3e-12
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    73   3e-12
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    72   3e-12
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    72   3e-12
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    71   5e-12
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    71   5e-12
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    71   5e-12
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    72   5e-12
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    70   5e-12
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    71   6e-12
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    71   6e-12
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    71   6e-12
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    71   8e-12
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    71   8e-12
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    71   8e-12
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    70   9e-12
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    71   1e-11
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    71   1e-11
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    70   1e-11
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    70   1e-11
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    68   1e-11
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    69   2e-11
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    69   2e-11
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    69   2e-11
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    70   2e-11
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    68   2e-11
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    69   3e-11
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    68   3e-11
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    67   3e-11
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    69   3e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     69   3e-11
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    69   3e-11
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    69   3e-11
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    69   3e-11
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    68   4e-11
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    69   4e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    69   4e-11
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    67   4e-11
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    67   4e-11
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    67   5e-11
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    68   5e-11
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    69   5e-11
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    69   6e-11
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    67   6e-11
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    69   6e-11
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    68   6e-11
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    67   6e-11
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    68   7e-11
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    67   7e-11
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    67   8e-11
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    68   8e-11
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    67   8e-11
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    68   8e-11
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    68   8e-11
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    66   9e-11
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    67   9e-11
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    66   1e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    67   1e-10
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    65   1e-10
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    68   1e-10
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    67   1e-10
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    67   1e-10
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    65   2e-10
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    67   2e-10
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    67   2e-10
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    67   2e-10
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    65   2e-10
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    67   2e-10
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    67   2e-10
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    66   2e-10
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    67   2e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    66   2e-10
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    66   2e-10
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    67   2e-10
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    65   2e-10
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    67   3e-10
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    66   3e-10
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    66   3e-10
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    66   3e-10
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    66   3e-10
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    66   3e-10
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    65   3e-10
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    66   3e-10
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    65   3e-10
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    66   3e-10
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    66   4e-10
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    65   4e-10
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     65   4e-10
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    65   4e-10
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    65   4e-10
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    65   5e-10
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    65   5e-10
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    65   5e-10
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    65   5e-10
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    65   6e-10
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    65   6e-10
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    65   7e-10
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    65   7e-10
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               64   7e-10
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    63   7e-10
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    64   7e-10
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    65   7e-10
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    65   7e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    64   8e-10
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      64   9e-10
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    64   9e-10
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    63   9e-10
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    64   1e-09
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    65   1e-09
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    65   1e-09
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    64   1e-09
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    64   1e-09
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    64   1e-09
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    64   1e-09
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    60   1e-09
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    64   1e-09
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    64   1e-09
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    64   1e-09
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    62   1e-09
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    64   2e-09
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    64   2e-09
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    64   2e-09
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    64   2e-09
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    64   2e-09
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    63   2e-09
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    62   2e-09
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    62   3e-09
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    62   3e-09
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    63   3e-09
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    63   3e-09
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    63   3e-09
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    63   3e-09
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    63   3e-09
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    63   3e-09
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    62   3e-09
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    62   3e-09
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     63   3e-09
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    63   3e-09
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    62   3e-09
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    63   3e-09
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    61   4e-09
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    61   4e-09
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    62   4e-09
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    62   4e-09
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    62   4e-09
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    62   4e-09
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    61   4e-09
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    62   4e-09
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    61   4e-09
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    62   5e-09
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    62   5e-09
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    62   5e-09
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    62   5e-09
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      60   5e-09
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    62   6e-09
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    62   6e-09
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    61   6e-09
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    62   7e-09
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    60   7e-09
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    61   7e-09
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    60   7e-09
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    60   7e-09
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    61   7e-09
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    61   8e-09
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    62   8e-09
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    61   8e-09
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    59   9e-09
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    60   9e-09
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    61   9e-09
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    61   9e-09
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    60   9e-09
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    61   9e-09
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    60   9e-09
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    61   9e-09
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    61   9e-09
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    61   1e-08
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    61   1e-08
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    61   1e-08
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    60   1e-08
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    61   1e-08
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    61   1e-08
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    61   1e-08
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    61   1e-08
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    60   1e-08
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    61   1e-08
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    59   1e-08
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    59   1e-08
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     60   1e-08
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    61   1e-08
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    60   1e-08
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    60   2e-08
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    59   2e-08
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    60   2e-08
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    60   2e-08
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    60   2e-08
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    60   2e-08
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    59   2e-08
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    60   3e-08
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    60   3e-08
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    60   3e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      59   3e-08
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    59   3e-08
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    58   3e-08
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    60   3e-08
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    59   3e-08
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    59   4e-08
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    57   4e-08
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    59   4e-08
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    58   4e-08
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    59   4e-08
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    58   4e-08
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    59   4e-08
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    59   4e-08
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    59   4e-08
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    59   4e-08
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    59   5e-08
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    59   5e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    59   5e-08
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    59   5e-08
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    59   5e-08
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    59   6e-08
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     58   6e-08
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    58   6e-08
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    59   6e-08
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    59   6e-08
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    58   7e-08
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    58   7e-08
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    58   7e-08
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    57   7e-08
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    58   8e-08
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    57   8e-08
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    58   8e-08
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       58   8e-08
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    57   8e-08
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    58   1e-07
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    57   1e-07
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    57   1e-07
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    57   1e-07
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    57   1e-07
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    57   1e-07
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    58   1e-07
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    57   1e-07
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      57   1e-07
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    57   1e-07
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    57   1e-07
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    57   2e-07
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    57   2e-07
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    56   2e-07
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    57   2e-07
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    57   2e-07
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       57   2e-07
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    57   2e-07
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    56   2e-07
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    57   2e-07
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    57   2e-07
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    55   2e-07
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    57   2e-07
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    57   2e-07
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    57   3e-07
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    55   3e-07
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    56   3e-07
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    56   3e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    56   3e-07
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    56   4e-07
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    56   4e-07
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    56   4e-07
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    56   4e-07
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    55   5e-07
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    56   5e-07
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    56   5e-07
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    56   5e-07
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    55   5e-07
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    55   5e-07
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    56   5e-07
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    55   5e-07
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    55   5e-07
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    55   5e-07
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    55   6e-07
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    55   6e-07
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    55   6e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    55   6e-07
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    54   7e-07
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    55   7e-07
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    55   7e-07
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    55   7e-07
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    55   7e-07
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    54   8e-07
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    55   8e-07
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    55   8e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    55   8e-07
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    54   8e-07
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    54   8e-07
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    55   8e-07
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    54   8e-07
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    54   9e-07
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    54   9e-07
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    54   9e-07
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    55   9e-07
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    54   9e-07
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    54   9e-07
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    54   1e-06
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    54   1e-06
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    54   1e-06
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    55   1e-06
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    54   1e-06
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    53   1e-06
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    54   1e-06
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    54   1e-06
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    54   1e-06
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    54   2e-06
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    54   2e-06
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    54   2e-06
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    53   2e-06
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    53   2e-06
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    53   2e-06
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    53   2e-06
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    53   2e-06
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    54   2e-06
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    54   2e-06
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    53   2e-06
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    54   2e-06
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    53   2e-06
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    53   2e-06
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    53   2e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    54   2e-06
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    53   2e-06
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    54   3e-06
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    52   3e-06
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    52   3e-06
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    52   3e-06
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    53   3e-06
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    53   3e-06
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    53   3e-06
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    52   3e-06
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    52   4e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    53   4e-06
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    53   4e-06
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    53   4e-06
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     52   4e-06
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    52   4e-06
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    52   4e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    52   4e-06
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    52   5e-06
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    52   5e-06
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    52   5e-06
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    52   5e-06
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    52   5e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    52   5e-06
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    52   5e-06
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    51   6e-06
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    52   6e-06
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    52   6e-06
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    52   6e-06
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    52   7e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    52   7e-06
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    51   7e-06
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    52   8e-06
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    52   8e-06
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    51   9e-06
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    51   9e-06
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    52   1e-05
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    51   1e-05
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    51   1e-05
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    51   1e-05
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    50   1e-05
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    51   1e-05
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    50   1e-05
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    50   1e-05
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    50   1e-05
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    50   1e-05
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    51   1e-05
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    50   1e-05
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    51   1e-05
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    50   2e-05
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    51   2e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    51   2e-05
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    50   2e-05
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    50   2e-05
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    50   2e-05
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    50   2e-05
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    50   2e-05
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    51   2e-05
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    50   2e-05
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    50   2e-05
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    49   2e-05
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    50   2e-05
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    50   2e-05
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    50   2e-05
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    50   2e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    50   2e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    50   2e-05
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    50   3e-05
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    50   3e-05
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    49   3e-05
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    50   3e-05
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    49   3e-05
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    49   3e-05
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    49   3e-05
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    50   3e-05
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    49   3e-05
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    49   3e-05
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    50   3e-05
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    50   3e-05
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    49   4e-05
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    49   4e-05
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    49   4e-05
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    49   4e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    49   4e-05
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    49   4e-05
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    49   4e-05
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    49   4e-05
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    49   4e-05
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    49   4e-05
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    49   4e-05
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    49   4e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    49   4e-05
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    49   5e-05
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    49   5e-05
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    49   5e-05
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    48   5e-05
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    49   5e-05
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    49   5e-05
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    49   6e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    49   6e-05
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    48   6e-05
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    49   6e-05
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    48   6e-05
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    49   7e-05
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    49   7e-05
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    49   7e-05
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    48   7e-05
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    48   7e-05
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    49   7e-05
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    48   7e-05
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    49   7e-05
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    48   7e-05
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    48   7e-05
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    48   8e-05
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    48   8e-05
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    48   8e-05
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    48   8e-05
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    48   8e-05
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    48   9e-05
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    49   9e-05
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    48   9e-05
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    48   9e-05
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    48   9e-05
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    49   9e-05
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    48   9e-05
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    48   9e-05
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    48   1e-04
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    48   1e-04
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    48   1e-04
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    48   1e-04
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    48   1e-04
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    47   1e-04
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    47   1e-04
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    47   1e-04
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    47   1e-04
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    48   1e-04
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    47   1e-04
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    47   1e-04
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    48   1e-04
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    48   1e-04
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    48   1e-04
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    47   1e-04
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    47   1e-04
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    48   1e-04
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    47   2e-04
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    47   2e-04
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    47   2e-04
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    47   2e-04
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    47   2e-04
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    47   2e-04
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    47   2e-04
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    47   2e-04
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    47   2e-04
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    47   2e-04
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    47   2e-04
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    47   2e-04
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    47   2e-04
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    47   2e-04
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               47   2e-04
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    47   2e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    47   2e-04
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    47   2e-04
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    47   2e-04
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    47   2e-04
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    47   2e-04
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    47   2e-04
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    47   2e-04
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    46   2e-04
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    46   2e-04
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    47   3e-04
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    46   3e-04
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    46   3e-04
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    46   3e-04
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    46   3e-04
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    47   3e-04
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    46   3e-04
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    46   3e-04
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    47   3e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    47   3e-04
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    46   3e-04
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    46   3e-04
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    46   3e-04
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    46   3e-04
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    46   3e-04
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    46   4e-04
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    46   4e-04
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    46   4e-04
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    46   4e-04
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    46   4e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    46   4e-04
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    46   4e-04
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     46   4e-04
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    45   4e-04
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    46   4e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    46   4e-04
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    46   4e-04
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    46   4e-04
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    46   4e-04
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    46   4e-04
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    46   4e-04
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    45   5e-04
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    46   5e-04
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    46   5e-04
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    45   5e-04
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    45   5e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    45   5e-04
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    45   6e-04
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    45   6e-04
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    45   6e-04
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    45   6e-04
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    45   6e-04
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    45   6e-04
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    45   6e-04
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    45   6e-04
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    45   7e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    45   7e-04
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    45   7e-04
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    45   7e-04
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    45   7e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    45   7e-04
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    45   7e-04
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    45   7e-04
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    45   7e-04
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    45   8e-04
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    45   8e-04
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    45   8e-04
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    45   8e-04
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    45   8e-04
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    45   8e-04
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    45   8e-04
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    45   8e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    45   8e-04
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    45   9e-04
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    45   0.001
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    45   0.001
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    45   0.001
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    45   0.001
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    44   0.001
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    45   0.001
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    44   0.001
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    45   0.001
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    45   0.001
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    44   0.001
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    45   0.001
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    44   0.001
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    44   0.001
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    44   0.001
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    44   0.001
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    44   0.001
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    42   0.001
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    45   0.001
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    44   0.001
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    44   0.001
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    44   0.001
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    44   0.001
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    44   0.001
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    44   0.001
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    44   0.002
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    44   0.002
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    44   0.002
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    44   0.002
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    44   0.002
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    44   0.002
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    44   0.002
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    44   0.002
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    44   0.002
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    44   0.002
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    44   0.002
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    44   0.002
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    44   0.002
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    44   0.002
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    44   0.002
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    44   0.002
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    44   0.002
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    44   0.002
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    44   0.002
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    44   0.002
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    44   0.002
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    43   0.002
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    43   0.003
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    44   0.003
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    43   0.003
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    43   0.003
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    43   0.003
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    43   0.003
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    43   0.003
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    44   0.003
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    43   0.003
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    43   0.003
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    43   0.003
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    43   0.003
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    43   0.003
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    43   0.003
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    43   0.003
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    43   0.003
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    43   0.003
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    43   0.004
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    43   0.004
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    43   0.004
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    43   0.004
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    43   0.004
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    43   0.004
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     43   0.004
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    43   0.004
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    43   0.004
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    43   0.004
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    42   0.004
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    43   0.004
NDAI0B02760 Chr2 complement(694100..697327) [3228 bp, 1075 aa] {...    43   0.004
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    42   0.004
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    43   0.004
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    43   0.004
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    43   0.004
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    43   0.005
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    43   0.005
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    43   0.005
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    43   0.005
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    43   0.005
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    43   0.005
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    42   0.005
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    42   0.005
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    42   0.005
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    42   0.005
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    42   0.005
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    42   0.005
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    42   0.006
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    42   0.006
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    42   0.006
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    42   0.006
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    42   0.006
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    42   0.006
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    42   0.006
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    42   0.007
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    42   0.007
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    42   0.007
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    42   0.007
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    42   0.007
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    42   0.007
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    42   0.007
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    41   0.008
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    42   0.008
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    42   0.008
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    42   0.008
KNAG0B00900 Chr2 (164610..165698) [1089 bp, 362 aa] {ON} Anc_3.4...    42   0.008
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    42   0.008
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    42   0.008
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    42   0.008
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    42   0.008
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    42   0.008
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    42   0.008
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    42   0.008
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    42   0.008
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    42   0.009
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    41   0.009
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    42   0.009
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    42   0.009
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    42   0.009
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    42   0.009
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    42   0.010
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    42   0.010
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    42   0.010
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    42   0.010
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    42   0.010
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    42   0.010
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    42   0.010
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    42   0.010
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    42   0.011
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    42   0.011
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    42   0.011
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    41   0.012
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    41   0.012
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    41   0.012
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    41   0.012
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    41   0.012
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    41   0.012
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    41   0.013
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    41   0.013
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    41   0.013
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    41   0.013
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    41   0.013
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    41   0.013
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    41   0.013
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    41   0.013
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    41   0.014
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    41   0.014
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    41   0.014
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    41   0.014
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    41   0.014
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    41   0.015
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    41   0.015
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    41   0.015
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    41   0.016
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    40   0.016
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    41   0.016
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    41   0.017
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    41   0.017
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    40   0.018
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    41   0.020
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    40   0.020
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    40   0.021
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    40   0.021
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    40   0.022
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    40   0.022
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    40   0.022
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    40   0.022
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    40   0.022
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    40   0.022
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    40   0.023
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    40   0.023
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    40   0.025
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    40   0.026
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    40   0.026
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              40   0.026
KNAG0L00330 Chr12 (45380..47014) [1635 bp, 544 aa] {ON} Anc_8.43...    40   0.027
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    40   0.027
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    40   0.027
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    40   0.027
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    40   0.028
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    40   0.028
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    40   0.028
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    40   0.029
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    40   0.029
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    40   0.030
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    40   0.031
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    39   0.031
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    40   0.031
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    40   0.031
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    40   0.031
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    40   0.032
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    40   0.032
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    40   0.032
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    40   0.032
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    40   0.033
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    40   0.034
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    40   0.034
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    40   0.035
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    40   0.035
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    40   0.036
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    40   0.036
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    40   0.036
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    40   0.037
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    40   0.038
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    39   0.038
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    40   0.038
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    40   0.038
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    40   0.039
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    40   0.040
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    40   0.041
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    40   0.042
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    39   0.043
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    40   0.043
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    39   0.043
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    39   0.044
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    40   0.044
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    40   0.045
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    39   0.046
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    39   0.046
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    39   0.047
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    39   0.048
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    39   0.048
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    39   0.049
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    39   0.051
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    39   0.053
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    39   0.054
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    39   0.054
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    39   0.055
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    39   0.055
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    39   0.055
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    39   0.057
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    39   0.058
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    39   0.059
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    39   0.060
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    39   0.061
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    39   0.061
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    39   0.062
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    39   0.066
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    39   0.066
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    39   0.071
KNAG0C02000 Chr3 (392436..393917) [1482 bp, 493 aa] {ON} Anc_1.3...    39   0.075
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    39   0.075
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    39   0.079
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    39   0.079
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    38   0.081
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    39   0.083
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    39   0.086
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    38   0.087
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    39   0.089
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    38   0.089
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    39   0.090
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    39   0.090
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      38   0.091
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    38   0.092
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    38   0.093
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    39   0.094
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    38   0.099
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    39   0.099
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    38   0.099
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    38   0.11 
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    38   0.11 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    38   0.11 
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    39   0.11 
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    38   0.11 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    38   0.11 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    38   0.12 
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    38   0.12 
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    38   0.12 
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    38   0.12 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    38   0.13 
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    37   0.13 
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    38   0.13 
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    37   0.14 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    38   0.15 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    38   0.15 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    38   0.15 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    38   0.15 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    38   0.15 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    38   0.15 
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    37   0.16 
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    37   0.16 
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    37   0.16 
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    38   0.17 
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    37   0.17 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    37   0.19 
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    37   0.19 
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    37   0.20 
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    37   0.21 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    37   0.21 
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    37   0.22 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    37   0.22 
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    37   0.22 
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    37   0.22 
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    37   0.23 
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    37   0.23 
KNAG0B05540 Chr2 (1079174..1080511) [1338 bp, 445 aa] {ON} Anc_4...    37   0.23 
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    37   0.24 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    37   0.24 
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    37   0.24 
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    37   0.24 
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    37   0.25 
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    37   0.25 
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    37   0.26 
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    37   0.26 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    37   0.26 
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    37   0.26 
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    37   0.26 
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    37   0.26 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    37   0.27 
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    37   0.27 
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    37   0.28 
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    37   0.29 
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    37   0.30 
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    37   0.30 
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    37   0.30 
KNAG0D00440 Chr4 (64241..65488) [1248 bp, 415 aa] {ON} Anc_6.333...    37   0.31 
Ecym_2258 Chr2 complement(510259..511278) [1020 bp, 339 aa] {ON}...    36   0.32 
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    37   0.32 
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    36   0.32 
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    37   0.33 
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    37   0.33 
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    37   0.34 
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    36   0.34 
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    36   0.34 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    37   0.36 
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    36   0.36 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    37   0.36 
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    37   0.36 
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    36   0.37 
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    36   0.37 
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    36   0.38 
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    36   0.38 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    36   0.39 
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    36   0.40 
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    36   0.40 
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    36   0.42 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    36   0.42 
TDEL0F03030 Chr6 (545760..552173) [6414 bp, 2137 aa] {ON} Anc_1....    37   0.42 
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    36   0.43 
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    36   0.44 
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    36   0.44 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    36   0.45 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    36   0.45 
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    36   0.46 
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    36   0.46 
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    36   0.48 
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    36   0.48 
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    36   0.49 
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    36   0.49 
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    36   0.49 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    36   0.50 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    36   0.50 
AFL038C Chr6 complement(367581..368573) [993 bp, 330 aa] {ON} Sy...    36   0.51 
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    36   0.51 
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    36   0.52 
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    36   0.53 
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    36   0.54 
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    35   0.55 
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    36   0.55 
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    36   0.57 
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    36   0.58 
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    36   0.59 
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    36   0.59 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    35   0.61 
KAFR0H02680 Chr8 (507660..510239) [2580 bp, 859 aa] {ON} Anc_8.6...    36   0.61 
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    35   0.62 
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    35   0.64 
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    35   0.65 
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    36   0.65 
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    35   0.65 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    35   0.66 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    36   0.67 
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    36   0.68 
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    36   0.69 
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    35   0.75 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    35   0.76 
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    35   0.77 
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    35   0.78 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    35   0.78 
Smik_6.325 Chr6 complement(511278..513968) [2691 bp, 896 aa] {ON...    35   0.79 
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    35   0.80 
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    35   0.81 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    35   0.82 
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    35   0.82 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    35   0.84 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    35   0.86 
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    35   0.87 
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    35   0.89 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    35   0.91 
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    35   0.92 
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    35   0.92 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    35   0.93 
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    35   0.93 
ZYRO0G21736g Chr7 (1788792..1789856) [1065 bp, 354 aa] {ON} high...    35   0.93 
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    35   0.94 
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    35   0.95 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    35   0.95 
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    35   0.96 
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    35   0.98 
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    35   0.98 
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    35   1.0  
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    35   1.0  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    35   1.0  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    35   1.1  
AER267W Chr5 (1126253..1128499) [2247 bp, 748 aa] {ON} Syntenic ...    35   1.1  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    35   1.1  
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    35   1.1  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   1.1  
NCAS0C01450 Chr3 complement(267976..270597) [2622 bp, 873 aa] {O...    35   1.1  
Suva_7.166 Chr7 (307962..309014) [1053 bp, 350 aa] {ON} YGL100W ...    35   1.1  
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    35   1.2  
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    35   1.2  
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    35   1.2  
NDAI0H03610 Chr8 (887848..889410) [1563 bp, 520 aa] {ON} Anc_1.359     35   1.3  
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    35   1.3  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    34   1.3  
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    35   1.3  
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    35   1.4  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    35   1.4  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    35   1.4  
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    34   1.4  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    35   1.4  
Suva_6.236 Chr6 (423785..426346) [2562 bp, 853 aa] {ON} YJL157C ...    35   1.4  
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    35   1.5  
Kpol_534.25 s534 complement(58326..59444) [1119 bp, 372 aa] {ON}...    34   1.5  
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    34   1.5  
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    34   1.5  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    34   1.6  
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    34   1.6  
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    35   1.6  
AFR634W Chr6 (1594214..1595686) [1473 bp, 490 aa] {ON} Syntenic ...    34   1.6  
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    35   1.6  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    35   1.7  
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    34   1.7  
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    34   1.7  
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    34   1.7  
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    34   1.7  
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    34   1.7  
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    34   1.7  
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    34   1.7  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    34   1.8  
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    34   1.8  
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    34   1.8  
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    34   1.8  
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    34   1.8  
KLLA0E13553g Chr5 complement(1195444..1197186) [1743 bp, 580 aa]...    34   1.8  
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    34   1.9  
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    34   1.9  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    34   1.9  
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    34   1.9  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    34   1.9  
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             34   1.9  
NDAI0E02190 Chr5 complement(450769..453492) [2724 bp, 907 aa] {O...    34   1.9  
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    34   1.9  
TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3....    34   2.0  
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    34   2.1  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    34   2.1  
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    34   2.1  
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    34   2.1  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    34   2.1  
AFR153W Chr6 (711168..712898) [1731 bp, 576 aa] {ON} Syntenic ho...    34   2.2  
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    33   2.3  
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    34   2.3  
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    34   2.3  
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    33   2.4  
TBLA0C00970 Chr3 complement(193861..194844) [984 bp, 327 aa] {ON...    33   2.4  
TBLA0F00440 Chr6 (115779..118880) [3102 bp, 1033 aa] {ON} Anc_7....    34   2.4  
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    34   2.4  
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    33   2.4  
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    34   2.5  
TBLA0G03390 Chr7 complement(900177..902099) [1923 bp, 640 aa] {O...    34   2.5  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    33   2.5  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    33   2.5  
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    33   2.5  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    33   2.6  
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    34   2.6  
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    34   2.6  
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    33   2.7  
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               33   2.8  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    34   2.8  
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    33   2.8  
Suva_15.79 Chr15 complement(128494..131850) [3357 bp, 1118 aa] {...    33   2.9  
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    33   2.9  
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    33   3.0  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    33   3.0  
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    33   3.1  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    33   3.1  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    33   3.1  
KAFR0H00750 Chr8 (140330..141574) [1245 bp, 414 aa] {ON} Anc_3.3...    33   3.1  
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    33   3.2  
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    33   3.2  
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    33   3.2  
AGR242C Chr7 complement(1203146..1204405) [1260 bp, 419 aa] {ON}...    33   3.2  
KLLA0C12771g Chr3 (1081988..1085017) [3030 bp, 1009 aa] {ON} sim...    33   3.3  
AAL119W Chr1 (137922..139535) [1614 bp, 537 aa] {ON} Syntenic ho...    33   3.4  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    33   3.4  
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    33   3.5  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    33   3.7  
TPHA0E03510 Chr5 (741718..748116) [6399 bp, 2132 aa] {ON} Anc_1....    33   3.7  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   4.0  
NCAS0B05410 Chr2 (1008672..1012064) [3393 bp, 1130 aa] {ON} Anc_...    33   4.2  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    33   4.2  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    33   4.2  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    33   4.3  
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    33   4.3  
YOL087C Chr15 complement(155287..158637) [3351 bp, 1116 aa] {ON}...    33   4.4  
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     33   4.6  
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    33   4.7  
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    33   4.8  
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    33   4.8  
CAGL0A00781g Chr1 (77746..81366) [3621 bp, 1206 aa] {ON} similar...    33   4.9  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    33   4.9  
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    33   5.0  
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    33   5.0  
NDAI0G02390 Chr7 complement(547355..550252) [2898 bp, 965 aa] {O...    33   5.2  
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    33   5.2  
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    32   5.5  
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    33   5.6  
KNAG0B02990 Chr2 (577427..579097) [1671 bp, 556 aa] {ON} Anc_7.2...    33   5.7  
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    33   5.7  
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    32   5.9  
TDEL0A03540 Chr1 (630893..632758) [1866 bp, 621 aa] {ON} Anc_5.4...    32   5.9  
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    33   5.9  
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    32   6.0  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    32   6.1  
CAGL0K10692g Chr11 (1040242..1041759) [1518 bp, 505 aa] {ON} sim...    32   6.3  
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    32   6.3  
Skud_16.374 Chr16 complement(672714..674045) [1332 bp, 443 aa] {...    32   6.3  
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    32   6.5  
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    32   6.5  
ZYRO0B05984g Chr2 (483249..486374) [3126 bp, 1041 aa] {ON} simil...    32   6.7  
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    32   6.8  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    32   6.8  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    32   6.9  
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    32   7.0  
KLTH0G02772g Chr7 (214898..216805) [1908 bp, 635 aa] {ON} simila...    32   7.0  
Ecym_5584 Chr5 complement(1199282..1200238) [957 bp, 318 aa] {ON...    32   7.1  
CAGL0M02805g Chr13 (317204..319822) [2619 bp, 872 aa] {ON} simil...    32   7.5  
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    32   7.7  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    32   7.9  
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    32   8.1  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    32   8.8  
Suva_16.184 Chr16 (319761..322448) [2688 bp, 895 aa] {ON} YPL126...    32   8.9  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    32   9.2  
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    32   9.4  
KLLA0A07106g Chr1 complement(640536..641468) [933 bp, 310 aa] {O...    32   9.5  
Kpol_242.8 s242 (12067..13335) [1269 bp, 422 aa] {ON} (12067..13...    32   9.6  
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    32   9.6  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    32   9.8  
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    32   9.8  

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1866 bits (4833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 916/935 (97%), Positives = 916/935 (97%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60
           MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60

Query: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120
           DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI
Sbjct: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG 180
           TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG
Sbjct: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG 180

Query: 181 LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK 240
           LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK
Sbjct: 181 LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK 240

Query: 241 GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK 300
           GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK
Sbjct: 241 GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK 300

Query: 301 GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS 360
           GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS
Sbjct: 301 GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS 360

Query: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR 420
           IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR
Sbjct: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR 420

Query: 421 NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480
           NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK
Sbjct: 421 NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480

Query: 481 RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL 540
           RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL
Sbjct: 481 RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL 540

Query: 541 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600
           AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD
Sbjct: 541 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660
           CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS
Sbjct: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660

Query: 661 SDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFISNN 720
           SDGQAVVSVSHDRSIRVWEETEDQVF                   SLEGGSGDDAFISNN
Sbjct: 661 SDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAFISNN 720

Query: 721 GDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKLGDQPTK 780
           GDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKLGDQPTK
Sbjct: 721 GDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKLGDQPTK 780

Query: 781 PQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVILH 840
           PQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVILH
Sbjct: 781 PQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVILH 840

Query: 841 KQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGLKF 900
           KQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGLKF
Sbjct: 841 KQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGLKF 900

Query: 901 VRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           VRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF
Sbjct: 901 VRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1350 bits (3495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/936 (68%), Positives = 778/936 (83%), Gaps = 2/936 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQ-AKNSPGQVITGALEEVKCWEIKTGELLKTM 59
           MV SYQRFEQ   FGV+ +NSNCVW+P++ ++ SPGQ+IT +LE + CW+IKTG LLKT+
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
            D +PPG+ID K EKPAE  YL+YH ET +LA GYADG IKIWDMQTQTVLI+F+SH++A
Sbjct: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           IT L+FD +GTRLISGSRD+ II+WDLV E GLCKLRSHKD+ITGIW ENDDWLIS SKD
Sbjct: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180

Query: 180 GLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLE 239
           GLIK+WD+K  QCVETHMAHT ECWSLA+ D++V+TANA+SE+K+WELDLER NGS L E
Sbjct: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240

Query: 240 KGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKE 299
           KG YEKQS+QR  ++   T  D   FFY  N+DKT E+FRIR+ +E++KALKKREKR KE
Sbjct: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLKE 300

Query: 300 KGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYY 359
           KG+S++EIQE  ++S+ N ++ PFQ+VRS FK K+++WT C+ SKLELV TT+NNTIEYY
Sbjct: 301 KGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360

Query: 360 SIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCI 419
           SIPYK ++P Q  A KL++IE  GHRTD+R+ DIS D+KLLA ASNG LK+WNI T++CI
Sbjct: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420

Query: 420 RNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDG 479
           R  DCGYALCCKFLPGG LV++GTR G+LQLFDLASS +LEN E AH AAIWSLDLTSDG
Sbjct: 421 RTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480

Query: 480 KRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRF 539
           +RL+T SADKTVKFW+F+VE+EL++ + DK+  +++++HDTTL+LGED+  VKISPEDRF
Sbjct: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540

Query: 540 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFG 599
           LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS+DSKLIITSSADKNIKIWGLDFG
Sbjct: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600

Query: 600 DCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAV 659
           DCH+SLFAHQD+IMNVKF+P+SHNFFSC KDG +KYWDG  FDCIQKL  H+ EVWALA+
Sbjct: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660

Query: 660 SSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFISN 719
           SSDGQ  VSVSHDRSIRVWEETEDQVF                   +LE  + D+ F  N
Sbjct: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720

Query: 720 NGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNK-KLGDQP 778
           + ++T   E T+VHKQTIESLKAGERLMEALDLGI+E++A E+Y + + LWNK K GDQP
Sbjct: 721 SEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQP 780

Query: 779 TKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVI 838
            KPQ+N+IL A++K PE Y+M+TL +IKP+QLEDALLVLPFSYVLKFLKFID +I+   +
Sbjct: 781 MKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQL 840

Query: 839 LHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGL 898
           ++  LPL+C+ L++VV+ NHKEL++QKNEELK+QIN+VKD+LRAAL+ ++DDLGFNI+GL
Sbjct: 841 VNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEGL 900

Query: 899 KFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934
           KF++  WNV HN++F DEYDQ   E   SKKR+F T
Sbjct: 901 KFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTT 936

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1345 bits (3481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/940 (67%), Positives = 771/940 (82%), Gaps = 5/940 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60
           MVKSYQRFEQ   FGV+++N+NCVW+ S+ + S GQ++TGALE V CW+IKTGEL K + 
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSAGQILTGALENVNCWDIKTGELSKILT 60

Query: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120
           DGLPPGA+D K+ K AE+TYLQYH ET +LAVGYADG IKIWD+ ++TVLI F+ H SAI
Sbjct: 61  DGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI 120

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG 180
           T+LRFD TGTRLISGS+D+ II+WDLV E GL KLRSHKD+ITGIWCEN+DWLIS SKDG
Sbjct: 121 TVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDG 180

Query: 181 LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK 240
           LIK+WD+K  QCVETHMAHT ECW LA+ +++VIT + ES+IK+W LDL++  GS L+EK
Sbjct: 181 LIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIEK 240

Query: 241 GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK 300
           G YEKQSKQR   + F T +DG  FFY  N+DKT+EIFR+R++ EI+KAL+KREKR ++K
Sbjct: 241 GIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRDK 300

Query: 301 GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS 360
           GM+DE+IQ++ ++SY ++++HPFQ +RS FK+KA++W V T SKLE+V+TT+NNT+EYYS
Sbjct: 301 GMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYYS 360

Query: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR 420
           IPY+K+EP +P   KL++IE  GHRTD+R+ DIS D+KLLATASNG LK+WNIKT  CIR
Sbjct: 361 IPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACIR 420

Query: 421 NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480
             +CGYAL CKFLPGGALV++G R G LQLFDLASST+LEN E+AH AAIWSLDLTSDGK
Sbjct: 421 TFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGK 480

Query: 481 RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL 540
           RLVT SADKTVKFWDFKV+QEL+ GT+DKFVPK+K+ HDTTL+L +D+  VKIS +++FL
Sbjct: 481 RLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFL 540

Query: 541 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600
           AVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLS+DIS DSKL+ITSSADKNIKIWGLDFGD
Sbjct: 541 AVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660
           CHKSLFAHQDSIM+VKF+PESHNFFSCSKDG VKYWDG+ F+C+QKL  HQ EVWALA+S
Sbjct: 601 CHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIS 660

Query: 661 SDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAF---I 717
           +D + VVS SHD SIRVWEETED+VF                   SLE GSGDD F   I
Sbjct: 661 NDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQRDI 720

Query: 718 SNNGDETAGV-ESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KKLG 775
              G++     ++T+VHKQTIESLKAGER++EALDLGI  I+  E YE+ +K W  KK G
Sbjct: 721 EGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKSG 780

Query: 776 DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKN 835
           + P+KPQ NAIL AL K PE Y+METL KI+PSQLEDALLVLPFSYVL FLKFID+ IK+
Sbjct: 781 EPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIKD 840

Query: 836 DVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNI 895
             + +  L L+CK+L F+++SN++ELV+QKNEELK+QINRVK +LR AL+ + DDLGFN+
Sbjct: 841 KKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFNV 900

Query: 896 QGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           QGLKF+R  WN+ HN +F D+YDQ  +E+   KKR+F T 
Sbjct: 901 QGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1332 bits (3446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/939 (65%), Positives = 764/939 (81%), Gaps = 7/939 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK----NSPGQVITGALEEVKCWEIKTGELL 56
           MVKSYQRFEQA  FGV+ +N+NCVW+P+ ++    + PGQ+IT ALE V  W+IKTG+L+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60

Query: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
            T+ DGLPPGA D K  KPAE TYL+ H++T +LAVGYADG IK+WD+ ++TVL+ F+ H
Sbjct: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176
            +AIT+++FD TGTRLISGS+D+ II+WDLV E GL KLRSHKDAITG WC+ +DWL+S 
Sbjct: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180

Query: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN-GS 235
           SKDGLIK+WD+K  QC+ETH+AHTGECW LAVKD+++IT + +S++K+W+L++E    G 
Sbjct: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240

Query: 236 MLLEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKRE 294
            L E G +EKQSKQR  ++ F T  +DG +FFY  N+DKT+E +RIR E EIA+ LKKRE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKRE 300

Query: 295 KRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANN 354
           KR +EKG++DEEI +S ++SY++L+LHPFQ VRSL+K+K++SWT  T SKLELV+TT+NN
Sbjct: 301 KRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360

Query: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIK 414
           TIEYYSIPY+K++P  P  +K H+IE  G RTD+R+ D+S D+KLLATASNG+LK+WN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420

Query: 415 TKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474
           T  CIR  +CGYAL CKFLPGG LVILGTR+G+LQLFDLASS++L+ IE+AH AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534
           LTSDGKRLVT SADKTVKFWDF+VE+ LV GT DKFVP +KL HDTTL+L +D+  V+IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540

Query: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG  F+CIQKLY HQ EV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDD 714
           WALA+S+DG  VVS SHD SIR+WEETEDQVF                   SLE G+GDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 715 AFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KK 773
           AF  +   E    E++ VHKQT+ESLKAGE+LMEALDLGI EI+  E Y + MKLW  KK
Sbjct: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780

Query: 774 LGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833
           LG+ P KPQ N++L A+ KTPE Y+M+TLS+I+ SQLEDAL+V+PFSYVLKFLKF D  +
Sbjct: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840

Query: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893
           +N  +LH  LPL+CK L F+++ NHKEL+SQKNEELK+QINRVK +LR AL+S  DDLGF
Sbjct: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLF 932
           N+QGLKF+R  WN+ HNY+F DEYDQ  KE   ++KR+F
Sbjct: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1323 bits (3423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/941 (65%), Positives = 763/941 (81%), Gaps = 7/941 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK----NSPGQVITGALEEVKCWEIKTGELL 56
           MVKSYQRFEQ+  FGV+ +N+NCVWLP+ ++    + PGQ+IT ALE V  W+IKTG+L+
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
            T+ DGLPPGA D +  KPAE TYL+ H++T +LAVGYADG IK+WD+ ++TVL+ F+ H
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176
            +AIT+L+FD TGTRLISGS+D+ II+WDLV E GL KLRSHKD+ITG WC+ +DWLIS 
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN-GS 235
           SKDG+IKLWD+K  QC+ETH+AHTGECW L+VKD+++IT   +S++KLW+L++E    G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 236 MLLEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKRE 294
            L E G++EKQSKQR  ++ F T  +DG +FFY  N+DKT+EIFRIR E EIA+ LKKRE
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 295 KRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANN 354
           KR +EKG++DEEI +S ++SY++L+LHPFQ VRSL+K+K++SWT  T SKLELV+TT+NN
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIK 414
           TIEYYSIPY+K+EP  P  +K H+IE  G RTD+R+ DIS D++LLATASNG+LK+WN+K
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 415 TKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474
           T  CIR  +CGYAL CKFLPGG LVILGTR G+LQLFDLASS++L+ IE+AH AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534
           LTSDGKRLVT SADKTVKFWDF+VE  LV GT DKF+P +KL HDTTL+L +D+  ++IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG  F+CIQKLY HQ EV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDD 714
           WALA+S+DG  VVS SHD SIR+WEETEDQVF                   SLE G+GDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 715 AFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KK 773
           AF  +   E+   E + VHKQT+ESLKAGERLMEALDLGI EI+  E Y + MKLW  KK
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 774 LGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833
           LG+ P KPQ N++L A++KTPE Y+M+TL +I+ SQLEDAL+V+PFSYVLKFLKFID  +
Sbjct: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840

Query: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893
           +N  +LH  LPL+CK L F+++ NHKELVSQKNEELK Q++RVK +LR AL+S  DDLGF
Sbjct: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900

Query: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934
           N+QGLKF++  WN+ HNY+F DEYDQ  KE   ++KR F T
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFET 941

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1321 bits (3418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/958 (65%), Positives = 775/958 (80%), Gaps = 26/958 (2%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQA--KNSPGQVITGALEEVKCWEIKTGELLKT 58
           MVKSYQRFEQA VFGV+++NSNCVWLPS +  K+ PGQ+ITGALE V  W++KTGEL   
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKKSHPGQIITGALENVNIWDLKTGELASF 87

Query: 59  MRDGL--PPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
           + DGL  PPG++D K+ KPAE T+LQ+H+ET +LAVGY DG +K+WD+ ++TVL   + H
Sbjct: 88  LNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGH 147

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWC--------- 167
           SSAIT L+FD +GTRLISGSRD+ II+WDLV+E GL KLRSHKDAITGIWC         
Sbjct: 148 SSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQE 207

Query: 168 END-DWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWE 226
           EN+ DWLIS SKDGLIK+WD+K+ QCVETH+AHTGECWSLAV++++VIT +++S++K W+
Sbjct: 208 ENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQ 267

Query: 227 LDLER---PNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSE 283
           L L+    PNGS L+EKG YEKQSKQR   + F    DG  FF   N+D+T+EIFR+R E
Sbjct: 268 LSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLRKE 327

Query: 284 TEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPS 343
            EI+KALKKREKR  EKGM+ +EI++S  +S+ ++++HPFQ++RS++K+KA++WT+ T +
Sbjct: 328 EEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIATST 387

Query: 344 KLELVITTANNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATA 403
           KLEL +TTANNTIEYYSIPY+K+EP QP A KL+++E  G RTD+R+ DIS D+KLLATA
Sbjct: 388 KLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLLATA 447

Query: 404 SNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIE 463
           SNG+LK+WN+KTK CIR  +CGYAL CKFLPGG LVI+GTRAG+LQLFDLASST + NIE
Sbjct: 448 SNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIANIE 507

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLD 523
           EAH AAIWSLDLTSDGKRL+T SADK+VKFW+F++EQELV GT DKFVPK+ L HDTTL+
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLE 567

Query: 524 LGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
           L +D+  V++SPED+FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS DSK+II
Sbjct: 568 LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMII 627

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF+PESHNFFSCSKDG +KYWDG+ F+C
Sbjct: 628 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFEC 687

Query: 644 IQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXX 703
           IQKL  HQ EVWALA+++D   VVS SHD SIR+WEETED+VF                 
Sbjct: 688 IQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYEDTL 747

Query: 704 XXSLEGGSGDDAFISNNGDETAGV-----ESTEVHKQTIESLKAGERLMEALDLGITEID 758
             SLE G+GDDAF    GD          E+T+VHKQT+ESLKAGERLMEA DLG+ EI+
Sbjct: 748 LASLEEGNGDDAF---KGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIE 804

Query: 759 AWEKYEQQMKLWN-KKLGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVL 817
           ++E+Y++ +KLW  KK G+ P KPQ NAIL A+ KTPE Y+M+TL +IKPSQLEDALLVL
Sbjct: 805 SFEEYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVL 864

Query: 818 PFSYVLKFLKFIDIAIKNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVK 877
           PFSYVLKFLKFI+I I N  +L+  L L+CK L F+V+SNHKELVSQKNE LK+QI +VK
Sbjct: 865 PFSYVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVK 924

Query: 878 DQLRAALRSHVDDLGFNIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           ++LR AL+++ DDLGFNIQG+KF++  WN+ HN +F DEYDQ + E   +KKR F T 
Sbjct: 925 NELRNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTL 982

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1320 bits (3415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/941 (65%), Positives = 759/941 (80%), Gaps = 7/941 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK----NSPGQVITGALEEVKCWEIKTGELL 56
           MVKSYQRFEQ+ +FGV+ +N+NCVWLP  ++    + PGQ+IT ALE V  W+IKTG+LL
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
            T+ DGLPPGA D +  KPAE TYL+ HE+T +LAVGYADG IK+WD+ ++TVL+ F+ H
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176
            +AIT+L+FD TGTRLISGSRD+ II+WDLV E GL KLRSHKD ITGIWC+ +DWLIS 
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN-GS 235
           SKDG+IKLWD+K  QC+ETH+AHTGECWSL+VKD+++IT   +S++K+W+L++E    G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 236 MLLEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKRE 294
            L E G +EKQSKQR  ++ F T  +DG +FFY  N+DKT+E FRIR E EIA+ LKKRE
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 295 KRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANN 354
           KR +EKG++DEEI  S + SY++L+LHPFQ +RS +K+K++SWT  T SKLELV+TT+NN
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIK 414
           TIEYYSIPY+K+E   P  +K H+IE  G RTD+R+ DIS D+KLLATASNG+LK+WN+K
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 415 TKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474
           T  CIR  +CGYAL CKFLPGG LVILGTR G+LQLFDLASS++L+ +E+AH AAIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534
           LTSDGKRLVT SADKTVKFWDF+VE  LV GT DK +P +KL HDTTL+L +D+  V+IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG  F+CIQKLY HQ EV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDD 714
           WALA++S+G  VVS SHD SIR+WEETEDQVF                   SLE G+ DD
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 715 AFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KK 773
           AF  +   E    E++ VHKQT+ESLKAGERLMEALD+GI +I+  E Y + M+LW  KK
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 774 LGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833
           LG+ P KPQ N++L A++KTPE Y+++TLS+I+ SQLEDAL+V+PFSYVLKFLKFID  +
Sbjct: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893
           +N  +LH  LPL+C+ L F+++ NHKELVSQKNEELK+QINRVK +LR AL+S  DDLGF
Sbjct: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934
           N+QGLKF++  WN+ HNY+F DEYDQ  KE   ++KR+F T
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFET 941

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1312 bits (3396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/959 (65%), Positives = 773/959 (80%), Gaps = 26/959 (2%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK--NSPGQVITGALEEVKCWEIKTGELLKT 58
           MVKSYQRFEQ  VFGV+ +NSNC+WLPS +    SPGQ+IT ALE +  W+IKTGEL   
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDSNPSTSPGQIITSALENINIWDIKTGELSSH 60

Query: 59  MRDGL--PPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
           + D L  PPG+ID K+ KPAE TYLQ+H++T +LAVGY DG IK+WD+ ++TVL   + H
Sbjct: 61  LIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLNGH 120

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWC--------- 167
           SSAIT+L+FD TGTRLISGSRD+ II+WDLV+E GL KLRSHKDAITGIWC         
Sbjct: 121 SSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNGED 180

Query: 168 -END-DWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLW 225
            EN+ DWLIS SKDGLIK+WD+K+ QC+ETH+AHTGECWS+AV+++++IT +++S+IK+W
Sbjct: 181 DENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIKIW 240

Query: 226 ELDLERPN---GSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRS 282
           EL+L+  +      L+EKG YEKQSKQR   + F   AD T FFY  N+DKT+EIFR+R 
Sbjct: 241 ELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTADETGFFYIQNADKTVEIFRLRK 300

Query: 283 ETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTP 342
           + EI KA+KKR KR  EKGM+ E+I+++ ++SY +L++HPFQ+VRS++K+KA +WT+ TP
Sbjct: 301 QDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTIATP 360

Query: 343 SKLELVITTANNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLAT 402
           SKLEL +TT+NNTIEYYS PY+K+EP QPT  KLH+IE  G RTD+R+ DIS D+KLLAT
Sbjct: 361 SKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKLLAT 420

Query: 403 ASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENI 462
           ASNG LK+WNIKTK+CIR  +CGY+L CKFLPGG LVI+GTR G+LQLFDLASST+LE I
Sbjct: 421 ASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLLETI 480

Query: 463 EEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTL 522
           E+AH AAIWSLDLTSDGKRLVT SADK+VKFWDF++EQELVAGT+DK++PK+KL HDTTL
Sbjct: 481 EDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHDTTL 540

Query: 523 DLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLI 582
           +L +D+  VKISPED+FLAVSLLDNTVKVFF+D+MKFFLSLYGHKLPVLS+DIS DSKLI
Sbjct: 541 ELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDSKLI 600

Query: 583 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFD 642
           ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF+PESHNFFSCSKDG +KYWDG+ F+
Sbjct: 601 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFE 660

Query: 643 CIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXX 702
           CIQKL GHQ EVW++A+++D   +VS SHD SIR+WEETED+VF                
Sbjct: 661 CIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYEDT 720

Query: 703 XXXSLEGGSGDDAFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEK 762
              SLE  +GDDAF  + G++    E+T+VHKQT+ESLKA ERLMEA DLG+ EI+A E+
Sbjct: 721 LLTSLEEDNGDDAFKKDGGEDKD--EATDVHKQTMESLKASERLMEAFDLGMKEIEAMEE 778

Query: 763 YEQQMKLWNKKLGDQ------PTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLV 816
           YE+++K W +K  +       P KPQ NAIL A+ KTPE Y+M+TL +IKPSQLEDALLV
Sbjct: 779 YERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLV 838

Query: 817 LPFSYVLKFLKFIDIAIKNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRV 876
           LPFSY++KFLKFIDI I +  IL+  LPL+C+IL F+V+SNHKELVSQKNEELK QI RV
Sbjct: 839 LPFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRV 898

Query: 877 KDQLRAALRSHVDDLGFNIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           KD LR AL+++ DDLGFNIQGLKF++  W + HNY++ D+ DQ A+E   +KKR F T 
Sbjct: 899 KDNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGTI 957

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1308 bits (3386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/937 (65%), Positives = 760/937 (81%), Gaps = 2/937 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60
           MVKSYQRFEQ+  FGV+++NSNCV++P   +   GQV+TG LE+V  W++KTG+L+  + 
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANRKGLGQVLTGGLEKVNLWDLKTGDLVSCLS 60

Query: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120
           DGLPPG+ID K+ KPAE TYL+YH ET +LAVGYA+G IK+WD+ ++TVL+  + H SA+
Sbjct: 61  DGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKSAV 120

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG 180
           TIL+FD TGTRLISGS+D+ II+WDL+ E GL KLRSHK AI+G+W E D+WLIS S+DG
Sbjct: 121 TILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLISTSRDG 180

Query: 181 LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK 240
           LIK+WD+K  QCVETH+AHTGECWSL V +++ ITA+A+S++K+W L+ E   GS L+EK
Sbjct: 181 LIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEAGSKLIEK 240

Query: 241 GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK 300
           G YEKQS QR + + F T  D TTFFY  N+DK++EIFRIR E EI KA +KREKR KEK
Sbjct: 241 GIYEKQSNQRGSSIEFVTTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLKEK 300

Query: 301 GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS 360
           G+SDEEI+++ ++ Y ++++HPFQ++RS FK+KA++W   T SKL+LV+TTA+NT+EYY+
Sbjct: 301 GLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEYYT 360

Query: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR 420
           IPY+K+EP  P   +LHS+E  GHRTD+RA DIS+D  LLATASNG LKVWN+KT+ C+R
Sbjct: 361 IPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMCLR 420

Query: 421 NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480
             DCGYALCC+FLPGG L+++GTR G LQLFDLASSTML+N E AH AAIWSLD+TSDGK
Sbjct: 421 TFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSDGK 480

Query: 481 RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL 540
           +LVT SADK+VKFW F+VE++L+AGT+DKF P MKL HDTTL+L +D+  V+ISPED++ 
Sbjct: 481 KLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDKYF 540

Query: 541 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600
           A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIWGLDFGD
Sbjct: 541 AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660
           CHKSLFAHQDSIM+VKFLPESHNFFSCSKDG VKYWDG+ F+CIQKL GHQ EVWALA+S
Sbjct: 601 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALAIS 660

Query: 661 SDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFISN- 719
           ++G+ VVS SHDRSIR+WEETEDQVF                   SLE GSGD AF  + 
Sbjct: 661 NNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRKDV 720

Query: 720 NGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKLGD-QP 778
            GDE    E+ +V KQTIESLKAGERLMEALDLGI EI+  E YE+++K WNK  GD +P
Sbjct: 721 GGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHKGDAKP 780

Query: 779 TKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVI 838
            KP  NAIL A+ KTPE Y++ETL++IKPSQLEDALLVLPFSYVLKF +FID A+ ++ I
Sbjct: 781 VKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLDNRI 840

Query: 839 LHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGL 898
           L   LPL+CK L F+V+SNH+ELVSQKNEELK++I +VKD LR AL+S+ DDLGFNI+GL
Sbjct: 841 LQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNIEGL 900

Query: 899 KFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           KF+R  W++ H  +F D+Y Q  +E   +KKR+F T 
Sbjct: 901 KFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETI 937

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1305 bits (3377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/941 (66%), Positives = 765/941 (81%), Gaps = 7/941 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNS----PGQVITGALEEVKCWEIKTGELL 56
           MVKSYQRFEQA  FGV+ +N+NCVW+P+ + NS    PGQ+IT ALE+V  W+IKTG+L+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
             + DGLPPGA D +  KPAE TYL+ H++T +LAVGYADG IK+WD+ ++TVL+ F+ H
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176
            +AIT+L+FD TGTRLISGS+D+ II+WDLV E GL KLRSHKD+ITG WC+ +DWLIS 
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN-GS 235
           SKDG+IKLWD+K HQC+ETH+AHTGECW LAVKD+++IT   +S++K+W+LD+E    G 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 236 MLLEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKRE 294
            L E G +EKQSKQR  ++ F T  +D T+FFY  N+DKT+E FRIR E EIA+ LKKRE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 295 KRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANN 354
           KR KEKG+++EEI +S + SY++ +LHPFQ +RSL+K+K++SWT  + SKLELV+TT++N
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIK 414
           TIEYYSIPY+K++P  P  +K H+IE  G RTD+R+ DIS D+KLLATASNG+LK+WNIK
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 415 TKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474
           T  CIR  +CGYAL CKFLPGG LVILGTR G+LQLFDLASS++L+ IE+AH AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534
           LTSDGKRLVT SADKTVKFWDFKVE  LV GT +KF+P +KL HDTTL+L +D+ CV++S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654
           GLDFGDCHKSLFAHQDSIMNVKFLP+SHNFFSCSKD  VKYWDG  F+CIQKLY HQ EV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 655 WALAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDD 714
           WALAV++DG  VVS SHD SIR+WEETEDQVF                   SLE G+GDD
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 715 AFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KK 773
           AF ++   E    E++ VHKQT+ESLKAGERLMEALDLGI EI+  E Y + MKLW  KK
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 774 LGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833
           LG+ P KPQ NA+L A++KTPE Y+M+TL +I+ SQLEDAL+V+PFSYVLKFLKFID  +
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893
           +N  +LH  LPL+CK L F+++ NHKELVSQKNEELK+QINRVK +LR+AL+S  DDLGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934
           N+QGLKFV+  WN+ HNY+F DEYDQ  KE   ++KR+F T
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGT 941

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1292 bits (3344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/940 (65%), Positives = 762/940 (81%), Gaps = 10/940 (1%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK--NSPGQVITGALEEVKCWEIKTGELLKT 58
           MVKSYQRFEQA VFGV++ N+NCVW+  ++K  NSPG VIT ALE +  W+IKTGEL+  
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60

Query: 59  MRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSS 118
           + DGLP G+ID K+ KPAE +YL YH+ET +LA GY DGTIK+WD+ +++VL+ F+ H S
Sbjct: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120

Query: 119 AITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSK 178
           AIT+++FD TGTRLISGSRD+ II+WDLV+E GL KLRSHKDAI+GIWCE +DWL+S SK
Sbjct: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180

Query: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238
           DGLIK+WD+KV QC+ETH+AHTGECW++ V ++++IT+ A++++KLW LD  +  GS L+
Sbjct: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240

Query: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298
           EKG Y+KQSKQR  ++ F+   +GT FFY  N+DKT E+FRIR E EI+KALKKREKR K
Sbjct: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRLK 300

Query: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358
           EKGM+DEEIQ++ + SY+++++HPFQ+++S +K+K+ S+T  + +KLE V+TT++N+IEY
Sbjct: 301 EKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360

Query: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418
           YSIPY+K++P  P   +L++IE PGHRTD+R+ DIS DDKLLATASNG LKVWN+KTK C
Sbjct: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420

Query: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478
           IR  DCGYAL CKFLPGG LVI+GTR G LQLFDLASST+LEN E+AH  AIWSLD+TSD
Sbjct: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480

Query: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538
           G+RLVT SADKT+KFW+F+VE++LV GT DK++P MKLIHDTT+++ ED+  V+ISPED+
Sbjct: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
           FLA+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLS+DIS DSKLIITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658
           GDCHKSLFAHQDSIMNVKFLPESHNFFS SKDG VKYWDG+ F+CIQKL  HQ EVW++A
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660

Query: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFIS 718
           ++SDG +V+S SHD S+RVWEET+DQVF                   SLE GSGDDAF  
Sbjct: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAF-- 718

Query: 719 NNGD-ETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKK--LG 775
             GD E    EST V  QT+ESLKAGERLMEALDLG++EI+A EKY+  MK W KK   G
Sbjct: 719 -KGDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSG 777

Query: 776 DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKN 835
           + P KPQ NAIL A+ K P  Y+METL KIKPSQLEDALLVLPFSYVLK LKFIDI +K+
Sbjct: 778 EPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKD 837

Query: 836 DVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNI 895
             +    L L+CK L FV+RSNHKEL+SQ+NE LK QI  VK+ LR +L+ +VDDLGFNI
Sbjct: 838 KKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNI 897

Query: 896 QGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           QGLKF++  WN+ HN+DF D++D+  KE+   KKR+F T 
Sbjct: 898 QGLKFIKQQWNLKHNFDFTDDFDK--KEESSGKKRIFGTL 935

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1291 bits (3341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/937 (64%), Positives = 755/937 (80%), Gaps = 3/937 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60
           MVKSYQRFEQ  VFGV+++NSNC+WLP++ +NS GQV+TGALE V CW +K+GEL+ T+ 
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAENRNSTGQVLTGALENVNCWSMKSGELIGTLT 60

Query: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120
           DGLPPGA+D K+ KPAE +YLQYH ET +LAVGY DG IKIWD+ +++VLI F+ H SAI
Sbjct: 61  DGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAI 120

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG 180
           TIL FDQTGTRLISGSRD+ II+WDLV E GL KLRSHKD+ITG+WCE ++WLIS SKDG
Sbjct: 121 TILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSKDG 180

Query: 181 LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK 240
           LIK+WD+KV QCVETH+AH GECWS+ V +++VITA A+++IKLW L+ E   GSML+EK
Sbjct: 181 LIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLIEK 240

Query: 241 GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK 300
           G++EKQS+QR   + FTTV+D TTFF+  N+D+++E FR+R + EIAKALKKREKR  EK
Sbjct: 241 GTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLTEK 300

Query: 301 GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS 360
           G+S++EIQ++ ++S+ + ++HPFQ+VRS++K+++  W   T SKL+LV+TTANNT++YYS
Sbjct: 301 GLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDYYS 360

Query: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR 420
           I Y+K+EP  P+  KLHSI+  GHR+D+RA DIS D+KLLATASNG LK+WNIKT +CIR
Sbjct: 361 IKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIR 420

Query: 421 NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480
             +CGYAL CKFLPGGALV+LGT+ G L L+DLASST+L  IE AH+ AIWSLD+T+DGK
Sbjct: 421 TFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGK 480

Query: 481 RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL 540
           RLVT SADKTV FWDF+VEQE V GT DKF PK+K+ HDTTL+L +D+  VKISP++R L
Sbjct: 481 RLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLL 540

Query: 541 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600
           AVSLLDNTVKVFF+DSMKFFLSLYGHKLPVLS+DIS DSKL+ITSSADKNIKIWGLDFGD
Sbjct: 541 AVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGD 600

Query: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660
           CH+SLFAH DSIM V F+PESHNFFSCSKD  VKYWDG+ F+CIQKL  HQ EVW LA+S
Sbjct: 601 CHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAIS 660

Query: 661 SDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFISN- 719
           SDG+ VVS SHD+SIRVW ET+DQVF                   SLE G+GDD F  + 
Sbjct: 661 SDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEKDG 720

Query: 720 NGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKL-GDQP 778
           NGD     ++T+VHKQT ESLKA E+LMEALDLG++EI+   +YE+ +K W KK  G  P
Sbjct: 721 NGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKRSGPHP 780

Query: 779 TKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVI 838
            KP  N+IL A++KTP  Y+M+ L KIKPSQLEDALLVLPF+YVL FL FID+ +K   +
Sbjct: 781 GKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLKEKEL 840

Query: 839 LHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGL 898
             ++LPL+C+ L F+++SNH+EL SQKNEELK+Q+NR+KD LR ++++  DDLGFNIQGL
Sbjct: 841 ARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFNIQGL 900

Query: 899 KFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
            F++  WN+ HN++F+D+   + K    +KKR+F T 
Sbjct: 901 TFIKQQWNMKHNFEFSDDI-TVNKTNEKAKKRVFETL 936

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1290 bits (3339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/936 (63%), Positives = 757/936 (80%), Gaps = 3/936 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60
           MVKSYQRFEQA V GV+++NSNC+W+P++ +N+ GQV+TGALE V CW +K+G+LL T+ 
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETRNASGQVLTGALENVNCWSMKSGDLLSTLS 60

Query: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120
           DGLPPGA+D K+ KPAE T+LQYH ET +LA GY DG +KIWD+ +++VLI F+ H SAI
Sbjct: 61  DGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSAI 120

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDG 180
           T+L+FD TGTRLISGS+D+ II+WDLV E GL KLRSHKD+ITG+WCE +DWL+S SKDG
Sbjct: 121 TVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVSTSKDG 180

Query: 181 LIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEK 240
           LIK+WD+K  QCVETH+AH GECWS+ V +++V+T   +++IKLW +D E+P GSML E+
Sbjct: 181 LIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSMLTER 240

Query: 241 GSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEK 300
           G++EKQSKQR   + FTT++DG TFF+  N+D+T+E FR+R+E EI+KALKKREKR  +K
Sbjct: 241 GTHEKQSKQRGVSVEFTTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLSDK 300

Query: 301 GMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYS 360
           G++ EEIQ + + SY + ++HPFQ++RS +K+K++ W V T SKLE+V++T+NNT++YYS
Sbjct: 301 GLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDYYS 360

Query: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIR 420
           IPY KKEP  P+  K++SI+  GHRTD+RA DIS D+KLLATASNG+LK+WNIKTK+CIR
Sbjct: 361 IPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSCIR 420

Query: 421 NLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480
             +CGYAL CKFLPGGALV++GT+ G L LFDLASST+L +IE AH+ AIWSLDLT+DGK
Sbjct: 421 TFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGK 480

Query: 481 RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL 540
           RLVT SADK+V+FWDF+VEQELV GT DKFVPK+K+ HDTTL+L +D+  VKISP++R L
Sbjct: 481 RLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNRLL 540

Query: 541 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600
           A+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS DSKL+ITSSADKNIK+WGLDFGD
Sbjct: 541 AISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFGD 600

Query: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660
           CHKSLFAH DSIM V FLPESHNFFSC KDG VKYWDG+ F+CIQKL  HQ EVW +A+S
Sbjct: 601 CHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIAIS 660

Query: 661 SDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFISN- 719
            DG  VVS SHD+SIRVW ET+DQVF                   SLE G+GD  F  + 
Sbjct: 661 HDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHGDG 720

Query: 720 NGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KKLGDQP 778
           NG    G E+T+VHKQT ESLKA ERLMEA+D+G+ EI    +YEQ +K W  KK G  P
Sbjct: 721 NGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKKSGPHP 780

Query: 779 TKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVI 838
            +PQ N+IL A++KTP  Y+M+ L++IKPSQLEDALLVLPFSYVL+FL FI++ I++  +
Sbjct: 781 GRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIEDKSL 840

Query: 839 LHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGL 898
           + + LPLLCK L F++++NH+EL SQKNE+LK+QI+R+K  LR ++++  DDLGFNIQGL
Sbjct: 841 VRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNIQGL 900

Query: 899 KFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934
           KF++  WN+ HN++F+D+   ++K+    KKR+F T
Sbjct: 901 KFIKQQWNLKHNFEFSDDV-IISKQDKKVKKRVFET 935

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1283 bits (3319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/938 (66%), Positives = 765/938 (81%), Gaps = 4/938 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK--NSPGQVITGALEEVKCWEIKTGELLKT 58
           MVKSYQRFEQ+ VFGVV++  N +W+P++ K  N PGQ+ITGALE V  W+IKTGEL+  
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNGPGQIITGALENVNIWDIKTGELVSH 60

Query: 59  MRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSS 118
           + DGLPPGAID +  KPAE TY+QY+ +T +LAVGYADG IKIWDM ++TVL+ F+ H S
Sbjct: 61  LSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGHRS 120

Query: 119 AITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSK 178
           A+T L FD TGTRLISGSRD+ II+WDLV+E GL KLRSHKD+ITG+   +++WL+SVSK
Sbjct: 121 AVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSVSK 180

Query: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238
           DGLIKLWD+K+ QCVETH+AH GECW+L V +++V+T +++S+IK+W LDL+   G  + 
Sbjct: 181 DGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVKVT 240

Query: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298
           EKG +EKQSKQR   +SF TV+DGT FFY  N+DKT+EI R+R E EI++ALKKREKRFK
Sbjct: 241 EKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFK 300

Query: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358
           EKGM+DEEIQ++F+ SY ++++H FQ++RS FK++A+SW V T SKLEL +TT+ NTIEY
Sbjct: 301 EKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEY 360

Query: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418
           YSIPY+K+EP  PT I++HSIE  GHRTD+RA DIS D KLLATASNG LK+WNI+TKTC
Sbjct: 361 YSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTC 420

Query: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478
           +R  +CGYAL CKFLPGG LVI+GTR+GQLQLFDLASST+LEN EEAH AAIWSLD+TSD
Sbjct: 421 LRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSD 480

Query: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538
           G+RLVT SADKTVKFW+F VE++ V GT DK +P M L HDTTL++ +D+  VKISPE++
Sbjct: 481 GRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENK 540

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
            LAVSLLDNTVKVF+L++MKFFLSLYGHKLPVLS+DIS DSKLIITSSADKNIKIWGLDF
Sbjct: 541 LLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658
           GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKD TVKYWDG+ F+ IQKL GHQ EVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALA 660

Query: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFIS 718
           V+  G  V+SVSHD SIRVWEET+DQVF                   SLE GSGD AF  
Sbjct: 661 VARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAF-K 719

Query: 719 NNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLW-NKKLGDQ 777
            +  +    ++ +VHKQT+ESLKAGERLMEA+DLGI EI+AWE YE++++LW  KK G +
Sbjct: 720 QDEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKKQGVE 779

Query: 778 PTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDV 837
           P +PQ NAIL A++K PE Y+M+TL +IKPSQLEDALL LPFSYVLKFLKF+D  +++  
Sbjct: 780 PERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKK 839

Query: 838 ILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQG 897
           +LH  L L+CK L F+V+SNH+ELVSQKNEELK +I RVK++LR AL+++ DDLGFNI+G
Sbjct: 840 LLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEG 899

Query: 898 LKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           LKF++  WN+ HNY+F DE+DQ  + +  +KKR+F T 
Sbjct: 900 LKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETL 937

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1282 bits (3318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/938 (65%), Positives = 756/938 (80%), Gaps = 5/938 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQ--AKNSPGQVITGALEEVKCWEIKTGELLKT 58
           MVKSYQRFEQ  VFGV+T N+NCVWLPS    K++ GQV+TGALE +  W+IKTGELL  
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60

Query: 59  MRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSS 118
           + DGLPPG+ID K+ KPAE TYL+YH+ET +LA GYADG IKIWD+ ++TVL+ F  H S
Sbjct: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120

Query: 119 AITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSK 178
            +TIL+FD TGTRL+SGSRD+ II+WDLV+E G+ KLRSHKDAITGIWCE +DWL+S +K
Sbjct: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180

Query: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238
           DGLIKLWD+K  QCVETH+A TGECW+L V  ++V+T   +S+IK+W LD  + NGS ++
Sbjct: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240

Query: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298
           EKG+YEKQSKQR   ++F T AD TTF Y  NSDKT+EIFRIR + EI++ALKKREKR K
Sbjct: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300

Query: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358
           EKG +DE+IQ+ F ++Y +L+L PFQ+++S +K+KA SWTV   SK+ELV+TT++NTIEY
Sbjct: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360

Query: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418
           YSIPY+K+ P  P+  KL++IE  GHRTD+R+ DIS D+KLLA+ASNG LK+WN+KTK+C
Sbjct: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKSC 420

Query: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478
           IR  DCGYAL CKFLP G L ++GTR GQ+QLFDL +ST++E+I+ AH AAIWSLD+T D
Sbjct: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480

Query: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538
           GKRLVT SADK++KFW+F +EQ+LV GT DKFVP MKLIHDTTL+L +D+  VKISPED+
Sbjct: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
           +LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS DSKLIITSSADKNIKIWGLDF
Sbjct: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658
           GDCHKSLFAHQDSIMNV FLPESHNFFS SKDG VKYWDG+ F+C+QKL  HQ EVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660

Query: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFIS 718
           ++SDG  VVS SHD S+RVW+ET+DQVF                   SLE GSGD AF +
Sbjct: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFKA 720

Query: 719 NNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLW-NKKLGDQ 777
           +  D     EST V  QT+ESLK+GERLMEAL+LG +EI+A EKY +  K W  KK G+ 
Sbjct: 721 DIEDGMD--ESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEP 778

Query: 778 PTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDV 837
           P KPQ NAIL A+++ P+ Y+M+TL KIKPSQLEDALLVLPFSYVL+FLKFIDI + +  
Sbjct: 779 PVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPE 838

Query: 838 ILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQG 897
           IL  +L L+CK L  +V++NHKEL+SQ+N+ LK QI  VK++LR +L+++VDDLGFNIQG
Sbjct: 839 ILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQG 898

Query: 898 LKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           LKF++  WN+ HNY+F DE DQ  +E+ +SKKR+F T 
Sbjct: 899 LKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTL 936

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1269 bits (3283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/940 (63%), Positives = 743/940 (79%), Gaps = 6/940 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSP----GQVITGALEEVKCWEIKTGELL 56
           MVKSYQRFEQA+VFGV+++NSN VW+  +A        GQVI G LE +  W+IKTGE +
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
             + DGLPPGA D K  KPAE T+L+YH ET +LA GYADG IKIWD+ ++TVLI F+ H
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176
            SAIT+L FD TGTRLIS S+D+ II+WDLV E+GL KLRSHKDAITG+WCE+++WLIS 
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSM 236
           SKDGL+K+WD+K  QCVETH+AHTGECWSL + ++M +T +A+S++KLW+LDL+  NGS 
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240

Query: 237 LLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKR 296
           L EKG  EKQSKQR  E+ F    DG  FFY  N+DKT+EI+R+R E EI++ALKKREKR
Sbjct: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

Query: 297 FKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTI 356
            ++KGMS+EEI+E+   S  +L+ H FQ+VRS +K+K++ WTVC+ SKLELV+TT+NN+I
Sbjct: 301 LQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359

Query: 357 EYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTK 416
           EYYSIPY K+EP QP  +KLH+I+  G RTD+R+  IS D+KLLATASNG+LK+WNIKTK
Sbjct: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419

Query: 417 TCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLT 476
            CIR+ +CGYAL CKFLPGGALV++GTR G+LQLFD+ASSTML+N E AH AAIWSLDLT
Sbjct: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479

Query: 477 SDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPE 536
           SDG++LVT SADKTV+FW F+V +  V+   +K +P ++L HDTTL+L +D+  V ISP+
Sbjct: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539

Query: 537 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596
           D+F+AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS+DSKLI+T SADKNIKIWGL
Sbjct: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

Query: 597 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWA 656
           DFGDCHKSLFAHQDSIMNVKFLPES+NFFSCSKD TVKYWDG  F+CIQKL  HQ EVW+
Sbjct: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659

Query: 657 LAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAF 716
           ++VS+DG  V+S  HD SIRVWEETEDQVF                   SLEGG+GD+  
Sbjct: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719

Query: 717 ISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNK-KLG 775
               GD     E   VHKQT+ESLKAGERLMEAL++G+ +I A E++ +Q+  W K K G
Sbjct: 720 SVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKG 779

Query: 776 DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKN 835
            QP +PQ N +L AL KTPE Y++ETL KIKPSQ+EDAL+V+PFSY+LKFLKFID+    
Sbjct: 780 IQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTK 839

Query: 836 DVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNI 895
             +L K + L+CK L FV+R N+KELV+QKN  LK+QI RVKD LR +L+S+VD+LGFNI
Sbjct: 840 AALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNI 899

Query: 896 QGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           +G+KF++  W +NH+ +FNDEY++   E+ HSKKR+F T 
Sbjct: 900 EGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1255 bits (3247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/935 (63%), Positives = 750/935 (80%), Gaps = 10/935 (1%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSP--GQVITGALEEVKCWEIKTGELLKT 58
           MVKSYQRFEQ+ VFGV+++NSNCVW+P  +K S   G+VITGALE +  W++KT EL   
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKSLGKVITGALENISVWDLKTSELEYV 60

Query: 59  MRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSS 118
           + DGLPPG++D K+ KPAE +YLQ+H ET ++A GYADG IK+WD+ ++TVL+ F+ H S
Sbjct: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120

Query: 119 AITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSK 178
            IT+L+FD+TGT+LISGS D+ II+WDLV+E GL KLRSHK  ITG+WC++D+WLIS SK
Sbjct: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180

Query: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238
           DGLIK+WD+K  QC+ETH+AHTGECW+L +  + V+T++A+S++K+W++DLE   GS L+
Sbjct: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240

Query: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298
           EKG++EKQSKQR   + FTT +DG  FFY  N+DKT+EIFR+R + EIAKA+K+REKR  
Sbjct: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300

Query: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358
           EKGM++E+I+ +   SY + ++HPFQ+VRS++K+K+ +WT+   +KLE+V+TT +NTIEY
Sbjct: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360

Query: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418
           YS+PY+K++P  PT IK H+IE  G RTD+R+ DIS D+ LLATASNG LK+WN+ TK+C
Sbjct: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420

Query: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478
           IR  +CGYAL CKFLPGG LV++GTR G LQLFDLASS +L  IE AH  AIWSLD+T+D
Sbjct: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480

Query: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538
           GKRLVT SADK++KFWDF+V+QEL+AGT DK+VP+M ++HD+TL+LG+D+  +KIS +D+
Sbjct: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
           FLA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600

Query: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658
           GDCHKSLFAHQDSIM VKFLP SHNFFS SKDG VKYWDG+ F+CIQKL  HQ EVWALA
Sbjct: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660

Query: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAF-- 716
           VS +G+ VVSVSHD SIR+WEET+DQVF                   SLE G+ DD F  
Sbjct: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTFKG 720

Query: 717 -ISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKLG 775
            + N+ D+    E+T V KQTIESLKAGERLM+ALDLGI EI+  E YE +M  + KK  
Sbjct: 721 DVKNDEDD----EATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQR 776

Query: 776 -DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIK 834
            D P KP  NAIL A+ KTP  Y+M+TL  IKPSQLED+LLVLPFSYVLKFLKF D  +K
Sbjct: 777 IDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMK 836

Query: 835 NDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFN 894
              IL+ +L L+CK L F+++SN KELVSQKNEELK+QI+RVK QLR+AL+++ DDLGFN
Sbjct: 837 VPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFN 896

Query: 895 IQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKK 929
           IQGLKF++  WN+ HN++F D+YDQ A+ +  +KK
Sbjct: 897 IQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1244 bits (3218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/940 (64%), Positives = 750/940 (79%), Gaps = 10/940 (1%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60
           MVKSYQRFEQ  VFGV+++NSN VW+P+   N PG +IT ALE +  W+IKTGEL+  + 
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIPN--GNGPGNIITSALENINIWDIKTGELVNQLT 58

Query: 61  DGLPP-GAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
           DGLPP G+ID+K  KPA  TY +YHE+T +LA GY+DG IK+WD+ ++T+L+ F+ H SA
Sbjct: 59  DGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHKSA 118

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-DWLISVSK 178
           ITIL FD TGTRLISGS D+ II+WDLV+E GL KLRSHKD ITGIWC +D +WLIS SK
Sbjct: 119 ITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLISTSK 178

Query: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLE-RPNGSML 237
           DGLIK+WD+K+ QCVETH+AHTGECWSL + +++V+T +AES++K W+LDLE +PNGS L
Sbjct: 179 DGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPNGSKL 238

Query: 238 LEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKR 296
           +EKG +EKQSKQR   + F T+  D  +FF+  N+DKT+EIFRIR + EI KALKKREKR
Sbjct: 239 VEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKREKR 298

Query: 297 FKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTI 356
            KEKGM+D+EI ++   ++ + L+HPFQ VRS +K+K+  WT  T SKLELV+TT++NTI
Sbjct: 299 LKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSNTI 358

Query: 357 EYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTK 416
           EYYS+ Y K+ P  P+  K+H+IE  G RTD+R+  IS D+KLLATASNG LK+WN+KT 
Sbjct: 359 EYYSVTYAKRIPQPPS--KIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLKTH 416

Query: 417 TCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLT 476
            CIR  +CGYALCCKFLPGG LVI+GTR G+LQLFDLASST LENIE+AH AAIWSLD+T
Sbjct: 417 KCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLDIT 476

Query: 477 SDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPE 536
           SDGKRL+T SADKTVKFWDFK++Q+ V GT D ++P +KL HDTTL++GED+ CV++SP+
Sbjct: 477 SDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLSPD 536

Query: 537 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596
           D+FLAVSLLD TVK+FFLDSMKFFLSLYGHKLPVLS+DIS DSKLIITSSADKNIKIWGL
Sbjct: 537 DKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 596

Query: 597 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWA 656
           DFGDCHKSLFAH DSIMNVKFL  SHNFFSCSKDGT+KYWDG+ F+CIQKL  HQ EVW+
Sbjct: 597 DFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEVWS 656

Query: 657 LAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAF 716
           +A++ D   VVS SHD S+R+WEETEDQVF                   SLE G+GD AF
Sbjct: 657 IAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDSAF 716

Query: 717 ISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKL-- 774
            S+        E+T+VHKQT ESLKAGERLMEALDLGI EI+  E Y + ++LW KK   
Sbjct: 717 KSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKKKKIG 776

Query: 775 GDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIK 834
           GD P KPQ NAIL A++KTPE Y++ETL KIKPSQLEDA+LV PFSYVLKFLKFIDI + 
Sbjct: 777 GDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFIDIVLN 836

Query: 835 NDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFN 894
           +  +L+  L L+CK L FV++SNHKEL+SQKNE+LK+Q++RVKD+LR ALR + DDLG+N
Sbjct: 837 DPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDDLGYN 896

Query: 895 IQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934
           IQGLKF++  WN+ HN++FNDE DQ  +E    KKR+F T
Sbjct: 897 IQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGT 936

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/942 (64%), Positives = 746/942 (79%), Gaps = 8/942 (0%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLP---SQAKNSPGQVITGALEEVKCWEIKTGELLK 57
           MVKSYQRFEQ+ VFGV+++ +N VWLP    ++  SPGQ+IT ALE V  W+IKTGEL+ 
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGSPGQIITSALENVNIWDIKTGELIA 60

Query: 58  TMRDGLPPGAIDTKAE-KPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116
            ++DG+ PG+ D+K   KPAE T+LQYH ++ +LAVGY DG IK+WD+ ++TVLI  + H
Sbjct: 61  QLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNGH 120

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-DWLIS 175
            S+IT+L+FD   TRL+SGS D+ II+WDLV+E G+CKLRSHKD I+ ++ ++D +WL+S
Sbjct: 121 KSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLLS 180

Query: 176 VSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGS 235
           VSKDGLIK+WD+K +QCVETH+AHTGECWSL +KD++VIT +  S+IKLW LDL+   GS
Sbjct: 181 VSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEVGS 240

Query: 236 MLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREK 295
            L+EKG YEKQSKQR T + F   + G  FF   N+DKT+EIFRIR + EI +ALKKREK
Sbjct: 241 KLIEKGVYEKQSKQRGTSVKFIENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREK 300

Query: 296 RFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNT 355
           R KEKGM DE+IQ++ + S+ + ++H FQ VRS FKLK+ SWT  T SKLELV TT++NT
Sbjct: 301 RLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNT 360

Query: 356 IEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKT 415
           IEYY+I Y+K+EP QP   +L++IE  G RTD+RA DIS D+ LLATASNG LK+WN++T
Sbjct: 361 IEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRT 420

Query: 416 KTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDL 475
           K CIR  DCGYAL CKFLPGG LVILGTR G+LQLFDLASST +ENIE AH AAIWSLDL
Sbjct: 421 KQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDL 480

Query: 476 TSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISP 535
           TS+GKRLVT SADKTVKFWDF++EQ  + GT  K   K+ L HDTTL+L +D+ CVKISP
Sbjct: 481 TSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISP 540

Query: 536 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           ED+ LAVSLLDNTVK+FFLD+MKFFLSLYGHKLPVLS+DIS DSK++ITSSADKNIKIWG
Sbjct: 541 EDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWG 600

Query: 596 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVW 655
           LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDG VKYWDG+ F+C+QKL  HQ EVW
Sbjct: 601 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVW 660

Query: 656 ALAVSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDA 715
            LA+  DG  VVS SHD SIR+W+ETEDQVF                   SLE G+GDDA
Sbjct: 661 CLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDA 720

Query: 716 FISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLW-NKKL 774
           F  ++ D   G E+T+VHKQTIESLKA E+LM+ALDLG+TEI+A E+Y   M LW  KK+
Sbjct: 721 FKKDSVD-GEGDEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKKI 779

Query: 775 GDQ-PTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833
           G + P KP  NA+L A+ K+PE Y+METL++IKPSQLEDALL+LPFSYVLKFLKFIDI +
Sbjct: 780 GSEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIVL 839

Query: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893
           KN  +LH  L L+CK L F+VR+NHKEL+SQKNEELK+QI RVK +LR  L+ + D LGF
Sbjct: 840 KNKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALGF 899

Query: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935
           NIQGLKF++  W++ HN++F DEYDQ  +E+  +KKR+F T 
Sbjct: 900 NIQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETL 941

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1163 bits (3009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/939 (59%), Positives = 720/939 (76%), Gaps = 10/939 (1%)

Query: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEEVKCWEIKTGELLKTMR 60
           MVKSYQRFEQ+ +FG+++ ++  ++LP+   ++ G++ITGALE ++ W +KT E+ + + 
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPA-TNSTSGKLITGALENIQIWTLKTNEV-EVLT 58

Query: 61  DGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI 120
           DGLP GA++T   KP+  T + +H+ET +L VGY DG IK+WD+ +++VL+ F+ H S +
Sbjct: 59  DGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGV 118

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCE-NDDWLISVSKD 179
           T+LR D  GTRL+SGS+D+ +I+WDLV E GL KLRSHKDAITGIW + N DWLISV+KD
Sbjct: 119 TVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVAKD 178

Query: 180 GLIKLWDMKVH-QCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238
           GLIK+WD+K   QCVETHMAHTG+CWS+A+ + ++IT + +S+ K+WELDLE+ NG  + 
Sbjct: 179 GLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSNGEKIS 238

Query: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298
           E+G++E +SKQR     F T  +GT FFY  N+DKT+EIFRIR E EI KAL +REKR +
Sbjct: 239 ERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKRLR 298

Query: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358
           +KG S+EEIQE+   +  ++L H F  VRS +K+K+S+W   + SKLE+V+TT+NNTIE 
Sbjct: 299 DKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTIES 358

Query: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418
           Y IPY K++   P  ++ +++E  GHRTD+R+ DIS D KLL+TASNG LKVWN+ TK C
Sbjct: 359 YQIPYSKRDAEPP--VRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKC 416

Query: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478
           IR   CGYALC + LPGG LV++GTR G+LQLFDLASST+L   E AHTAAIWSLDLTS+
Sbjct: 417 IRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWSLDLTSN 475

Query: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538
           GKRLVT SADK+ KFWDF+V ++LV GT DK++P++KL+HDTTL+L +D+  VKIS EDR
Sbjct: 476 GKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDR 535

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
           +LAVSLLDNTVKVFF DS+KF+LSLYGHKLPVLS+D S DSK++ITSSADKNIKIWG+DF
Sbjct: 536 YLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDF 595

Query: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658
           GDCHKS+FAHQDSIM+V+F  ++HNFFSC KDG VK WDG+ FDCIQKL GHQ EVW +A
Sbjct: 596 GDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIA 655

Query: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFXXXXXXXXXXXXXXXXXXXSLEGGSGDDAFI- 717
           VS DG+ VVS SHD SIRVW+ET+DQVF                   SLEGGSGDD F+ 
Sbjct: 656 VSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQFLR 715

Query: 718 -SNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYE-QQMKLWNKKLG 775
             N+GD+    E + V+KQT+ESLKAGE+LMEALDLG+ EI++WE YE        KK G
Sbjct: 716 DKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKKKKSG 775

Query: 776 DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKN 835
           + P KPQ+NAIL A+   PE Y+M+TL KIKPSQLED+LLVLPFSYV+KF KF D+ +K 
Sbjct: 776 EPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVIMKQ 835

Query: 836 DVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNI 895
             ++   L L+CKIL F+VR+N+KELV+QKNEELK +I RVK  +R  L+ + DDLGFNI
Sbjct: 836 KDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLGFNI 895

Query: 896 QGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934
            GL F++  WN+ HN +F D+Y QL  EK  +KKR+F T
Sbjct: 896 AGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFET 934

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 162/683 (23%), Positives = 278/683 (40%), Gaps = 145/683 (21%)

Query: 35  GQVIT--GALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92
           GQ +T     + +K +++KTG+++++M+   P   +DT +              + +LAV
Sbjct: 73  GQYLTYVSQAQLLKIFQLKTGKVVRSMKISSPSYILDTDST-------------STLLAV 119

Query: 93  GYADGTIKIWDMQTQTVLIVFHSHSSAITILRF----DQTGTRLISGSRDATIILWDLVA 148
           G  DG+I + D++   +      H   I+ L+F    D     L SG  +  + +WDLV 
Sbjct: 120 GGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVK 179

Query: 149 ETGLCKLRSHKDAITGI---WCENDDW-----LISVSKDGLIKLWD------------MK 188
              L  L+ H  A+ G+     EN+D      LIS  +D ++  WD            + 
Sbjct: 180 RKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKKCKLIKTLP 239

Query: 189 VHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSK 248
           V+Q VE+       C  L  +D   I   A  +     +DLE  +GSML       K++ 
Sbjct: 240 VNQQVES-------CGFLNTRDGKHIIYTAGGDAIFQLIDLE--SGSML-------KRTN 283

Query: 249 QRCTELSFTTV----ADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSD 304
           +   EL    V    +D   F   + SD+T+++  I       +AL+ +E          
Sbjct: 284 KPIEELYIIGVLPIMSDSKMFL--VMSDQTLQLINIE------EALESKE---------- 325

Query: 305 EEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYSIP-Y 363
           E IQ     +  + ++   + V               P   +L + T +  +    IP  
Sbjct: 326 EIIQAESSIAGNHGIIADMRFV--------------GPELNKLALATNSPALRIIPIPDL 371

Query: 364 KKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLK-VWNIKTKTCIRNL 422
              E   P  ++++     GH   L + D + D   +ATAS  N   VW     T     
Sbjct: 372 TSTESSLPLDVEIYE----GHEDLLNSLDATEDGLWIATASKDNSAIVWKYNNDT----- 422

Query: 423 DCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR- 481
                                       FD+ +  +       H++A+ ++ L +   + 
Sbjct: 423 --------------------------SKFDIYAKYI------GHSSAVTAVGLPNVMPKG 450

Query: 482 ----LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED 537
               L+TAS D T+K W      ++   T    V  +K+   T     +D+  + +SP D
Sbjct: 451 YPEFLLTASNDLTIKKW------KIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPND 504

Query: 538 RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLD 597
              A +  D T K++ L++ +   +L  HK  +  +      KL+ T S DK +KIW L+
Sbjct: 505 SIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLE 564

Query: 598 FGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWAL 657
                K+L  H +++    F+ +     SC  DG +K WD  S +C++ L GH   +WAL
Sbjct: 565 TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWAL 624

Query: 658 AVSSDGQAVVSVSHDRSIRVWEE 680
              +DG  +VS   D   + W++
Sbjct: 625 NTMNDGDTIVSADADGIFQFWKD 647

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 99/227 (43%), Gaps = 7/227 (3%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           I A    D T KIW+++   +     +H   +  + F Q    L + S D T+ +W L  
Sbjct: 506 IFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLET 565

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
            + +  L  H +A+    +      L+S   DGLIK+WD    +C++T   H    W+L 
Sbjct: 566 FSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALN 625

Query: 208 VKD--NMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGT-T 264
             +  + +++A+A+   + W+   +        E    + Q +Q  +  ++ +  D T  
Sbjct: 626 TMNDGDTIVSADADGIFQFWK---DCTEQEKEEELEKTKIQVEQEQSLQNYMSQGDWTNA 682

Query: 265 FFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESF 311
           F  +++ D  M +F +  ++      +K  K    K + +EE+  + 
Sbjct: 683 FLLAMSLDHPMRLFNVLKKSLGESRSRKGGKESDSKVIFNEELDHAI 729

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 77/176 (43%), Gaps = 12/176 (6%)

Query: 515 KLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           K++H  + +  +++  ++++P+ ++L        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILD 109

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSCSKD 630
               S L+     D +I +  ++ G    SL  H  +I ++KF  +  +      S   +
Sbjct: 110 TDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTN 169

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAVS----SDGQA---VVSVSHDRSIRVWE 679
           G VK WD     C+  L  H   V  L ++    +DG +   ++S   D  +  W+
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWD 225

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 153/671 (22%), Positives = 276/671 (41%), Gaps = 144/671 (21%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +K + +KTG+++++M+   P   +D      A++T       + +LAVG  DG+I + D+
Sbjct: 85  LKIFHLKTGKVVRSMKISSPSYILD------ADST-------STLLAVGGTDGSIIVVDI 131

Query: 105 QTQTVLIVFHSHSSAITILRF-DQTGTR---LISGSRDATIILWDLVAETGLCKLRSHKD 160
           +   +   F  H   I+ L+F  Q  ++   L SG  +  + +WDLV    L  L+ H  
Sbjct: 132 ENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTS 191

Query: 161 AITGI----WCENDDW---LISVSKDGLIKLWDMK------------VHQCVETHMAHTG 201
           A+ G+      +ND+    L+S  +D +I LWD              V+Q VE+      
Sbjct: 192 AVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVNQQVES------ 245

Query: 202 ECWSLAVKDN--MVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTEL---SF 256
            C  L   D   ++ TA  ++  +L +            E GS  K++ +   EL     
Sbjct: 246 -CGFLKDGDGKRIIYTAGGDAIFQLID-----------SESGSVLKRTNKPIEELFIIGV 293

Query: 257 TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYA 316
             +   +  F  L SD+T+++  +  +      LK  E           ++  S   ++ 
Sbjct: 294 LPILSNSQMFLVL-SDQTLQLINVEED------LKNDEDTI--------QVTSSIAGNHG 338

Query: 317 NLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYSIP-YKKKEPLQPTAIK 375
            +                +      P   +L + T + ++    +P     E   P  ++
Sbjct: 339 II----------------ADMRYVGPELNKLALATNSPSLRIIPVPDLSGPEASLPLDVE 382

Query: 376 LHSIESPGHRTDLRAADISSDDKLLATASNGNLK-VWNIKTKTCIRNLDCGYALCCKFLP 434
           ++     GH   L + D + D   +ATAS  N   VW     +      C + +  K++ 
Sbjct: 383 IYE----GHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENS------CKFDIYAKYI- 431

Query: 435 GGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSL---DLTSDG--KRLVTASADK 489
                                          H+AA+ ++   ++ S G  + L+TAS D 
Sbjct: 432 ------------------------------GHSAAVTAVGLPNIVSKGYPEFLLTASNDL 461

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTV 549
           T+K W        +   + K     +  H+      +D+  + +SP D   A +  D T 
Sbjct: 462 TIKKWIIPKPTASMDVQIIKVSEYTRHAHE------KDINALSVSPNDSIFATASYDKTC 515

Query: 550 KVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQ 609
           K++ L++ +   +L  HK  +  +      KL+ TSS DK +KIW LD     K+L  H 
Sbjct: 516 KIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHT 575

Query: 610 DSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSV 669
           +++    F+ +     SC  DG +K WD +S +C++ L GH   +WAL+  +DG  +VS 
Sbjct: 576 NAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSA 635

Query: 670 SHDRSIRVWEE 680
             D   + W++
Sbjct: 636 DADGVFQFWKD 646

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 111/253 (43%), Gaps = 24/253 (9%)

Query: 64  PPGAIDTKAEKPAEATYLQYHEETF----------ILAVGYADGTIKIWDMQTQTVLIVF 113
           P  ++D +  K +E T    HE+            I A    D T KIW+++   +    
Sbjct: 471 PTASMDVQIIKVSEYTR-HAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATL 529

Query: 114 HSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDW 172
            +H   +  + F Q    L + S D T+ +W L   + +  L  H +A+    +      
Sbjct: 530 ANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQ 589

Query: 173 LISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKD--NMVITANAESEIKLWELDLE 230
           LIS   DGLIK+WD    +C++T   H    W+L+  +  +M+++A+A+   + W+ D  
Sbjct: 590 LISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK-DCT 648

Query: 231 RPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTT-FFYSLNSDKTMEIFRIRSETEIAKA 289
                   EK   + + +Q     ++ +  D T  F  ++  D  M +F +     + +A
Sbjct: 649 EQEIEEEQEKAKLQVEQEQSLQ--NYMSKGDWTNAFLLAMTLDHPMRLFNV-----LKRA 701

Query: 290 L-KKREKRFKEKG 301
           L + R ++  E+G
Sbjct: 702 LGESRSRQDTEEG 714

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 65/149 (43%), Gaps = 5/149 (3%)

Query: 515 KLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           K++H  + +  +++  +K++P+ ++L        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISS-PSYILD 109

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSCSKD 630
               S L+     D +I +  ++ G    S   H  +I ++KF  + ++      S   +
Sbjct: 110 ADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTN 169

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAV 659
           G VK WD     C+  L  H   V  L +
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 150/673 (22%), Positives = 273/673 (40%), Gaps = 148/673 (21%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +K +++KTG ++++++   P   +DT                + +LAVG  DG+I I D+
Sbjct: 85  LKIFQLKTGRIVRSLKISSPSYILDTDPT-------------STLLAVGGTDGSIVIVDI 131

Query: 105 QTQTVLIVFHSHSSAITILRF----DQTGTRLISGSRDATIILWDLVAETGLCKLRSHKD 160
           +   +      H   I+ L+F    D     L SG  +  + +WDLV    L  L+ H  
Sbjct: 132 ENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSS 191

Query: 161 AITG---IWCENDDW----LISVSKDGLIKLWD------------MKVHQCVETHMAHTG 201
           A+ G   I  E+ D     L+S  +D ++ +WD            + V+Q VE+      
Sbjct: 192 AVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKKCKLVKTLPVNQQVES------ 245

Query: 202 ECWSLAVKDN--MVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTEL---SF 256
            C  L   D   ++ TA  ++  +L +L           E G+  K++ +   EL     
Sbjct: 246 -CGFLKNHDGKRIIYTAGGDAIFQLIDL-----------ESGTVLKRTNKPIEELFIIGV 293

Query: 257 TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYA 316
             + + +  F  + SD+T+++  I                  E+ + +E    + R++ A
Sbjct: 294 LPIMNDSEMFLVM-SDQTLQLINI------------------EEVLENENDTINARSTIA 334

Query: 317 --NLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYSIP-YKKKEPLQPTA 373
             N ++   + V               P   +L + T + ++    IP     +   P  
Sbjct: 335 GNNGIIADMRFV--------------GPELNKLALATNSPSLRIIPIPDLSGADASLPLD 380

Query: 374 IKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKV-WNIKTKTCIRNLDCGYALCCKF 432
           ++++     GH   L + D + D   +ATAS  N  + W    +T               
Sbjct: 381 VEIYE----GHEDLLNSLDATEDGLWIATASKDNTAILWKYNERT--------------- 421

Query: 433 LPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR-----LVTASA 487
                             FD+ +  +       H++A+ ++ L +   +     L+TAS 
Sbjct: 422 ----------------SKFDIYAKYI------GHSSAVTAVGLPNVMPKGYPEFLLTASN 459

Query: 488 DKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDN 547
           D T+K W       ++   + K     +  H+      +D+  + +SP D   A +  D 
Sbjct: 460 DLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHE------KDINALSVSPNDSIFATASYDK 513

Query: 548 TVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFA 607
           T K++ L++ +   +L  HK  +  +      KL+ TSS DK +KIW LD     K+L  
Sbjct: 514 TCKIWSLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEG 573

Query: 608 HQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVV 667
           H +++    F+ +     SC  DG +K WD +S +C+  L GH   +WAL   +DG  +V
Sbjct: 574 HSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDGDMIV 633

Query: 668 SVSHDRSIRVWEE 680
           S   D   + W++
Sbjct: 634 SADADGVFQFWKD 646

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 79/175 (45%), Gaps = 11/175 (6%)

Query: 515 KLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           K++H  + +  +++  ++++P+ ++LA       +K+F L + +   SL     P   +D
Sbjct: 51  KILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS-PSYILD 109

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE--SHNFFSCSKD-- 630
               S L+     D +I I  ++ G    SL  H  +I ++KF  +  S  +   S D  
Sbjct: 110 TDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTN 169

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAV----SSDGQA--VVSVSHDRSIRVWE 679
           G VK WD     C+  L  H   V  L +    S DG +  ++S   D  + VW+
Sbjct: 170 GMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWD 224

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 151/680 (22%), Positives = 269/680 (39%), Gaps = 136/680 (20%)

Query: 39  TGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGT 98
           T   + +K  E+ TG+++++M+   P   +D++A              + ++AVG  DG+
Sbjct: 108 TSQAQLLKIVEVATGKVMRSMKISSPSYIMDSEAT-------------STLVAVGGTDGS 154

Query: 99  IKIWDMQTQTVLIVFHSHSSAITILRFDQTGTR----LISGSRDATIILWDLVAETGLCK 154
           I + D++   V   F  H   I+ L+F          L SG  +  I +W+LV       
Sbjct: 155 IIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTRKCTHT 214

Query: 155 LRSHKDAITGIWCEN--DD------WLISVSKDGLIKLWDM------KVHQCVETHMAHT 200
           ++ H  A+ GI   +  DD       +IS  +D ++  W++      K+ Q +  H    
Sbjct: 215 VQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWELDNKKKCKLLQTIPAHQ-QV 273

Query: 201 GECWSLAVKD--NMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTEL---S 255
            +C  +A     N++ T+  ++ ++            + LEKGS  K+SK+   EL    
Sbjct: 274 EQCGFIASPGHKNLIYTSGGDAIMQF-----------ISLEKGSIVKKSKKPIEELFIIG 322

Query: 256 FTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSY 315
              ++ G     S+ SD+++    + S            K   E+ ++ E        + 
Sbjct: 323 VLPISQGEKLI-SVMSDQSLHYLDVESNL----------KATNEEELTYESALAGNHGTI 371

Query: 316 ANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYSIPYKKK----EPLQP 371
           A+++                      P    L + T + T+     P          L P
Sbjct: 372 ADMVF-------------------VGPKFQHLALATNSPTLRIIPTPLDDSTVDTNNLLP 412

Query: 372 TAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLK-VWNIKTKTCIRNLDCGYALCC 430
             + ++     GH   L A D + D   LATAS      VW    +T             
Sbjct: 413 IDVDMYE----GHEDLLNAVDATEDGLWLATASKDKTAIVWRYDDETA------------ 456

Query: 431 KFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR-----LVTA 485
           KF P    +                          H++++ ++ L +   R     L+TA
Sbjct: 457 KFKPYAKFI-------------------------GHSSSVTAVGLPNVMLRHWPEFLLTA 491

Query: 486 SADKTVKFWDFKVEQELVAGT-LDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSL 544
           S D T+K W+     + + G  L K     +  H+      +D+  + +SP D   A + 
Sbjct: 492 SNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHE------KDINALSVSPNDSVFATAS 545

Query: 545 LDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKS 604
            D T K++ L++ +   +L  HK  +  +      KL+ T S DK IKIW LD     ++
Sbjct: 546 YDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRT 605

Query: 605 LFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQ 664
           L  H +++    F+ +     S   DG +K WD +S +C++ L GH   +WAL +  DG+
Sbjct: 606 LEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTIQRDGE 665

Query: 665 AVVSVSHDRSIRVWEETEDQ 684
            + S   D   + W +  +Q
Sbjct: 666 LIASADADGVFQFWTDCSEQ 685

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 11/154 (7%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           + A    D T KIWD++T  +     +H   +  + F Q    L + S D TI +W L  
Sbjct: 540 VFATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDT 599

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
            + +  L  H +A+    +      L+S   DGLIK+WD    +CV+T   H    W+L 
Sbjct: 600 FSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALT 659

Query: 208 VKDN--MVITANAESEIKLW--------ELDLER 231
           ++ +  ++ +A+A+   + W        E DLER
Sbjct: 660 IQRDGELIASADADGVFQFWTDCSEQQREQDLER 693

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 64/133 (48%), Gaps = 14/133 (10%)

Query: 384 HRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLD--CGYALCCKFLPGGALVI 440
           H+  L        DKLLAT S +  +K+W++ T + +R L+        C F+     ++
Sbjct: 567 HKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLV 626

Query: 441 LGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFW------ 494
                G ++++D +S   ++ ++  H   IW+L +  DG+ + +A AD   +FW      
Sbjct: 627 SSGADGLIKIWDCSSGECVKTLD-GHANRIWALTIQRDGELIASADADGVFQFWTDCSEQ 685

Query: 495 ----DFKVEQELV 503
               D + E+ELV
Sbjct: 686 QREQDLEREKELV 698

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 152/640 (23%), Positives = 268/640 (41%), Gaps = 113/640 (17%)

Query: 70  TKAEKPAEATYLQYHEET-FILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF--D 126
           T++ K +  +Y+   + T  ++A+G  DG+I + D++   +   F  H   I+ L+F  +
Sbjct: 95  TRSMKISSPSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGE 154

Query: 127 QTGTR--LISGSRDATIILWDLVAETGLCKLRSHKDAITGI---WCENDDW--LISVSKD 179
             G +  L SG  +    +WDLV    L  ++ H  AI G+     E +D   L+S  +D
Sbjct: 155 LNGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRD 214

Query: 180 GLIKLW--DMKVH-QCVETHMAHTG-ECWSLAVKDNMVITANAESEIKLWELDLERPNGS 235
            ++ LW  +MK H + ++T   H   E      + ++V TA  E+ ++L           
Sbjct: 215 DIVNLWEFNMKKHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQL----------- 263

Query: 236 MLLEKGSYEKQSKQRCTELSFTTVA---DGTTFFYSLNSDKTMEIFRIRSETEIAKALKK 292
           + LE     K++++   EL    V     G  F+  L SD+T+++  +            
Sbjct: 264 ISLESQKVIKKTQKPIEELFIVGVLPILSGREFYLVL-SDQTLQLINM------------ 310

Query: 293 REKRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTA 352
                       EE   +F +   N+         ++  ++     V  P   ++ + T 
Sbjct: 311 ------------EEAISNFDDELINVASSIAGNHGTIADIR-----VVGPGLNKIALATN 353

Query: 353 NNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATAS-NGNLKVW 411
           +  +    IP   +  L P  ++++     GH   L + D + D   LAT S + +  +W
Sbjct: 354 SPALRIIPIPQTSENSL-PLDVEVYE----GHEDLLNSLDATEDGLWLATCSKDSSAILW 408

Query: 412 NIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIW 471
               +T             KF P                               H+A++ 
Sbjct: 409 RFNVETA------------KFFPYAKFT-------------------------GHSASVT 431

Query: 472 SLDLTSDGKR-----LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL-G 525
           ++ L +   R     L+TAS D TVK W  KV +       D    K     + T  +  
Sbjct: 432 AVALPNVMLRGWPEFLITASNDLTVKRW--KVPKPANEDISDLLTIKQS---EYTFHVHA 486

Query: 526 EDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITS 585
           +D+  + ++P D   A +  D T K++ +++ +   +L GHK  +  +      KL+ TS
Sbjct: 487 KDINALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATS 546

Query: 586 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQ 645
           S DK IKIW LD   C K+L  H +++    F+ +     S   DG +K WD  + DC++
Sbjct: 547 SGDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLK 606

Query: 646 KLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEE-TEDQ 684
            L GH   +WA+ V +DG  ++S   D   + W + TE+Q
Sbjct: 607 TLDGHGNRIWAMNVCNDGDLIISADADGVFQFWRDCTEEQ 646

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 65/141 (46%), Gaps = 13/141 (9%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W+++TGE   T+  G   G  D         ++ QY +   +LA    D TIKIW++ 
Sbjct: 511 KIWDVETGESKATLA-GHKRGLWD--------VSFCQYDK---LLATSSGDKTIKIWNLD 558

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI 165
           T + +     H++A+    F     +L+S   D  I +WD +    L  L  H + I  +
Sbjct: 559 TFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAM 618

Query: 166 -WCENDDWLISVSKDGLIKLW 185
             C + D +IS   DG+ + W
Sbjct: 619 NVCNDGDLIISADADGVFQFW 639

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 9/176 (5%)

Query: 512 PKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 571
           P  KL+H    D  +++  ++++P+ R+L        +K+F LDSMK   S+     P  
Sbjct: 47  PTQKLLHTIENDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS-PSY 105

Query: 572 SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSC 627
            MD    S LI     D +I +  ++ G    S   H  +I ++KF  E +       S 
Sbjct: 106 VMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLLASG 165

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWAL----AVSSDGQAVVSVSHDRSIRVWE 679
             +G  K WD     C+  +  H   +  L        D   ++S   D  + +WE
Sbjct: 166 DTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWE 221

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 146/624 (23%), Positives = 258/624 (41%), Gaps = 129/624 (20%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF-DQTGTR---LISGSRDATIILW 144
           ++A+G  DG+I + D++   +      H + I+ L+F  Q  +    L SG  +  + +W
Sbjct: 120 LVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVW 179

Query: 145 DLVAETGLCKLRSHKDAITGIWCE--NDDW-LISVSKDGLIKLWD------------MKV 189
           DLV    L  ++ H +A+ G+      D+W LIS  +D +  LW+            + V
Sbjct: 180 DLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTIPV 239

Query: 190 HQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQ 249
           HQ VE+      E       D+++ TA  ++ ++            + LEK +  K++K+
Sbjct: 240 HQQVESCGFINHE------HDDLIYTAGGDALLQF-----------ISLEKATMIKKTKK 282

Query: 250 RCTELSFTTVAD--GTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEI 307
              EL    V         Y + SD+T+E+  I+S                         
Sbjct: 283 HIEELFIIGVLPILENDKMYLVMSDQTLELVDIKS------------------------- 317

Query: 308 QESFRNSYANLLLHPFQLVRSLFKLKASSWTVC-----TPSKLELVITTANNTIEYYSIP 362
                    NLL     ++     +  ++ T+       P+  +L + T + T+    +P
Sbjct: 318 ---------NLLNESSDIIEIESCIAGNNGTIADMKFVGPNHDKLALATNSPTLRIIPVP 368

Query: 363 YKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLK-VWNIKTKTCIRN 421
             ++E L P  ++++     GH   L + D + D   +ATAS  +   VW          
Sbjct: 369 SSEQEEL-PINVEMYE----GHEDLLNSLDTTDDGLWMATASKDHTAIVWKYN------- 416

Query: 422 LDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR 481
                ++  KF P    +                          H+A + ++ L +   R
Sbjct: 417 -----SIINKFQPYVKFI-------------------------GHSATVTAVGLPNVMLR 446

Query: 482 -----LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPE 536
                L+TAS D T+K W  K+ +   + T+++    +K+   T     +D+  + ISP 
Sbjct: 447 GYPEFLLTASNDLTIKKW--KIPKP--STTVEEDCQIVKVSEYTRRAHEKDINALAISPN 502

Query: 537 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596
           D   A +  D T K++ L++ +   +L  HK  +  +      KLI T S DK IKIW L
Sbjct: 503 DSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSL 562

Query: 597 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWA 656
           D     K+L  H +++    F+ +     S   DG +K WD ++ DC++ L GH   +WA
Sbjct: 563 DTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWA 622

Query: 657 LAVSSDGQAVVSVSHDRSIRVWEE 680
           L   +DG  +VS   D   + W++
Sbjct: 623 LTEINDGDMIVSADADGVFQFWKD 646

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 101/219 (46%), Gaps = 16/219 (7%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           I A    D T KIWD++   +     +H   +  + F Q    + + S D TI +W L  
Sbjct: 505 IFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDT 564

Query: 149 ETGLCKLRSHKDAITGIWCENDDW-LISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
            + +  L  H +A+      N    L+S   DGLIK+WD     C++T   H    W+L 
Sbjct: 565 FSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALT 624

Query: 208 -VKD-NMVITANAESEIKLWE--LDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGT 263
            + D +M+++A+A+   + W+   +LE+     L ++   ++Q+ +     ++    D T
Sbjct: 625 EINDGDMIVSADADGVFQFWKDCTELEKEQNLELEKEKVEKEQTLK-----NYLLNEDWT 679

Query: 264 T-FFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKG 301
             F  +L  D  M +F +     + ++L  R+   +E+G
Sbjct: 680 NAFLLALTLDHPMRVFNV-----LKQSLNARKAGSEEQG 713

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 102/495 (20%), Positives = 196/495 (39%), Gaps = 87/495 (17%)

Query: 80  YLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGT--RLISGSR 137
           + Q +   ++L  G  +G +K+WD+  +  L     HS+A+  L   + G   +LISG R
Sbjct: 157 FGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGR 216

Query: 138 DATIILWDLVAETGLCKLRS---HK--DAITGIWCENDDWLISVSKDGLIKLWDMKVHQC 192
           D    LW+   +     L++   H+  ++   I  E+DD + +   D L++   ++    
Sbjct: 217 DNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISLEKATM 276

Query: 193 VETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCT 252
           ++    H  E + + V   + I  N +  + + +  LE  +    L   S +    + C 
Sbjct: 277 IKKTKKHIEELFIIGV---LPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIEIESCI 333

Query: 253 ELSFTTVADGTTFFYSLNSDK--------TMEIFRIRSETE-----IAKALKKREKRFKE 299
             +  T+AD    F   N DK        T+ I  + S  +       +  +  E     
Sbjct: 334 AGNNGTIADMK--FVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHEDLLNS 391

Query: 300 KGMSDEEI--QESFRNSYA-----NLLLHPFQLVRSLFKLKASSWTVCTPSKL-----EL 347
              +D+ +    + ++  A     N +++ FQ         A+   V  P+ +     E 
Sbjct: 392 LDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYPEF 451

Query: 348 VITTANN-TIEYYSIPYKKKEPLQPTAI-KLHSIESPGHRTDLRAADISSDDKLLATAS- 404
           ++T +N+ TI+ + IP       +   I K+       H  D+ A  IS +D + ATAS 
Sbjct: 452 LLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASY 511

Query: 405 ----------NGNL--------------------------------KVWNIKTKTCIRNL 422
                     NG L                                K+W++ T + ++ L
Sbjct: 512 DKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTL 571

Query: 423 DCGYALC---CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDG 479
           + G+      C F+     ++     G ++++D ++   L+ ++  H   IW+L   +DG
Sbjct: 572 E-GHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLD-GHDNRIWALTEINDG 629

Query: 480 KRLVTASADKTVKFW 494
             +V+A AD   +FW
Sbjct: 630 DMIVSADADGVFQFW 644

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 13/141 (9%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W+++ GEL  T+ +               +  + QY +   ++A    D TIKIW + 
Sbjct: 516 KIWDLENGELTATLSN---------HKRGLWDVAFCQYDK---LIATCSGDKTIKIWSLD 563

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI 165
           T +V+     H++A+    F     +L+S   D  I +WD      L  L  H + I  +
Sbjct: 564 TFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWAL 623

Query: 166 WCEND-DWLISVSKDGLIKLW 185
              ND D ++S   DG+ + W
Sbjct: 624 TEINDGDMIVSADADGVFQFW 644

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 89/207 (42%), Gaps = 15/207 (7%)

Query: 482 LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLA 541
           + T SAD TV       + E+++ T     P+ +L H    D  +++  +K++P+ ++L+
Sbjct: 22  IATVSADGTVLATPILDDIEIISLT----TPQRRL-HSIANDDEQEITALKLTPDAQYLS 76

Query: 542 VSLLDNTVKVFFLDSMKF----FLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLD 597
               +  +K+F LD  K      +       P   MD    S L+     D +I +  ++
Sbjct: 77  FISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLVALGGTDGSITVVDIE 136

Query: 598 FGDCHKSLFAHQDSIMNVKFLPESHN--FFSCSKD--GTVKYWDGNSFDCIQKLYGHQGE 653
            G    SL  H  +I  +KF  ++++  +  CS D  G VK WD     C+  +  H   
Sbjct: 137 NGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNA 196

Query: 654 VWALAVSSDGQ--AVVSVSHDRSIRVW 678
           V  L V   G    ++S   D    +W
Sbjct: 197 VRGLDVREVGDEWQLISGGRDNVCTLW 223

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 156/643 (24%), Positives = 267/643 (41%), Gaps = 104/643 (16%)

Query: 67  AIDTKAEKPAEATYLQYHEETFIL-AVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF 125
            + T++ K +  +Y+   + T  L A+G  DG+I + D++   +   F  H   I+ L+F
Sbjct: 94  GVITRSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKF 153

Query: 126 -DQTGTR---LISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDW----LISV 176
             + GT    L SG  +    +WDLV       ++ H  AI GI + +NDD     LI+ 
Sbjct: 154 YGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITG 213

Query: 177 SKDGLIKLWDMKV----HQCVETHMAH--TGECWSLAVKD-NMVITANAESEIKLWELDL 229
            +D ++ LW   +     + V+T  AH     C  +   D     TA  ++  ++ +L+ 
Sbjct: 214 GRDNVLNLWRFNIKGKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLN- 272

Query: 230 ERPNGSMLLEKGSYEKQSKQRCTELSFTTVA--DGTTFFYSLNSDKTMEIFRIRSETEIA 287
                     + S  K +K+   EL  T V   +    FY++ SD+T+++ +  SE   +
Sbjct: 273 ----------ESSVVKCTKKPIEELFITGVIPINQGNQFYAVLSDQTIQLLQPNSEIFSS 322

Query: 288 KALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLEL 347
           K+       F +       IQE    ++  +                    +C  +K + 
Sbjct: 323 KS------EFIQ-------IQEYIAGNHGTVA------------------DLCLVTKNKD 351

Query: 348 VITTANNTIEYYSIPYKKKEP-LQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNG 406
            I  A N+     IP  K +   Q T + +      GH   L +   + D + LATAS  
Sbjct: 352 CIALATNSPSLRIIPLPKIDADTQDTDLPIEVNLYEGHSDLLNSLACTEDGQWLATASKD 411

Query: 407 NLKV---WNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIE 463
              +   WN  +K         + +   F+   A V               S+  L N+ 
Sbjct: 412 KTAILWHWNNTSKR--------FYIYATFVGHAASV---------------SAVCLPNVM 448

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLD 523
           E +             K ++TAS D TVK W+    +  +      F+ K  +   T   
Sbjct: 449 EKNYP-----------KYIITASNDLTVKKWEIPPMKNDLNEV--PFIVKSSIY--TRHA 493

Query: 524 LGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
             +D+  + ++P D   A +  D T K++ +D+ +   +L  HK  +  +      K I 
Sbjct: 494 HEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIA 553

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           T S DK +KIW L+     K+L  H +++    F+ +     S   DG +K WD  S DC
Sbjct: 554 TCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDC 613

Query: 644 IQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEE-TEDQV 685
           I+ L GH   +WAL+V  DG  ++S   D   + W++ TE ++
Sbjct: 614 IKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEI 656

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 115/282 (40%), Gaps = 60/282 (21%)

Query: 323 FQLVRSLFKLKASSWTVCTPSKLE-----LVITTANN-TIEYYSIPYKKKEPLQ-PTAIK 375
           F +  +     AS   VC P+ +E      +IT +N+ T++ + IP  K +  + P  +K
Sbjct: 426 FYIYATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVK 485

Query: 376 LHSIESPGHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNL--------DCGY 426
                   H  D+ A  ++ +D + ATAS +   K+WN+ T   +  L        D  +
Sbjct: 486 SSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSF 545

Query: 427 -------ALC-----------------------------CKFLPGGALVILGTRAGQLQL 450
                  A C                             C F+     ++     G +++
Sbjct: 546 CESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKV 605

Query: 451 FDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKF 510
           +D+AS   ++N++  H+  IW+L +  DG  +++A AD   +FW    E E + G L++ 
Sbjct: 606 WDIASGDCIKNLD-GHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAE-IQGALEEN 663

Query: 511 VPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVF 552
             +++     T  +    W       + FL    LD+ +++F
Sbjct: 664 KVRVEQEQSLTNYMNNGEW------SNAFLLALQLDHPMRLF 699

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 99/239 (41%), Gaps = 23/239 (9%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W + TGE + T+ +    G  D           + + E    +A    D T+KIW ++
Sbjct: 520 KLWNVDTGEPVATLANH-KRGLWD-----------VSFCESEKWIATCSGDKTVKIWSLE 567

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI 165
           + TVL     H++A+    F     +L+S   D  I +WD+ +   +  L  H + I  +
Sbjct: 568 SFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWAL 627

Query: 166 WC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVIT---ANAE-S 220
              E+ D +IS   D + + W      C E  +    E   + V+    +T    N E S
Sbjct: 628 SVLEDGDLIISADADSVFQFW----KDCTEAEIQGALEENKVRVEQEQSLTNYMNNGEWS 683

Query: 221 EIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFR 279
              L  L L+ P     + + S   Q +Q   ++ F    D  +   +LN D+ +++ +
Sbjct: 684 NAFLLALQLDHPMRLFNVLRSSMGSQPEQANGKVIFNQELD--SLIGTLNKDQLIQLMK 740

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 150/663 (22%), Positives = 275/663 (41%), Gaps = 125/663 (18%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +K ++++ G+++++M+   P   +D+ +              + +LA+G  DG+I + D+
Sbjct: 84  LKIFDLREGKIVRSMKISSPSYVVDSDST-------------STLLAIGGTDGSITVVDV 130

Query: 105 QTQTVLIVFHSHSSAITILRF--DQTGT--RLISGSRDATIILWDLVAETGLCKLRSHKD 160
           +   V      H   I+ ++F  +Q G    L SG  +  + +WDLV    +  ++ H  
Sbjct: 131 ENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTA 190

Query: 161 AITGI---WCENDD----WLISVSKDGLIKLWDMKVHQ-CV---ETHMAHTGECWSLAVK 209
           A+ GI     +N+D    +LIS  +D +I  W   + + C       ++   E    A  
Sbjct: 191 AVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKKCTLLKTLPVSQQVESCGFA-N 249

Query: 210 DNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVAD--GTTFFY 267
             ++ TA +++ ++L           + LE G   K++ +   EL    V    G +  Y
Sbjct: 250 SELIYTAGSDAFLQL-----------ISLESGKAVKRTHKPVEELFTVGVLSILGGSKLY 298

Query: 268 SLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPFQLVR 327
            + SD+T+ +  +    E   AL               E++     ++  +    F    
Sbjct: 299 MVISDQTLALINLEEALESESALI--------------EVESYIAGNHGTIADMNF---- 340

Query: 328 SLFKLKASSWTVCTPSKLELVITTANNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTD 387
                         P   +L + T + T+    IP   +  L P  ++L+     GH+  
Sbjct: 341 ------------VGPELDKLALATNSPTLRI--IPVSMEGGL-PIDVELYE----GHKDL 381

Query: 388 LRAADISSDDKLLATASNGNLKV-WNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAG 446
           L A D + D   LATAS  +  + W  ++ +             KF+P            
Sbjct: 382 LNAVDATEDGLWLATASKDSTAILWWYQSNSN------------KFVPYAKF-------- 421

Query: 447 QLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR-----LVTASADKTVKFWDFKVEQE 501
                            E H++A+ ++ L +   +     ++TAS D TVK W      +
Sbjct: 422 -----------------EGHSSAVTAVGLPNIMHKGWPEFILTASNDLTVKKWAVP---K 461

Query: 502 LVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFL 561
            VA      +  +K+   T     +D+  + ++P D   A +  D T KV+ L+S +   
Sbjct: 462 PVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGEVKA 521

Query: 562 SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 621
           +L  H+  +  +      +LI T S DK IKIW LD     K+   H +++    F+ + 
Sbjct: 522 TLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQ 581

Query: 622 HNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEET 681
               S S DG VK WD ++ +C++ L GH   +WAL V+ DG  +VS   D   + W+++
Sbjct: 582 TQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDS 641

Query: 682 EDQ 684
            +Q
Sbjct: 642 TEQ 644

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 100/216 (46%), Gaps = 17/216 (7%)

Query: 73  EKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRL 132
           EK   A  +  ++ TF  A    D T K+WD+++  V     +H   +  + F Q    +
Sbjct: 485 EKDINALSVAPNDSTF--ATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLI 542

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQ 191
            + S D TI +W L     +     H +A+    +      L+S S DGL+K+WD    +
Sbjct: 543 ATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGE 602

Query: 192 CVETHMAHTGECWSLAVKD--NMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQS-- 247
           CV+T   HT   W+L V +  +++++A+A+   + W+   E+       E+  + +Q   
Sbjct: 603 CVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQ-------ERQQHNEQQHL 655

Query: 248 --KQRCTELSFTTVADGT-TFFYSLNSDKTMEIFRI 280
             +Q  +  ++ +  D T  F  ++  D  + +FR+
Sbjct: 656 KVEQEQSLQNYLSQGDWTNAFLLAITLDHPLRLFRV 691

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 23/157 (14%)

Query: 46  KCWEIKTGELLKTM---RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           K W++++GE+  T+   R GL             +  + QY     ++A    D TIKIW
Sbjct: 510 KVWDLESGEVKATLANHRRGL------------WDVAFCQYER---LIATCSGDKTIKIW 554

Query: 103 DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLC--KLRSHKD 160
            + T  V+  F  H++A+    F    T+L+S S D  + +WD    TG C   L  H +
Sbjct: 555 SLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWD--CSTGECVKTLDGHTN 612

Query: 161 AITGIW-CENDDWLISVSKDGLIKLWDMKVHQCVETH 196
            I  +   E+ D ++S   DG+ + W     Q  + H
Sbjct: 613 RIWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQH 649

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 384 HRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLD--CGYALCCKFLPGGALVI 440
           HR  L        ++L+AT S +  +K+W++ T   ++  +        C F+     ++
Sbjct: 526 HRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLV 585

Query: 441 LGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQ 500
             +  G ++++D ++   ++ ++  HT  IW+L +  DG  +V+A AD   +FW    EQ
Sbjct: 586 SSSADGLVKIWDCSTGECVKTLD-GHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQ 644

Query: 501 E 501
           E
Sbjct: 645 E 645

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 5/150 (3%)

Query: 509 KFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 568
           + VP+ K +     D  +D+  +K++ + R+L  +     +K+F L   K   S+     
Sbjct: 44  QLVPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS- 102

Query: 569 PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----F 624
           P   +D    S L+     D +I +  ++ G    SL  H  +I +VKF  E +      
Sbjct: 103 PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLL 162

Query: 625 FSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654
            S   +G VK WD     CI  +  H   V
Sbjct: 163 ASGDTNGMVKIWDLVKRKCIHTVQEHTAAV 192

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 76/191 (39%), Gaps = 27/191 (14%)

Query: 459 LENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIH 518
           L  IE      I +L LT+DG+ L  AS  + +K +D +           K V  MK+  
Sbjct: 52  LFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLRE---------GKIVRSMKISS 102

Query: 519 DTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI--S 576
            +        + V        LA+   D ++ V  +++     SL GH   + S+     
Sbjct: 103 PS--------YVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGE 154

Query: 577 HDSKLIITSSADKN--IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN------FFSCS 628
            + ++ + +S D N  +KIW L    C  ++  H  ++  + F    +N        S  
Sbjct: 155 QNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGG 214

Query: 629 KDGTVKYWDGN 639
           +D  + YW  N
Sbjct: 215 RDDVINYWQFN 225

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 142/593 (23%), Positives = 250/593 (42%), Gaps = 72/593 (12%)

Query: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI--WCEND--DW 172
           SS + ++  D+T T L+ G  D ++ ++D+         + H   I+ +  + E D  +W
Sbjct: 101 SSPVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANW 160

Query: 173 LI-SVSKDGLIKLWDMKVHQCVETHMAHTGECWSL--AVKDN--MVITANAESEIKLWEL 227
           L+ S   +G++K+WD+   +C+ T   HT     L   VKD+  ++I+   +  I L   
Sbjct: 161 LLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINLHHF 220

Query: 228 DLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIA 287
           D ++   +  L K    KQ  + C       +A+  +  Y    +   +I  ++S  +I 
Sbjct: 221 DYKK---TCKLLKTLPVKQQIEACG-----FIANHESLIYHAGDNAVYQIVCLQSGKQIK 272

Query: 288 KALKKREKRFKEKGMSDEE---------IQESFRNSYANLLLHPFQLVRSLFKLKASSWT 338
            + K +E+ F    +S E           Q  F       L+     +    K+  +  T
Sbjct: 273 SSQKPQEELFIIGVLSIENGSKHYLVLSDQTLFLLDIEQALMEEDTTIPIKSKIAGNHGT 332

Query: 339 VC-----TPSKLELVITTANNTIEYYSIPYKKKEPLQ-PTAIKLHSIESPGHRTDLRAAD 392
           +       P+   L + T + T+     P   +E  Q P    ++     GH   L A D
Sbjct: 333 IADMKFVGPNLDMLALATNSPTLRIIKAPQASEEDGQFPVETNMYG----GHVDLLNALD 388

Query: 393 ISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLF 451
            S D   +ATAS +  + +W    +         +    KF+           AG +   
Sbjct: 389 ASEDGLWIATASKDHTVLLWRYSEQLG------DFKQYAKFIG---------HAGSV--- 430

Query: 452 DLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFV 511
              ++  L NI + H               L+++S D TVK W  KV +     T D+ +
Sbjct: 431 ---TAVALPNIMDQHFPNF-----------LLSSSTDMTVKKW--KVPKPTQNPTEDE-I 473

Query: 512 PKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 571
           P +K    T     +D+  + ISP D   A +  D T K++ L + +   +L  HK  + 
Sbjct: 474 PVVKTSEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLW 533

Query: 572 SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDG 631
            +      KLI T S DK IKIW L+  +   +L  H +++  + F+ ++    SC  DG
Sbjct: 534 DVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADG 593

Query: 632 TVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQ 684
            VK WD ++ +C++ L  H   +WAL V+ DG   V+   D   + W++  ++
Sbjct: 594 LVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEE 646

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 71/154 (46%), Gaps = 11/154 (7%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           I A    D T KIWD+ T  ++    +H   +  + F Q    + + S D TI +W L  
Sbjct: 501 IFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLEN 560

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
                 L  H +A+  I +   +  L+S   DGL+K+WD    +C+ T  AH    W+L 
Sbjct: 561 YNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALE 620

Query: 208 VKD--NMVITANAESEIKLW--------ELDLER 231
           V D  +  +TA+A+   + W        E DLE+
Sbjct: 621 VADDGDRFVTADADGLFQFWKDNSEEEHEQDLEK 654

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 63/141 (44%), Gaps = 13/141 (9%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W++ TGEL+ T+ +               + ++ Q+ +   ++A    D TIKIW ++
Sbjct: 512 KIWDLVTGELVATLAN---------HKRGLWDVSFCQHDK---LIATCSGDKTIKIWSLE 559

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI 165
              +      H++A+  + F     +L+S   D  + +WD      L  L +H + I  +
Sbjct: 560 NYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWAL 619

Query: 166 WCEND-DWLISVSKDGLIKLW 185
              +D D  ++   DGL + W
Sbjct: 620 EVADDGDRFVTADADGLFQFW 640

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 54/169 (31%)

Query: 346 ELVITTANNTIEYYSIPYKKKEPLQPTA-----IKLHSIES-------PGHRTDL-RAAD 392
           ELV T AN+    + + + + + L  T      IK+ S+E+        GH   + R + 
Sbjct: 520 ELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISF 579

Query: 393 ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFD 452
           I+ + +L++  ++G +K+W+  T  C+R LD                             
Sbjct: 580 INKNKQLVSCGADGLVKIWDCSTGECLRTLD----------------------------- 610

Query: 453 LASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE 501
                       AH   IW+L++  DG R VTA AD   +FW    E+E
Sbjct: 611 ------------AHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 74/206 (35%), Gaps = 35/206 (16%)

Query: 58  TMRDGLPPGAIDTKAEKPAEATYLQYH----------EETFILAVGYADGTIKIWDMQTQ 107
           T+R    P A +   + P E      H          E+   +A    D T+ +W    Q
Sbjct: 354 TLRIIKAPQASEEDGQFPVETNMYGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQ 413

Query: 108 ----TVLIVFHSHSSAITILRFDQTGTR-----LISGSRDATIILWDL------------ 146
                    F  H+ ++T +       +     L+S S D T+  W +            
Sbjct: 414 LGDFKQYAKFIGHAGSVTAVALPNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEI 473

Query: 147 -VAETGLCKLRSHKDAITGIWCE-NDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECW 204
            V +T     R+H+  I  +    ND    + S D   K+WD+   + V T   H    W
Sbjct: 474 PVVKTSEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLW 533

Query: 205 --SLAVKDNMVITANAESEIKLWELD 228
             S    D ++ T + +  IK+W L+
Sbjct: 534 DVSFCQHDKLIATCSGDKTIKIWSLE 559

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 80  YLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF--DQTGTRLISGSR 137
           Y +     ++LA G  +G +KIWD+  +  +     H++A+  L F    +   LISG R
Sbjct: 152 YGELDGANWLLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGR 211

Query: 138 DATIIL 143
           D  I L
Sbjct: 212 DEIINL 217

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 158/678 (23%), Positives = 274/678 (40%), Gaps = 143/678 (21%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +K +++ TG+++K+M+   P   ++T                + +LA+G  DG++ + D+
Sbjct: 97  LKIFKLSTGKIVKSMKISSPSYVLETDPT-------------STLLAIGGTDGSVTVIDI 143

Query: 105 QTQTVLIVFHSHSSAITILRF---DQTGTRLI-SGSRDATIILWDLVAETGLCKLRSHKD 160
           +   +      H + I+ L+F     T T L+ SG  +  + +WDLV+   +  L+ H  
Sbjct: 144 ENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNS 203

Query: 161 AITGI--------WCENDDWLISVSKDGLIKLWDMK---------------VHQCVETHM 197
           A+ GI          E+   LI+ ++D +I  W+ K               VHQ +E   
Sbjct: 204 AVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFKDVTNLKRCKLLKTIPVHQQIE--- 260

Query: 198 AHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFT 257
           A         + D+++ T+  ++ +++  L+    N S++       K+SK+   EL   
Sbjct: 261 ACGFIINIDGIDDDLIYTSGGDAVLQIVSLN----NNSIV-------KKSKKPLEELFII 309

Query: 258 TVADGTTF--FYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSY 315
            V     F   Y + SD+T+++                            +++++F N  
Sbjct: 310 GVLPVRNFTQLYLVFSDQTLQLV---------------------------DLKDTFSN-- 340

Query: 316 ANLLLHPFQLVRSLFKLKASSWT-----VCTPSKLELVITTANNTIEYYSIPYKKKEPLQ 370
                 P + +  +  L  +  T     V  P+  +L + T ++T+    IP    +   
Sbjct: 341 ------PKEYIEVVSSLAGNHGTIADMKVVGPNFDKLALATNSSTLRI--IPISDVDDSN 392

Query: 371 PTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKV-WNIKTKTCIRNLDCGYALC 429
             +I     E  GH   L A D + D   +ATAS  N  + W    +T          L 
Sbjct: 393 SVSISTELYE--GHTDLLNAVDATEDGLWIATASKDNSAILWRYNPRT---------TLF 441

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
           CK+      V   T  G            L N+        W        + L+TAS D 
Sbjct: 442 CKYAHFQGHVSSVTSVG------------LPNVMNKG----WP-------EYLITASNDL 478

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHD---TTLDLGEDLWCVKISPEDRFLAVSLLD 546
           TVK W        V    D+F  ++  I     T     +D+  + ISP D   A +  D
Sbjct: 479 TVKKWK-------VPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDSIFATASYD 531

Query: 547 NTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLF 606
            T K++ L++ +   +L  HK  +  +      K I T+S DK +KIW LD     K+L 
Sbjct: 532 KTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLE 591

Query: 607 AHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAV 666
            H +++    F  +     S   DG VK WD ++ +CI  L GH   +WAL V  DG  V
Sbjct: 592 GHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALNVIKDGDIV 651

Query: 667 VSVSHDRSIRVWEETEDQ 684
           ++   D   + W++  ++
Sbjct: 652 ITADADGVFQFWKDRTEE 669

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 67/152 (44%), Gaps = 17/152 (11%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W+++TGEL  T+ +               + ++ QY +    +A    D T+KIW + 
Sbjct: 535 KIWDLETGELKATLNN---------HKRGLWDVSFCQYDK---FIATASGDKTVKIWSLD 582

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLC--KLRSHKDAIT 163
           T TV+     HS+A+    F     +L+S   D  + LWD    TG C   L  H + I 
Sbjct: 583 TFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWD--CSTGECINTLDGHDNRIW 640

Query: 164 GIWCEND-DWLISVSKDGLIKLWDMKVHQCVE 194
            +    D D +I+   DG+ + W  +  +  E
Sbjct: 641 ALNVIKDGDIVITADADGVFQFWKDRTEEARE 672

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 12/176 (6%)

Query: 515 KLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           +++H    D  +++  + ++P+ ++L        +K+F L + K   S+     P   ++
Sbjct: 63  QILHKIENDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLE 121

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSCSKD 630
               S L+     D ++ +  ++ G    SL  H  +I ++KF  E H       S   +
Sbjct: 122 TDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTN 181

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAV-------SSDGQAVVSVSHDRSIRVWE 679
           G VK WD  S   I  L  H   V  +         S D   +++ + D  I  WE
Sbjct: 182 GMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWE 237

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 162/688 (23%), Positives = 270/688 (39%), Gaps = 165/688 (23%)

Query: 56  LKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFIL-AVGYADGTIKIWDMQTQTVLIVFH 114
           + T +  L P     K  K +  +Y+   + T  L AVG  DG+I + D++   +   F 
Sbjct: 102 MNTKQQSLQP----IKTLKLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFK 157

Query: 115 SHSSAITILRF----DQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWC--- 167
            H   I+ ++F    D     L SG  +  + +WDLV  + +  L+ H  A+ G+     
Sbjct: 158 GHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSV 217

Query: 168 --ENDD---WLISVSKDGLIKLWD------------MKVHQCVETHMAHTGECWSLAVKD 210
             END+    L+S S+D ++ LW+            + V+Q VE+       C  +   D
Sbjct: 218 SKENDNVVLQLLSGSRDNIVNLWEFNLRKLCKLLKTLPVNQQVES-------CGFIHDHD 270

Query: 211 N----MVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFF 266
           N    ++ TA  E+  +L           + L KGS  K++ +   EL       GT  F
Sbjct: 271 NELQDIIYTAGGEAIFQL-----------ISLSKGSVIKRTVKPTEELFII----GTLPF 315

Query: 267 YSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLL--LHPFQ 324
            + N+D    I                        MSD+ +Q        NL   L P +
Sbjct: 316 TATNNDLNSYIV-----------------------MSDQTLQ------MINLTKALSPTE 346

Query: 325 LVRSLFKLK---ASSWTVCTPSKL------ELVITTANNTIEYYSIPYKKKEPLQPTA-- 373
           L   + +++   A +       K       +L + T + T+    +P   KE   P    
Sbjct: 347 LSNPIIEIESCIAGNHGTIADMKFVGQDLNKLALATNSPTLRIIPVPSTMKEAADPNTQD 406

Query: 374 ------IKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKV-WNIKTKTCIRNLDCGY 426
                 I + + E  GH   L +   + D + LATAS  +  + W   ++T         
Sbjct: 407 NSADLPINMETYE--GHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETS-------- 456

Query: 427 ALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR----- 481
               +F      +                          H++++ ++ L +   R     
Sbjct: 457 ----RFFAYAKFI-------------------------GHSSSVTAVGLPNVLLRGYPEF 487

Query: 482 LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLI---------HDTTLDLGEDLWCVK 532
           L+TAS D T+K W  K+       + D+   K  +I         HD      +D+  + 
Sbjct: 488 LITASNDLTIKKW--KIPTPSKERSDDESKDKTHIIKVSEYTRHAHD------KDINSIS 539

Query: 533 ISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIK 592
           ISP D  +A    D + K++ LDS +   +L  HK  +  +      KLI T S DK IK
Sbjct: 540 ISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIK 599

Query: 593 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652
           +W LD     K+   H +++    F+ +     S   DG +K WD  + DC++ L GH  
Sbjct: 600 LWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDN 659

Query: 653 EVWALAVSSDGQAVVSVSHDRSIRVWEE 680
            +WAL   +DG+ +VS   D  ++ W +
Sbjct: 660 RIWALTTWNDGELIVSADADGVLQFWND 687

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 37  VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           + TG+ ++  K W + +GEL+ T+ +               + ++ Q+ +   ++A    
Sbjct: 547 IATGSYDKSCKLWNLDSGELVATLNN---------HKRGIWDVSFCQFDK---LIATCSG 594

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D TIK+W + T  VL  F  H++A+    F     +L+S   D  I +WD      L  L
Sbjct: 595 DKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTL 654

Query: 156 RSHKDAITGIWCEND-DWLISVSKDGLIKLWD 186
             H + I  +   ND + ++S   DG+++ W+
Sbjct: 655 DGHDNRIWALTTWNDGELIVSADADGVLQFWN 686

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 86/195 (44%), Gaps = 24/195 (12%)

Query: 509 KFVPKMKLIHDTTLDLGEDLWCVKISPEDRFL-AVSLLDNTVKVFFLDSMKFFLSLYGHK 567
           K  P  + +   T +  +++ C+K++P+ +FL +++L    +K++ L +++   ++   +
Sbjct: 47  KLSPLQERLTTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQ 106

Query: 568 L------------PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 615
                        P   MD    S L+     D +I +  ++ G    S   H  +I +V
Sbjct: 107 QSLQPIKTLKLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSV 166

Query: 616 KFLP--ESHNFFSCSKD--GTVKYWDGNSFDCIQKLYGHQGEVWAL---AVSSDGQAVV- 667
           KF    +++ +  CS D  G VK WD     CI  L  H   V  L   +VS +   VV 
Sbjct: 167 KFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVL 226

Query: 668 ---SVSHDRSIRVWE 679
              S S D  + +WE
Sbjct: 227 QLLSGSRDNIVNLWE 241

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 87/210 (41%), Gaps = 53/210 (25%)

Query: 346 ELVITTANN-TIEYYSIPYKKKEPLQPTA------IKLHSIESPGHRTDLRAADISSDDK 398
           E +IT +N+ TI+ + IP   KE     +      IK+       H  D+ +  IS +D 
Sbjct: 486 EFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSISISPNDS 545

Query: 399 LLATAS-NGNLKVWNIKTKTCIRNLD-----------CGY----ALC------------- 429
           L+AT S + + K+WN+ +   +  L+           C +    A C             
Sbjct: 546 LIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDT 605

Query: 430 ----------------CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSL 473
                           C F+     ++     G ++++D  +   L+ ++  H   IW+L
Sbjct: 606 FAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLD-GHDNRIWAL 664

Query: 474 DLTSDGKRLVTASADKTVKFWDFKVEQELV 503
              +DG+ +V+A AD  ++FW+   E E++
Sbjct: 665 TTWNDGELIVSADADGVLQFWNDCTELEIL 694

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 144/663 (21%), Positives = 268/663 (40%), Gaps = 116/663 (17%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +K   + TG+++K+M+   P   ID               + + ++ +G  DG++ + D+
Sbjct: 53  LKIVNVSTGKIIKSMKVSSPSYIIDCD-------------KTSTLVTIGGTDGSVVVIDI 99

Query: 105 QTQTVLIVFHSHSSAITILRF----DQTGTRLISGSRDATIILWDLVAETGLCKLRSHKD 160
           +   +      H   I+ L+F    +     L SG  +  + +WDLV    +  ++ H  
Sbjct: 100 ENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKRKCIHTVQEHTS 159

Query: 161 AITGI---WCENDD---WLISVSKDGLIKLWDMKVHQ---CVETHMAHTGECWSLAVKDN 211
            + G+     END     L++  +D ++  W+  + +    V+T  AH     S  +  +
Sbjct: 160 PVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNLKKKCTLVKTIPAHQQIESSGFINHD 219

Query: 212 MVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTEL---SFTTVADGTTFFYS 268
            + TA +++  ++           + L+ G   K++++   EL       + +GT ++  
Sbjct: 220 FIYTAGSDAVFQV-----------ISLKNGQVIKRTRKPIEELFIIGVLPILNGTEYYLV 268

Query: 269 LNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRS 328
           + SD+++ +  ++       AL++ E         DE I      S  + +     ++  
Sbjct: 269 M-SDQSLNLIDVQG------ALEEEE---------DELI------SSKSCIAGNHGIIAD 306

Query: 329 LFKLKASSWTVCTPSKLELVITTANNTIEYYSIPYKKK------EPLQPTAIKLHSIESP 382
           +        T   P    L + T + T+    +P   K      E   P  + ++     
Sbjct: 307 M--------TFVGPDLKHLALATNSPTLRLIPVPNTNKSDGNEDESFLPIDVDMYE---- 354

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVIL 441
           GH   L A D + D   +ATAS + +  VW   T                         +
Sbjct: 355 GHEDLLNAIDSTEDGLWIATASKDHSAIVWKYNT-------------------------I 389

Query: 442 GTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE 501
             +  Q   F   SS++           + ++   S  + L+TAS D T+K W       
Sbjct: 390 KQKFTQYARFSGHSSSVT-------AVGLPNVMPKSYPEYLLTASNDLTIKKWKIPKPS- 441

Query: 502 LVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFL 561
             AG  +     +K+   T     +D+  + ISP D   A +  D T K++ L++ +   
Sbjct: 442 --AGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVA 499

Query: 562 SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 621
           +L  HK  +  +      K+I T S DK IKIW LD     K+L  H +++    F+ + 
Sbjct: 500 TLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQ 559

Query: 622 HNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEET 681
           +   S   DG +K WD ++ +CI  L GH   +WAL V +DG  +VS   D   + W + 
Sbjct: 560 NQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWRDC 619

Query: 682 EDQ 684
            D+
Sbjct: 620 TDE 622

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 139/316 (43%), Gaps = 38/316 (12%)

Query: 6   QRFEQADVFGVVTANSNCVWLPS-QAKNSPGQVITGALE-EVKCWEIKTGELLKTMRDGL 63
           Q+F Q   F   +++   V LP+   K+ P  ++T + +  +K W+I             
Sbjct: 391 QKFTQYARFSGHSSSVTAVGLPNVMPKSYPEYLLTASNDLTIKKWKIP------------ 438

Query: 64  PPGAIDTKAE----KPAEATYLQYHEETF----------ILAVGYADGTIKIWDMQTQTV 109
            P A D + E    K +E T  + HE+            I A    D T KIWD++T   
Sbjct: 439 KPSAGDEEVEFHDVKISEYTR-RAHEKDINALSISPNDSIFATASYDKTCKIWDLETGES 497

Query: 110 LIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCE 168
           +    +H   +  + F Q    + + S D TI +W L   + +  L  H +A+    +  
Sbjct: 498 VATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFIN 557

Query: 169 NDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKD--NMVITANAESEIKLW- 225
             + L+S   DGLIK+WD+   +C+ T   H    W+L V++  +++++A+A+   + W 
Sbjct: 558 KQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWR 617

Query: 226 ELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTT-FFYSLNSDKTMEIFRIRSET 284
           +   E+    M  EK   E++   +    ++    D T  F  +++ D  M +F +  E+
Sbjct: 618 DCTDEQREEDMAKEKERIEQEQSLQ----NYLNERDWTNAFLLAISLDHPMRLFNVLRES 673

Query: 285 EIAKALKKREKRFKEK 300
              K    +E  F ++
Sbjct: 674 LSTKHEADKESIFNKE 689

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 77/177 (43%), Gaps = 10/177 (5%)

Query: 512 PKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 571
           P  K++H  + +  +++  +K++P+ ++L        +K+  + + K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 572 SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE--SHNFFSCSK 629
            +D    S L+     D ++ +  ++ G    SL  H  +I ++KF  E  S+ +  CS 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 630 D--GTVKYWDGNSFDCIQKLYGHQGEVWALAV-----SSDGQAVVSVSHDRSIRVWE 679
           D  G VK WD     CI  +  H   V  + +      +D   +V+   D  +  WE
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 156/666 (23%), Positives = 268/666 (40%), Gaps = 119/666 (17%)

Query: 50  IKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTV 109
           +   +LL+     LP   I    +  +    ++    + +LA+G  DG++ I D++   V
Sbjct: 98  VSQAQLLRVYH--LPSKKIVRSMKVSSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYV 155

Query: 110 LIVFHSHSSAITILRF----DQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITG- 164
              F  H   I+ ++F    +    RL SG     + +WDLV    L  ++ H  A+ G 
Sbjct: 156 THSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGL 215

Query: 165 ---IWCENDDW--LISVSKDGLIKLWD------------MKVHQCVET-HMAHTGECWSL 206
              +  E++D   LIS  +D +I L+             + +HQ VE+    +TG     
Sbjct: 216 DFRVLDEDEDQMQLISGGRDNIINLYQFDSRKKCKLLKTLPIHQQVESCGFINTGGV--- 272

Query: 207 AVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTEL---SFTTVADGT 263
               N V TA +++  ++  LD            GS  +++ Q   EL       + +G+
Sbjct: 273 ---QNCVYTAGSDAVYQIVSLD-----------TGSVIRKTAQPIEELFIIGVLPILEGS 318

Query: 264 TFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPF 323
             F  L SD+T+  F I  E  IA                DE I    + +  +  +   
Sbjct: 319 KMFLIL-SDQTL--FLIDVEAAIAN--------------EDEIIDIELKIAGNHGTIADM 361

Query: 324 QLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYYSIPYK--KKEPLQ-PTAIKLHSIE 380
           + V    KL   +    +P+   + +    N  E      +  +KE +Q P  ++++   
Sbjct: 362 RFVGP--KLDKLALATNSPTLRVIPVPVYGNEEEERDEEMEDDQKEEIQLPIEVEMYE-- 417

Query: 381 SPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVI 440
             GH   L + D + D   LATAS  N                               VI
Sbjct: 418 --GHEDLLNSLDATEDGMWLATASKDNF------------------------------VI 445

Query: 441 LGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR-----LVTASADKTVKFWD 495
           L     Q +LF   +  +       H   + ++ L +   R     L++AS D T+K W 
Sbjct: 446 LWRYDEQTELFKQYAKFV------GHAGPVTAVGLPNVMNRPWPEFLLSASNDLTIKKWA 499

Query: 496 F-KVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFL 554
             K E       + K     +  H+      +D+  + +SP D   A +  D T K++ L
Sbjct: 500 VPKPEDGKDTVHVVKASEYTRRAHE------KDINALAVSPNDSVFATASYDKTCKIWSL 553

Query: 555 DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMN 614
           D+ +   +L  HK  +  ++     KL+ T S DK +KIW LD     K+L  H +++  
Sbjct: 554 DTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQR 613

Query: 615 VKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRS 674
             F+ ++    S   DG VK WD ++ +C++ L  H   +WAL+V  DG  +V+   D  
Sbjct: 614 CSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIVTADADGV 673

Query: 675 IRVWEE 680
            + W++
Sbjct: 674 FQFWKD 679

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 71/175 (40%), Gaps = 21/175 (12%)

Query: 515 KLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           +++H    D  +++  ++I+P+ +FL        ++V+ L S K   S+     PV  M+
Sbjct: 70  QVVHIIENDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVME 128

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSCSKD 630
               S L+     D ++ I  ++ G    S   H  +I +VKF  E ++      S    
Sbjct: 129 CDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTT 188

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQV 685
           G VK WD     C+  +  H   V  L                  RV +E EDQ+
Sbjct: 189 GVVKIWDLVKRKCLHTVQEHTMAVRGL----------------DFRVLDEDEDQM 227

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 139/647 (21%), Positives = 266/647 (41%), Gaps = 74/647 (11%)

Query: 65  PGAIDTKAEKPAE--ATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITI 122
           P AI  K E   E   T L+   +   L     +  ++ +D++T+         S A  +
Sbjct: 48  PHAIIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAY-V 106

Query: 123 LRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI--WCENDD--WLI-SVS 177
           L  D++ T L  G  D ++ ++D+        L+ H   I+ +  + E D   WL+ S  
Sbjct: 107 LDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGD 166

Query: 178 KDGLIKLWDMKVHQCVETHMAHTGECWSLAVK-----DNMVITANAESEIKLWELDLERP 232
            +G++K+WD+   +C+ T   HT     L ++     ++++++   +  + +   D+++ 
Sbjct: 167 TNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMKKK 226

Query: 233 NGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKK 292
               LL+    ++Q +      S   + D T+  Y+   D   +I  + S   I +  + 
Sbjct: 227 --CKLLQTIPVKRQIE------SCGFIGDNTSLIYTAGGDAVYQIISLESGKSIKQTAQP 278

Query: 293 REKRFKEKGMSDEEI---------QESFRNSYANLLLHPFQLVRSLFKLKASSWTVC--- 340
            E+ F    +  +           Q  F       L    +++    K+  +  T+    
Sbjct: 279 VEELFIVGVLPVQNSTKCYLVLSDQTLFLIDVEKALSQTEKMIEIEKKIAGNHGTIADMR 338

Query: 341 --TPSKLELVITTANNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDK 398
              PS   L + T + T+     P   ++      +++ +    GH   L + D +SD  
Sbjct: 339 LVGPSLNRLALATNSPTLRIIPTPQASEDK---EVMEIETEMYEGHTDLLNSLDATSDGL 395

Query: 399 LLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASST 457
            LATAS + ++ +W     +        +    KFL     V               ++ 
Sbjct: 396 WLATASKDHSVILWRYNEASS------SFEPFTKFLGHAGPV---------------TAI 434

Query: 458 MLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLI 517
            L N+   +    W        + L+TAS D T+K W      +  A  L   V   K  
Sbjct: 435 ALPNVMNRN----WP-------EFLLTASNDLTIKRWKVPNPNDRKAIELPHIV---KAS 480

Query: 518 HDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISH 577
             T     +D+  + +SP D   A +  D T K++ +D+ +   +L  HK  +  +    
Sbjct: 481 EYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCE 540

Query: 578 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
              L+ T S D++I +W L+     K+L  H +++  V F+  +    S   DG VK WD
Sbjct: 541 YDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWD 600

Query: 638 GNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQ 684
            ++ +C++ L  H   +WALAV++DGQ +++   D   + WE+  ++
Sbjct: 601 CSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEE 647

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 100/205 (48%), Gaps = 8/205 (3%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           I A    D T KIW++ T  V     +H   +  + F +    L + S D +I LW L +
Sbjct: 502 IFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLES 561

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
            T L  L  H +A+  + +   +  L+S   DGL+K+WD    +CV T  AH    W+LA
Sbjct: 562 FTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALA 621

Query: 208 VKDN--MVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVAD-GTT 264
           V ++  ++ITA+A+   + WE + E  +   + ++   + + +Q  +  ++ +  D    
Sbjct: 622 VANDGQLIITADADGVFQFWEDNSEEEHERNIEQE---KLRVEQEQSLQNYISEGDWNNA 678

Query: 265 FFYSLNSDKTMEIFRIRSETEIAKA 289
           F  ++  D  M ++ +  E  IAKA
Sbjct: 679 FLLAMTLDHPMRLYHVL-ERAIAKA 702

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 64/144 (44%), Gaps = 17/144 (11%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W + TGE+  T+            A        + + E  ++LA    D +I +W ++
Sbjct: 513 KIWNVDTGEVEATL------------ANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLE 560

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLC--KLRSHKDAIT 163
           + TVL     H++A+  + F     +L+S   D  + +WD    TG C   L +H + I 
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWD--CSTGECVRTLDAHNNRIW 618

Query: 164 GIWCENDDWL-ISVSKDGLIKLWD 186
            +   ND  L I+   DG+ + W+
Sbjct: 619 ALAVANDGQLIITADADGVFQFWE 642

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 82/204 (40%), Gaps = 49/204 (24%)

Query: 346 ELVITTANN-TIEYYSIPYK--KKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLAT 402
           E ++T +N+ TI+ + +P    +K    P  +K        H  D+ A  +S +D + AT
Sbjct: 446 EFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFAT 505

Query: 403 AS-NGNLKVWNIKTKTCIRNLDC------GYALC-------------------------- 429
           AS +   K+WN+ T      L        G A C                          
Sbjct: 506 ASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVL 565

Query: 430 ------------CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTS 477
                         F+ G   ++     G ++++D ++   +  ++ AH   IW+L + +
Sbjct: 566 KTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLD-AHNNRIWALAVAN 624

Query: 478 DGKRLVTASADKTVKFWDFKVEQE 501
           DG+ ++TA AD   +FW+   E+E
Sbjct: 625 DGQLIITADADGVFQFWEDNSEEE 648

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 146/676 (21%), Positives = 266/676 (39%), Gaps = 154/676 (22%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +K + +KTG+++++M+   P   +D      A++T       + +LAVG  DG+I + D+
Sbjct: 85  LKIFHLKTGKVVRSMKISSPSYILD------ADST-------STLLAVGGTDGSIIVVDI 131

Query: 105 QTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITG 164
           +   +   F  H   I+ L+F         G  D+ I                       
Sbjct: 132 ENGYITHSFKGHGGTISSLKF--------YGQLDSKI----------------------- 160

Query: 165 IWCENDDWLI-SVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNM--------VIT 215
                  WL+ S   +G++K+WD+   +C+ T   H+     L + +          +++
Sbjct: 161 -------WLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLS 213

Query: 216 ANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTM 275
              +  I +W+ ++++   +  L K     Q  + C    F    D     Y+   D   
Sbjct: 214 GGRDDIINIWDFNMKK---TCKLIKTLPVNQQVESC---GFLRYHDDKHLIYTAGGDAIF 267

Query: 276 EIFRIRSETEIAKALKKREKRF---------KEKG---MSDEEIQESFRNSYANLLLHPF 323
           ++  + S   I K  K  E+ F           K    MSD+ +Q          L++  
Sbjct: 268 QLIDLESGIMIKKTNKPIEELFIIGVLPIVSSSKMFLVMSDQTLQ----------LINVE 317

Query: 324 QLVRSLFKLKASSWTVCT------------PSKLELVITTANNTIEYYSIP-YKKKEPLQ 370
           ++++S  ++   S T+              P   +L + T + ++    IP         
Sbjct: 318 EVIKSENEIIEVSSTIAGNHGIIADMRFVGPELNKLALATNSPSLRIIPIPDLAGTTASL 377

Query: 371 PTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLK-VWNIKTKTCIRNLDCGYALC 429
           P  ++++     GH   L + D + D   +ATAS  N   VW     T            
Sbjct: 378 PLDVEIYE----GHEDLLNSLDATEDGLWIATASKDNSAIVWKYNENT------------ 421

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR-----LVT 484
                              + F++ S  +       H++A+ ++ L     +     L+T
Sbjct: 422 -------------------RKFEVYSKYI------GHSSAVTAVGLPKIMPKGYPEFLLT 456

Query: 485 ASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSL 544
           AS D T+K W      ++   T    V  +K+   T     +D+  + ISP D   A + 
Sbjct: 457 ASNDLTIKKW------KIPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATAS 510

Query: 545 LDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKS 604
            D T K++ L++ +   +L  HK  +  +      KL+ T S DK +KIW LD     K+
Sbjct: 511 YDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKT 570

Query: 605 LFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQ 664
           L  H +++    F+ +     SC  DG +K WD +S +C++ L GH   +WAL   +DG 
Sbjct: 571 LEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMNDGD 630

Query: 665 AVVSVSHDRSIRVWEE 680
            +VS   D   + W++
Sbjct: 631 IIVSADADGVFQFWKD 646

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 11/174 (6%)

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           +IH  + +  +++  +K++P+ ++L        +K+F L + K   S+     P   +D 
Sbjct: 52  IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISS-PSYILDA 110

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSCSKDG 631
              S L+     D +I +  ++ G    S   H  +I ++KF  +  +      S   +G
Sbjct: 111 DSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNG 170

Query: 632 TVKYWDGNSFDCIQKLYGHQGEVWALAV----SSDGQ--AVVSVSHDRSIRVWE 679
            VK WD     C+  L  H   V  L +    +SD     ++S   D  I +W+
Sbjct: 171 MVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWD 224

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 149/677 (22%), Positives = 249/677 (36%), Gaps = 141/677 (20%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGS 136
           E T LQ   +   L     +  +KI+++  +   +     SS   ++  DQT T L  G 
Sbjct: 63  EITALQLSPDGKYLCYASTNQLLKIYNI-VEKKFVKSLKISSPSYVMSIDQTSTLLAVGG 121

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGIWC-------ENDDWLI-SVSKDGLIKLWDMK 188
            D ++ + D+         + H   I+ +          N+ WL+ S    G+IK+ DM 
Sbjct: 122 TDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMV 181

Query: 189 VHQCVETHMAHTGECWSLAVKDN-----------MVITANAESEIKLWELDLERPNGSML 237
             +C+ T   HT     L ++ +            +++   +  + LWE +L R +    
Sbjct: 182 KRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRKSK--- 238

Query: 238 LEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRF 297
           L K     Q  + C  L+     +     Y+  SD   +I  I S     K LKK  K  
Sbjct: 239 LIKTIPVYQQVEACGFLN----GNYEDLIYTGGSDAIFQILSISSN----KILKKTLK-- 288

Query: 298 KEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIE 357
                    I+E F             ++  L  L  S + +    +  L++    N  E
Sbjct: 289 --------PIEELF-------------IIGVLPILDNSKFYLVLSDQTLLLVDVEENMAE 327

Query: 358 YYSIPYKKKEPLQPTAIKLHSIESPGHRT--DLRAADISSDDKLLATASNGNLKVWNIKT 415
                    E +  T IK+ +  +  H T  D+R  D +     LAT S           
Sbjct: 328 ----DENPSEYVDHTIIKIENSIAGNHGTIADMRVVDPTLSKLALATNS----------- 372

Query: 416 KTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLE-NIEEAHTAAIWSLD 474
                             P   ++ +     +    D  S   ++ ++ E HT  + SLD
Sbjct: 373 ------------------PTLRIIPISEANEEADSKDALSRIPIDVDMYEGHTDLLNSLD 414

Query: 475 LTSDGKRLVTASADKTVKFWDFKVEQE-------------------------------LV 503
            T D   + TAS D +   W +    E                               ++
Sbjct: 415 STEDSLWIATASKDNSCILWRYNAVLEKYQIYAKFLGHASSVTAVGLPNVLTKNYPDYVI 474

Query: 504 AGTLDKFVPKMKLIHDT-TLDLGE-------------------DLWCVKISPEDRFLAVS 543
             + D  + K K+   T  LD  +                   D+  + ISP D   A +
Sbjct: 475 TASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATA 534

Query: 544 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHK 603
             D T K++ L+S     +L  HK  +  +      K I+T+S DK IK+W LD     K
Sbjct: 535 SYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVK 594

Query: 604 SLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDG 663
           +   H +++   +F+ +     SC  DG +K WD +S +CI+ L GH   +WAL+V +DG
Sbjct: 595 TFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDG 654

Query: 664 QAVVSVSHDRSIRVWEE 680
             ++S   D   + W +
Sbjct: 655 DVIISADADGVFQFWRD 671

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 115/267 (43%), Gaps = 13/267 (4%)

Query: 24  VWLPSQ-AKNSPGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAID----TKAEKPAE 77
           V LP+   KN P  VIT + +  +K W++          D   P  +     T+     +
Sbjct: 459 VGLPNVLTKNYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKD 518

Query: 78  ATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSR 137
              L       I A    D T KIWD+++  +     +H   +  + F Q    +++ S 
Sbjct: 519 INALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASG 578

Query: 138 DATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETH 196
           D TI +W L   T +     H +A+    +      L+S   DGLIK+WD    +C++T 
Sbjct: 579 DKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTL 638

Query: 197 MAHTGECWSLAVKD--NMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTEL 254
             H+   W+L+V +  +++I+A+A+   + W  D    N    LEK   + + +Q     
Sbjct: 639 DGHSNRIWALSVINDGDVIISADADGVFQFWR-DCTGENREKDLEKERLKVEQEQSLQ-- 695

Query: 255 SFTTVADGTT-FFYSLNSDKTMEIFRI 280
           ++    D T  F  ++  D  + +F +
Sbjct: 696 NYLANEDWTNAFLLAMTLDHPLRLFNV 722

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 18/139 (12%)

Query: 71  KAEKPAEATYLQYHEET-FILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF---- 125
           K+ K +  +Y+   ++T  +LAVG  DG++ + D++   +   F  H + I+ ++F    
Sbjct: 97  KSLKISSPSYVMSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDA 156

Query: 126 ---DQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-------WCENDD---W 172
              +  G  L SG     I + D+V    L   + H  AI G+         END+    
Sbjct: 157 STQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQ 216

Query: 173 LISVSKDGLIKLWDMKVHQ 191
           L+S  +D ++ LW+  + +
Sbjct: 217 LLSGGRDDIVNLWEFNLRR 235

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 81/202 (40%), Gaps = 35/202 (17%)

Query: 455 SSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKM 514
           +S +L+N+       I +L L+ DGK L  AS ++ +K ++  VE+        KFV  +
Sbjct: 49  NSYLLDNVSNDDEQEITALQLSPDGKYLCYASTNQLLKIYNI-VEK--------KFVKSL 99

Query: 515 KLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           K+   +        + + I      LAV   D +V V  +++     S  GH   + ++ 
Sbjct: 100 KISSPS--------YVMSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVK 151

Query: 575 ISHDSK-------LIITSSADKNIKIWGLDFGDCHKSLFAHQDSI--MNVKFLPESH--- 622
              D+        L+ +      IK+  +    C  +   H  +I  ++++  P SH   
Sbjct: 152 FYSDASTQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSP-SHVEN 210

Query: 623 -----NFFSCSKDGTVKYWDGN 639
                   S  +D  V  W+ N
Sbjct: 211 DEPLLQLLSGGRDDIVNLWEFN 232

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 142/618 (22%), Positives = 250/618 (40%), Gaps = 67/618 (10%)

Query: 99  IKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSH 158
           ++I+ ++++ V+      SS + ++  D + T +  G  D ++ + D+        L+ H
Sbjct: 84  LRIYHLRSKRVVRSMKV-SSPVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGH 142

Query: 159 KDAITGI----WCENDDW-LISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMV 213
              I+ +       +  W L S   +G++K+WD+    C+ T   H      L  +    
Sbjct: 143 GATISSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFR---- 198

Query: 214 ITANAESEIKLWELDLERPNGSMLLEKGSYEK-------QSKQRCTELSFTTVADGTTFF 266
             ++A+ ++ L  L   R +   L + GS +K          Q+     F    +    F
Sbjct: 199 -VSDADDDV-LELLSGGRDDIVNLYQLGSTKKVKLVKTIPVHQQIEACGFIHDGEHQDLF 256

Query: 267 YSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPFQLV 326
           Y+   D   +I  + + + I K  K  E+ F         +    + S   L+L    L 
Sbjct: 257 YTAGGDAVYQILSLATASVIKKTNKPIEELFIIG------VLPILQGSKMYLVLSDQTLF 310

Query: 327 RSLFKLKASSWTVCTPSKLELVITTANNTIE--YYSIPYKKKEPLQPTAIKLHSIESPGH 384
             L  L+AS     T   +E  I   + T+    +  P  K   L   +  L  I +P  
Sbjct: 311 --LVDLEASFVEPDTAVVIESKIAGNHGTVADMRFVGPDLKFLALATNSPALRVIPAP-- 366

Query: 385 RTDLRAADISSDDKLLATASNGN------LKVWNIKTKTCIRN-LDCG-----YALCCKF 432
             DL A  I SD+   A     +      L+V   +  T + N LD        A C K 
Sbjct: 367 --DLNAKSIVSDETTAARDHAQDSRDCFPLEVELYEGHTDLLNALDSSEDGKWLATCSK- 423

Query: 433 LPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKR-----LVTASA 487
                 VIL   + +L+ F   +          H   + ++ L +  +      ++TAS 
Sbjct: 424 ---DHTVILWRYSSELEKFKAYAKFT------GHAGPVTAVGLPNVMRSAWPEFIITASN 474

Query: 488 DKTVKFWDF-KVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLD 546
           D T+K W   K   E     + K     +  HD      +D+  + ISP D   A +  D
Sbjct: 475 DLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHD------KDINALSISPNDSTFATASYD 528

Query: 547 NTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLF 606
            T KV+ +DS +   +L  HK  +  +      KL+ T S DK +K+W LD     K+L 
Sbjct: 529 KTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLE 588

Query: 607 AHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAV 666
            H +++    F+ ++    S   DG +K WD ++ +C++ L  H+  +WAL+V  DG   
Sbjct: 589 GHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEF 648

Query: 667 VSVSHDRSIRVWEETEDQ 684
           V+   D   + W++  ++
Sbjct: 649 VTADADGVFQFWKDCSEE 666

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 112/250 (44%), Gaps = 20/250 (8%)

Query: 73  EKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRL 132
           +K   A  +  ++ TF  A    D T K+WD+ +  +     +H   +  + F Q    L
Sbjct: 507 DKDINALSISPNDSTF--ATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLL 564

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQ 191
            + S D T+ +W L   + +  L  H +A+    +   +  L+S   DGLIKLWD+   +
Sbjct: 565 ATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGE 624

Query: 192 CVETHMAHTGECWSLAV--KDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQ 249
           CV T  AH    W+L+V    +  +TA+A+   + W+ D         LE  +++++ +Q
Sbjct: 625 CVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWK-DCSEEQEKENLE--NHKRKVEQ 681

Query: 250 RCTELSFTTVADGT-TFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQ 308
             +  ++ +  D T  F  ++  D  M ++R+    E A A        +E G SD    
Sbjct: 682 DQSLQNYMSQGDWTNAFLLAMTLDHPMRLYRV---LESASA--------QEDGSSDFVFN 730

Query: 309 ESFRNSYANL 318
           E   N  + L
Sbjct: 731 EELDNVISTL 740

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 83/203 (40%), Gaps = 48/203 (23%)

Query: 346 ELVITTANN-TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATAS 404
           E +IT +N+ TI+ +++P    E  +P  +K+       H  D+ A  IS +D   ATAS
Sbjct: 467 EFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATAS 526

Query: 405 -------------------------------------------NGNLKVWNIKTKTCIRN 421
                                                      +  +KVW++ T + ++ 
Sbjct: 527 YDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKT 586

Query: 422 LD--CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDG 479
           L+        C F+     ++     G ++L+DL++   +  ++ AH   IW+L +  DG
Sbjct: 587 LEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLD-AHENRIWALSVLHDG 645

Query: 480 KRLVTASADKTVKFW-DFKVEQE 501
              VTA AD   +FW D   EQE
Sbjct: 646 DEFVTADADGVFQFWKDCSEEQE 668

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 17/143 (11%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W++ +GEL          G +        + ++ QY +   +LA    D T+K+W + 
Sbjct: 532 KVWDVDSGEL---------QGTLANHKRGLWDVSFCQYDK---LLATCSGDKTVKVWSLD 579

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLC--KLRSHKDAIT 163
           T +V+     H++A+    F     +L+S   D  I LWDL   TG C   L +H++ I 
Sbjct: 580 TLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDL--STGECVRTLDAHENRIW 637

Query: 164 GIWCEND-DWLISVSKDGLIKLW 185
            +   +D D  ++   DG+ + W
Sbjct: 638 ALSVLHDGDEFVTADADGVFQFW 660

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 66/153 (43%), Gaps = 5/153 (3%)

Query: 509 KFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 568
           +  P  +++H    D  +++  +K++P+  +L        ++++ L S +   S+     
Sbjct: 44  ELAPTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS- 102

Query: 569 PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----F 624
           PV  +D    S L+     D ++ +  ++ G    SL  H  +I +VKF  E ++     
Sbjct: 103 PVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRL 162

Query: 625 FSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWAL 657
            S   +G VK WD     C+  +  H   V  L
Sbjct: 163 GSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGL 195

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 80/181 (44%), Gaps = 36/181 (19%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           ++ + +++  ++++M+   P   ID                 + ++A+G  DG++ + D+
Sbjct: 84  LRIYHLRSKRVVRSMKVSSPVYVIDCDPS-------------STLVALGGTDGSVSVIDI 130

Query: 105 QTQTVLIVFHSHSSAITILRF----DQTGTRLISGSRDATIILWDLVAETGLCKLRSHKD 160
           +   V      H + I+ ++F    + T  RL SG  +  + +WDLV  + L  ++ H  
Sbjct: 131 ENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAA 190

Query: 161 AITGI---WCENDD---WLISVSKDGLIKLWDM------------KVHQCVET-HMAHTG 201
           A+ G+     + DD    L+S  +D ++ L+ +             VHQ +E     H G
Sbjct: 191 AVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVKLVKTIPVHQQIEACGFIHDG 250

Query: 202 E 202
           E
Sbjct: 251 E 251

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 122/563 (21%), Positives = 224/563 (39%), Gaps = 82/563 (14%)

Query: 155 LRSHKDAITGI--WCENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKD 210
           L+ H   I+ +  + E++D  WL++     ++K+WD+   +C+ T   H+     +  K 
Sbjct: 85  LKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFKQ 144

Query: 211 NM-------VITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGT 263
           +        ++T   ++ I  W +   +   +  L +     Q  + C    F    +  
Sbjct: 145 SSTDSDIIHLVTGGRDNIINHWTISGLK---NFKLIRTFPVHQQVEAC---GFIKSTEDD 198

Query: 264 TFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANLLLHPF 323
              Y+   D   +I  + + + I K  K  E+ F    +      ++F   Y  L     
Sbjct: 199 NCIYTAGGDAVFQILSLSNGSVIKKTKKPTEELFIIGVLP----IKNFTKLYLVLSDQTL 254

Query: 324 QLVRSLFKLKASSWTVC----------TPSKLELV------ITTANNTIEYYSIPYKKKE 367
           QL+  +   +  S  +           T + + LV      I  A N+     IP   ++
Sbjct: 255 QLIDLIDTFEEDSEIITIKSSIAGNHGTIADMRLVGPELKSIALATNSPTLRIIPVISED 314

Query: 368 PLQ--PTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKV-WNIKTKTCIRNLDC 424
                P  ++L+     GH   L + D + D   +ATAS  N  + W         + + 
Sbjct: 315 NKNNIPLGVELYD----GHEDLLNSLDATEDGLWIATASKDNTAMLWRF------NDSEN 364

Query: 425 GYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDG--KRL 482
            +    +F+   + V               +S  L N+              ++G  + +
Sbjct: 365 KFKKYAQFIGHASSV---------------TSVSLPNV-------------INNGWPEFI 396

Query: 483 VTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAV 542
           +T+S D TVK W  KV         D  +  +K+   T     +D+  + I+P D   A 
Sbjct: 397 ITSSNDFTVKKW--KVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFAT 454

Query: 543 SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCH 602
           +  D T K++ LDS +   +L  HK  +  +      K I T+S DK IKIW L+     
Sbjct: 455 ASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVV 514

Query: 603 KSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSD 662
            +L  H +++    F+ +     S   DG +K WD +S +C++ L GH   +WAL V  D
Sbjct: 515 NTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRD 574

Query: 663 GQAVVSVSHDRSIRVWEETEDQV 685
           G  +++   D   + W++  ++V
Sbjct: 575 GDMIITADADGVFQFWKDCTEEV 597

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 91/210 (43%), Gaps = 27/210 (12%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           I A    D T KIWD+ +  ++    +H   +  + F Q    + + S D TI +W L  
Sbjct: 451 IFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLET 510

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
              +  L  H +A+    +      ++S   DGLIK+WD    +C++T   H    W+L 
Sbjct: 511 FKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALC 570

Query: 208 V--KDNMVITANAESEIKLW--------ELDLERPNGSMLLEKGSYEKQSKQRCTELSFT 257
           V    +M+ITA+A+   + W        E DLE+       EK   E++   R       
Sbjct: 571 VLRDGDMIITADADGVFQFWKDCTEEVKEQDLEK-------EKLRVEQEQSLR------N 617

Query: 258 TVADG---TTFFYSLNSDKTMEIFRIRSET 284
            +A+G     F  ++  D  M ++ +  ++
Sbjct: 618 FIANGEWTNAFLLAMTLDHPMRLYNVLKQS 647

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 13/141 (9%)

Query: 46  KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ 105
           K W++ +GEL+ T+ +               + ++ QY +    +A    D TIKIW ++
Sbjct: 462 KIWDLDSGELMATLAN---------HKRGLWDVSFCQYDK---YIATASGDKTIKIWSLE 509

Query: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI 165
           T  V+     H++A+    F     +++S   D  I +WD  +   L  L  H + I  +
Sbjct: 510 TFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWAL 569

Query: 166 WCEND-DWLISVSKDGLIKLW 185
               D D +I+   DG+ + W
Sbjct: 570 CVLRDGDMIITADADGVFQFW 590

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 80  YLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGT-----RLIS 134
           Y +  +  ++LA G  +  +K+WD+  +  +     HSSA+  + F Q+ T      L++
Sbjct: 98  YGESEDSVWLLASGDTN-MVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVT 156

Query: 135 GSRDATIILWDL 146
           G RD  I  W +
Sbjct: 157 GGRDNIINHWTI 168

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 113/269 (42%), Gaps = 49/269 (18%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           E HT  + SLD T+DG  + TAS D +V  W +  + E                      
Sbjct: 387 EGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGLPN 446

Query: 502 ---------LVAGTLDKFVPKMKLIHDTTLDLGEDLWCVK-----------------ISP 535
                    ++  + D  + K K +   T D  EDL  VK                 ISP
Sbjct: 447 VMPRSWPEFIITASNDLTIKKWK-VPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISP 505

Query: 536 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
            D   A +  D T K++ LD  +F  +L  HK  +  +      KL+ T S DK IKIW 
Sbjct: 506 NDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWS 565

Query: 596 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVW 655
           L+     K+L  H +++    F+ ++    S   DG V  WD ++ + ++ L  H   +W
Sbjct: 566 LESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIW 625

Query: 656 ALAVSSDGQAVVSVSHDRSIRVWEETEDQ 684
           ALAV +DG++ V+   D     W +  ++
Sbjct: 626 ALAVMNDGESFVTADADGFFEFWRDNSEE 654

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 3/140 (2%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           + A    D T KIW++          +H   +  + F Q    L + S D TI +W L +
Sbjct: 509 LFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLES 568

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
              +  L  H +A+    +   +  LIS   DGL+ +WD+   + V+T  AH    W+LA
Sbjct: 569 YAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALA 628

Query: 208 VKDN--MVITANAESEIKLW 225
           V ++    +TA+A+   + W
Sbjct: 629 VMNDGESFVTADADGFFEFW 648

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 4/110 (3%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGS 136
           +  + QY +   +LA    D TIKIW +++  V+     H++A+    F     +LIS  
Sbjct: 542 DVAFCQYDK---LLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTG 598

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGIWCEND-DWLISVSKDGLIKLW 185
            D  +I+WDL     +  L +H + I  +   ND +  ++   DG  + W
Sbjct: 599 ADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 82/203 (40%), Gaps = 48/203 (23%)

Query: 346 ELVITTANN-TIEYYSIP-YKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATA 403
           E +IT +N+ TI+ + +P     EP     +K        H  D+ A  IS +D L ATA
Sbjct: 454 EFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATA 513

Query: 404 S-------------------------------------------NGNLKVWNIKTKTCIR 420
           S                                           +  +K+W++++   ++
Sbjct: 514 SYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVK 573

Query: 421 NLD--CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478
            L+        C F+     +I     G + ++DL++   ++ ++ AH   IW+L + +D
Sbjct: 574 TLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLD-AHNNRIWALAVMND 632

Query: 479 GKRLVTASADKTVKFWDFKVEQE 501
           G+  VTA AD   +FW    E+E
Sbjct: 633 GESFVTADADGFFEFWRDNSEEE 655

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF----DQTGTRLISGSRDATIILW 144
           +LA+G  DG++ + D++   V      H + I+ ++F    +    +L SG  +  I +W
Sbjct: 115 LLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVW 174

Query: 145 DLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKL 184
           DLV     C ++ H  A+ G+     D+ ++  + G ++L
Sbjct: 175 DLVKRNCQCTIQEHTTAVRGL-----DFRVTDEEKGTLQL 209

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 66/139 (47%), Gaps = 8/139 (5%)

Query: 67  AIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFD 126
           ++DT+ E+   A +L   + +++  V  A   ++++ ++ Q  +I     SS + ++  D
Sbjct: 54  SVDTEDEQDITALHLT-PDGSYLCFVSQAQ-LLRVYSLK-QERIIRSMKISSPVYVMNCD 110

Query: 127 QTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI----WCENDDW-LISVSKDGL 181
           QT T L  G  D ++ + D+        L+ H   I+ +       ++ W L S   +G+
Sbjct: 111 QTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGM 170

Query: 182 IKLWDMKVHQCVETHMAHT 200
           IK+WD+    C  T   HT
Sbjct: 171 IKVWDLVKRNCQCTIQEHT 189

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 82  QYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF----DQTGT-RLISGS 136
           + + E + LA G  +G IK+WD+  +        H++A+  L F    ++ GT +L+SG 
Sbjct: 154 ELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGG 213

Query: 137 RDATIILWDL 146
           RD  + L++ 
Sbjct: 214 RDNILNLFEF 223

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 121/271 (44%), Gaps = 29/271 (10%)

Query: 437 ALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDF 496
           ++V   +  G L++    +  +++  + AH + I  +D   DG  LVT +A+  ++ W+ 
Sbjct: 195 SMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANGEIRIWNL 254

Query: 497 KVEQELVAGTLD---------KFVPKMKLIHDTTLDLGEDLW------------------ 529
             + E  AGTL          +F P  K +   + D+   LW                  
Sbjct: 255 NNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEV 314

Query: 530 -CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSAD 588
            CV    +   L  + LD+   V+ L S K  ++L GH  P+  +D S +   I T SAD
Sbjct: 315 YCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSAD 374

Query: 589 KNIKIWGLDFGDCHKSLFAHQDSIMNVKF-LPESHNFFSCSKDGTVKYWDGNSFDCIQKL 647
             I++W +       +L AH   +  VKF     H   S S D T+  + G+++  +  +
Sbjct: 375 GTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLSVI 434

Query: 648 YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
            GH  ++ ++ +S+DG  + S   DRS++ W
Sbjct: 435 QGHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 104/260 (40%), Gaps = 30/260 (11%)

Query: 341 TPSKLELVITTANNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLL 400
            P    LV   AN  I  +++    + P              GH   +         K +
Sbjct: 234 NPDGTALVTGAANGEIRIWNLNNDSESPAGTLT---------GHENRVARVRFHPSGKYV 284

Query: 401 ATAS-NGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGALVILGTRAGQLQLFDLASS 456
           A+AS +   ++W+++ +  ++ L  G+A    C  F   G+L+          ++DL S 
Sbjct: 285 ASASFDMTWRLWDVEKQIELQ-LQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSG 343

Query: 457 TMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516
             +  +E  H   I+ LD + +G  + T SAD T++ WD +       G L        +
Sbjct: 344 KSIMALE-GHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRK-----VGILGALPAHNSI 397

Query: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 576
           + +   D               +L  S  D T+ ++  D+      + GH   +LS+DIS
Sbjct: 398 VSEVKFD----------KANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDIS 447

Query: 577 HDSKLIITSSADKNIKIWGL 596
            D   + +S  D+++K W L
Sbjct: 448 TDGSHLFSSGWDRSLKQWSL 467

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 69/154 (44%), Gaps = 12/154 (7%)

Query: 37  VITGALE-EVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           ++TGA   E++ W +          D   P    T  E       +++H     +A    
Sbjct: 240 LVTGAANGEIRIWNLNN--------DSESPAGTLTGHEN--RVARVRFHPSGKYVASASF 289

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T ++WD++ Q  L +   H+  +  + F + G+ L S   D+  ++WDL +   +  L
Sbjct: 290 DMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMAL 349

Query: 156 RSHKDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
             H   I G+ W  N   + + S DG I+LWD++
Sbjct: 350 EGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVR 383

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 67/152 (44%), Gaps = 3/152 (1%)

Query: 531 VKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSL-YGHKLPVLSMDISHDSKLIITSSADK 589
           V IS +D  +A       +K+   ++++   +    H   +  +D + D   ++T +A+ 
Sbjct: 188 VAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANG 247

Query: 590 NIKIWGL--DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL 647
            I+IW L  D      +L  H++ +  V+F P      S S D T + WD      +Q  
Sbjct: 248 EIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQ 307

Query: 648 YGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
            GH  EV+ +A   DG  + S   D    VW+
Sbjct: 308 EGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWD 339

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 69/145 (47%), Gaps = 14/145 (9%)

Query: 47  CWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQT 106
            W++++G+ +  +   + P               L +    + +A G ADGTI++WD++ 
Sbjct: 337 VWDLRSGKSIMALEGHIKP------------IYGLDWSPNGYDIATGSADGTIRLWDVRK 384

Query: 107 QTVLIVFHSHSSAITILRFDQ-TGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI 165
             +L    +H+S ++ ++FD+  G  L+S S D T+ ++     T L  ++ H D I  +
Sbjct: 385 VGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSV 444

Query: 166 WCEND-DWLISVSKDGLIKLWDMKV 189
               D   L S   D  +K W +K+
Sbjct: 445 DISTDGSHLFSSGWDRSLKQWSLKI 469

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 68/137 (49%), Gaps = 6/137 (4%)

Query: 97  GTIKIWDMQTQTVLIVFHS-HSSAITILRFDQTGTRLISGSRDATIILWDLV--AETGLC 153
           G +KI   +T  ++  F + H S I  + ++  GT L++G+ +  I +W+L   +E+   
Sbjct: 204 GDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANGEIRIWNLNNDSESPAG 263

Query: 154 KLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV-KDN 211
            L  H++ +  + +  +  ++ S S D   +LWD++    ++    H  E + +A  KD 
Sbjct: 264 TLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDG 323

Query: 212 MVITANAESEIKL-WEL 227
            ++ +     + L W+L
Sbjct: 324 SLLCSTGLDSVGLVWDL 340

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 70/162 (43%), Gaps = 5/162 (3%)

Query: 73  EKPAEATY-LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTR 131
           E  A+  Y + + ++  +L     D    +WD+++   ++    H   I  L +   G  
Sbjct: 308 EGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYD 367

Query: 132 LISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCE--NDDWLISVSKDGLIKLWDMKV 189
           + +GS D TI LWD+     L  L +H   ++ +  +  N  +L+S S D  + ++    
Sbjct: 368 IATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDN 427

Query: 190 HQCVETHMAHTGECWS--LAVKDNMVITANAESEIKLWELDL 229
              +     HT +  S  ++   + + ++  +  +K W L +
Sbjct: 428 WTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSLKI 469

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 5/120 (4%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALC--CKF-LPGGAL 438
           GH   +   D S +   +AT S +G +++W+++    +  L    ++    KF    G  
Sbjct: 351 GHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHY 410

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV 498
           ++  +    L ++   + T L  I+  HT  I S+D+++DG  L ++  D+++K W  K+
Sbjct: 411 LVSSSYDKTLNIYSGDNWTKLSVIQ-GHTDKILSVDISTDGSHLFSSGWDRSLKQWSLKI 469

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 113/267 (42%), Gaps = 46/267 (17%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           E HT  + SLD + +G+ L T S D TV  W    + E                      
Sbjct: 397 EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPN 456

Query: 502 ---------LVAGTLDKFVPKMKLIHDTTLDLG---------------EDLWCVKISPED 537
                    ++  + D  + K  +   T+ D+                +D+  + ISP D
Sbjct: 457 VMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPND 516

Query: 538 RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLD 597
              A +  D T K++ +DS +   +L  HK  +  +      KL+ T S DK IK+W L+
Sbjct: 517 SVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLE 576

Query: 598 FGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWAL 657
                K+L  H +++    F+  +    S   DG +K WD ++ +CI+ L  H   +WAL
Sbjct: 577 SMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWAL 636

Query: 658 AVSSDGQAVVSVSHDRSIRVWEETEDQ 684
           +V SDG+  V+   D   + W++  ++
Sbjct: 637 SVLSDGKEFVTADADGVFQFWKDCSEE 663

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 104/230 (45%), Gaps = 14/230 (6%)

Query: 3   KSYQRFEQADVFGVVTANSNCVWLPSQAKNS-PGQVITGALE-EVKCWEIKTGELLKTMR 60
           K Y RF      G VTA    V LP+  +N+ P  +IT + +  +K W +          
Sbjct: 437 KPYARFTGH--AGPVTA----VGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDM 490

Query: 61  DGLPPGAIDTKA-EKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
             +       +A EK   A  +  ++  F  A    D T KIW++ +  +     +H   
Sbjct: 491 HNIKVSDYTRRAHEKDINALSISPNDSVF--ATASYDKTCKIWNVDSGELEGTLANHKRG 548

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSK 178
           +  + F Q    L + S D TI +W L + + +  L  H +A+    +   +  ++S   
Sbjct: 549 LWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGA 608

Query: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--MVITANAESEIKLWE 226
           DGLIK+WD+   +C+ T  AH+   W+L+V  +    +TA+A+   + W+
Sbjct: 609 DGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWK 658

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 85/202 (42%), Gaps = 47/202 (23%)

Query: 346 ELVITTANN-TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATAS 404
           E +IT +N+ TI+ +S+P      +    IK+       H  D+ A  IS +D + ATAS
Sbjct: 464 EFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATAS 523

Query: 405 -------------------------------------------NGNLKVWNIKTKTCIRN 421
                                                      +  +KVW++++ + ++ 
Sbjct: 524 YDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKT 583

Query: 422 LD--CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDG 479
           L+        C F+     ++     G ++++DL++   +  ++ AH+  IW+L + SDG
Sbjct: 584 LEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLD-AHSNRIWALSVLSDG 642

Query: 480 KRLVTASADKTVKFWDFKVEQE 501
           K  VTA AD   +FW    E+E
Sbjct: 643 KEFVTADADGVFQFWKDCSEEE 664

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 61/150 (40%), Gaps = 5/150 (3%)

Query: 512 PKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 571
           P  +LIH    D  +++  +K++P   +L        ++++ L S K   S+     PV 
Sbjct: 47  PTKRLIHTIENDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSS-PVY 105

Query: 572 SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSC 627
            MD    S L+     D ++ +  ++ G    S   H  +I +VKF  E         S 
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWAL 657
              G VK WD    +CI  +  H   V  L
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAVRGL 195

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 74/144 (51%), Gaps = 22/144 (15%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           ++ +++ + +++++M+   P   +D  +              + ++A+G  DG++ + D+
Sbjct: 84  LRIYKLSSKKIIRSMKVSSPVYVMDCDSS-------------STLVALGGTDGSVTVVDI 130

Query: 105 QTQTVLIVFHSHSSAITILRF--DQTGT--RLISGSRDATIILWDLVAETGLCKLRSHKD 160
           +   V   F  H + I+ ++F  +Q+G+  RL SG     + +WDLV    +  ++ H  
Sbjct: 131 ENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAA 190

Query: 161 AITGIWCENDDWLISVSKDGLIKL 184
           A+ G+     D+ +S + DG+++L
Sbjct: 191 AVRGL-----DFRLSPADDGVLEL 209

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 77/183 (42%), Gaps = 23/183 (12%)

Query: 112 VFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAET----GLCKLRSHKDAITGIWC 167
           ++  H+  +  L   + G  L + S+D T+ILW L A++       +   H   +T +  
Sbjct: 395 LYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGL 454

Query: 168 EN------DDWLISVSKDGLIKLW--------DMKVHQCV---ETHMAHTGECWSLAV-- 208
            N       +++I+ S D  IK W        D+ +H       T  AH  +  +L++  
Sbjct: 455 PNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISP 514

Query: 209 KDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYS 268
            D++  TA+ +   K+W +D     G++   K      +  +  +L  T   D T   +S
Sbjct: 515 NDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWS 574

Query: 269 LNS 271
           L S
Sbjct: 575 LES 577

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRF-----DQTGTRLISGSRDATIILW 144
           LA G   G +K+WD+  +  +     H++A+  L F     D     L++G RD  + L+
Sbjct: 162 LASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRDDIVNLF 221

Query: 145 DL 146
            L
Sbjct: 222 QL 223

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 134/307 (43%), Gaps = 53/307 (17%)

Query: 394 SSDDKLLATASNGNLKVWNIKTKTCIRNLDCG--------------------YALCCKFL 433
           S+D + LAT  N   +V+   T   I  L                       Y     F 
Sbjct: 407 SNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFS 466

Query: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493
           P G  +  G     ++++D+ +  ++  I + H   I+SLD    G++LV+ S DKTV+ 
Sbjct: 467 PDGKFLAAGAEDKLIRIWDITTKQIVM-ILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRI 525

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSLLDNTVKV- 551
           WD +  Q  +                 TL + + +  V  SP + +F+A   LD + ++ 
Sbjct: 526 WDLRTGQCSL-----------------TLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIW 568

Query: 552 -----FFLDSMKFFLSLY-GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD----- 600
                F L  +     L  GHK  + S+  + D K +++ S D+++K+W LD  +     
Sbjct: 569 DTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNE 628

Query: 601 -CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAV 659
            C  +   H+D +++V          S SKD  V +WD NS + +  L GH+  V ++AV
Sbjct: 629 SCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVAV 688

Query: 660 SSDGQAV 666
            ++GQ +
Sbjct: 689 -ANGQPL 694

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 109/224 (48%), Gaps = 12/224 (5%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
           +H + +  +  ++DG+ L T   +KT + +     + +    +D            T   
Sbjct: 396 SHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPE 454

Query: 525 GEDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLI 582
             DL+   V  SP+ +FLA    D  ++++ + + +  + L GH+  + S+D     + +
Sbjct: 455 SSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKL 514

Query: 583 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYWDGNSF 641
           ++ S DK ++IW L  G C  +L + +D +  V   P +  F +  S D + + WD  + 
Sbjct: 515 VSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETG 573

Query: 642 DCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
             +++L        GH+  +++++ + DG+ +VS S DRS+++W
Sbjct: 574 FLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLW 617

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 104/220 (47%), Gaps = 21/220 (9%)

Query: 35  GQVI-TGALEEVKCWEIKTGELLKTMR-DGLPPGAIDTKAEKPAEATYLQYHEETF---- 88
           GQ + TG  +  + ++  TGEL+ T+  D       +++ +   E++ L      F    
Sbjct: 410 GQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFSPDG 469

Query: 89  -ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLV 147
             LA G  D  I+IWD+ T+ ++++   H   I  L +  +G +L+SGS D T+ +WDL 
Sbjct: 470 KFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDL- 528

Query: 148 AETGLCKLR-SHKDAITGIWC--ENDDWLISVSKDGLIKLWDM-------KVHQCVETHM 197
             TG C L  S +D +T +     N  ++ + S D   ++WD        ++    +   
Sbjct: 529 -RTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQN 587

Query: 198 AHTGECWSLA-VKDN-MVITANAESEIKLWELDLERPNGS 235
            H    +S++  KD   +++ + +  +KLW LD    N +
Sbjct: 588 GHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSN 627

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 92/203 (45%), Gaps = 36/203 (17%)

Query: 25  WLPSQAKNSPGQVITGALEE-VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYL 81
           + PS  K     +++G+ ++ V+ W+++TG+  L  ++ DG     + T +  P    ++
Sbjct: 507 YFPSGEK-----LVSGSGDKTVRIWDLRTGQCSLTLSIEDG-----VTTVSSSPNNGKFI 556

Query: 82  QYHEETFILAVGYADGTIKIWDMQTQTVLIVFHS-------HSSAITILRFDQTGTRLIS 134
                    A G  D + +IWD +T  +L    S       H  +I  + F + G +L+S
Sbjct: 557 ---------AAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVS 607

Query: 135 GSRDATIILWDL------VAETGLCKLRSHKDAITGIW-CENDDWLISVSKDGLIKLWDM 187
           GS D ++ LW+L        E+       HKD +  +   +ND++++S SKD  +  WD 
Sbjct: 608 GSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDT 667

Query: 188 KVHQCVETHMAHTGECWSLAVKD 210
                +     H     S+AV +
Sbjct: 668 NSGNPLLMLQGHKNSVISVAVAN 690

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 19/168 (11%)

Query: 530 CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY------------------GHKLPVL 571
           CV+ S + +FLA    + T +V+   + +   +L                      L + 
Sbjct: 403 CVRFSNDGQFLATGC-NKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIR 461

Query: 572 SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDG 631
           S+  S D K +   + DK I+IW +        L  H+  I ++ + P      S S D 
Sbjct: 462 SVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDK 521

Query: 632 TVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           TV+ WD  +  C   L    G     +  ++G+ + + S DRS R+W+
Sbjct: 522 TVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWD 569

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 95.5 bits (236), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 119/274 (43%), Gaps = 30/274 (10%)

Query: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493
           P G     G+ AG + +F+  +   +    E H+  I  +D +SD + LV+   D  VK 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 494 WDFKVEQELVAGTL---------DKFVPKMKLIHDTTLDLGEDLWCVKISPE-------- 536
           ++F      VA +           KF P  K I   + D    LW +  + E        
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 537 -----------DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITS 585
                         +A +  D    ++ L S K  LSL GH  P+   D S +       
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNG-YQXXX 369

Query: 586 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF-SCSKDGTVKYWDGNSFDCI 644
           S D  IKIW L   D  +++ AH++ + ++KF  E+  F  S S D  +  +  +S+  I
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 645 QKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
             L GH  ++ ++ +SSD Q +VS   DRS+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 110/248 (44%), Gaps = 38/248 (15%)

Query: 384 HRTDLRAADISSDDK-LLATASNGNLKVWN-----IKTKTCIRNLDCGYALCCKFLPGGA 437
           H   +   D SSD + L++   +G +K++N     I+  T     D       KF P   
Sbjct: 223 HSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDA-RVTNVKFHPSQK 281

Query: 438 LVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
            +   +     +L+D+ +++ L  ++E H+  I+SL   +DG  + TA ADK    WD +
Sbjct: 282 YIGSASFDTTWRLWDIVTNSELL-LQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLR 340

Query: 498 VEQELVA-------------------------GTLDKFVPKMKLIHD--TTLDLGEDLWC 530
             + +++                         GT+   +  ++ + D  T L     +  
Sbjct: 341 SGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIK--IWDLRKVDDVETILAHKNVVTD 398

Query: 531 VKISPED-RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADK 589
           +K   E+ +FL  S  D  + VF  DS     +L GH   +LS+DIS D + I++   D+
Sbjct: 399 LKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDR 458

Query: 590 NIKIWGLD 597
           ++K+W ++
Sbjct: 459 SVKLWSME 466

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 2/125 (1%)

Query: 76  AEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISG 135
           A  T +++H     +     D T ++WD+ T + L++   HS  I  L F   G+ + + 
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 136 SRDATIILWDLVAETGLCKLRSHKDAI-TGIWCENDDWLISVSKDGLIKLWDMKVHQCVE 194
             D   I+WDL +   +  L  H   I    W +N  +    S DG IK+WD++    VE
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQN-GYQXXXSGDGTIKIWDLRKVDDVE 387

Query: 195 THMAH 199
           T +AH
Sbjct: 388 TILAH 392

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 66/152 (43%), Gaps = 7/152 (4%)

Query: 533 ISPEDRFLAVSLLDNTVKVFFLDSMK-FFLSLYGHKLPVLSMDISHDSKLIITSSADKNI 591
           ISPE    A       + +F   ++     S   H   +  +D S DS+ +++   D  +
Sbjct: 189 ISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIV 248

Query: 592 KIWGLDFGDCH--KSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD--GNSFDCIQKL 647
           K++  D        S   H   + NVKF P      S S D T + WD   NS   +Q+ 
Sbjct: 249 KLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQE- 307

Query: 648 YGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
            GH  E+++L+  +DG  + +   D+   +W+
Sbjct: 308 -GHSKEIYSLSFQTDGSLIATAGADKVGIIWD 338

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 96/220 (43%), Gaps = 15/220 (6%)

Query: 63  LPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIV--FHSHSSAI 120
           L P  I ++     + + + +  ++  L  G  DG +K+++  + ++ +   F  H + +
Sbjct: 213 LAP-VITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARV 271

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVS-KD 179
           T ++F  +   + S S D T  LWD+V  + L     H   I  +  + D  LI+ +  D
Sbjct: 272 TNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGAD 331

Query: 180 GLIKLWDMKVHQCVETHMAHTGECW-SLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238
            +  +WD++  + + + + H    + S   ++      + +  IK+W+L       ++L 
Sbjct: 332 KVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILA 391

Query: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIF 278
            K           T+L F    + + F  S + DK + +F
Sbjct: 392 HKNV--------VTDLKFE--KENSKFLISSSYDKDINVF 421

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 66/143 (46%), Gaps = 6/143 (4%)

Query: 91  AVGYADGTIKIWDMQT-QTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           A G   G I I++ +T   V+    +HS  I+ + +      L+SG  D  + L++  + 
Sbjct: 197 AAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSN 256

Query: 150 T--GLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSL 206
           +         H   +T + +  +  ++ S S D   +LWD+  +  +     H+ E +SL
Sbjct: 257 SIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSL 316

Query: 207 AVKDN--MVITANAESEIKLWEL 227
           + + +  ++ TA A+    +W+L
Sbjct: 317 SFQTDGSLIATAGADKVGIIWDL 339

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/315 (23%), Positives = 143/315 (45%), Gaps = 25/315 (7%)

Query: 373 AIKLHSIESPGHRT----DLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRN---LDC 424
           A+K  +IE  G +      +    +S +  L+A AS  G+L + N +T   ++N   +  
Sbjct: 164 AMKTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHM 223

Query: 425 GYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIE-EAHTAAIWSLDLTSDGKRLV 483
           G      + P G L+  G   G ++LF   S+T+ E      H   +        G+ + 
Sbjct: 224 GKIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIA 283

Query: 484 TASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVS 543
           +AS D T + WD + ++EL+          ++  H      G++L+ +    +   +   
Sbjct: 284 SASFDMTWRLWDVETQEELL----------LQEGH------GKELYSLGFQCDGSLVCSG 327

Query: 544 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHK 603
            +D    V+ + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + ++
Sbjct: 328 GIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQ 387

Query: 604 SLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDG 663
           ++ AH+  +  V F    +   S   D ++  +   ++  +  L GH  ++  + +S + 
Sbjct: 388 TILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENA 447

Query: 664 QAVVSVSHDRSIRVW 678
            +VVS   DRS+++W
Sbjct: 448 SSVVSCGWDRSVKLW 462

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 70/147 (47%), Gaps = 3/147 (2%)

Query: 82  QYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATI 141
           ++H     +A    D T ++WD++TQ  L++   H   +  L F   G+ + SG  D   
Sbjct: 274 KFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKG 333

Query: 142 ILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHT 200
           ++WD+ +      L  H   I  + W  N   + + S DG I++WD++  +  +T +AH 
Sbjct: 334 LVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHK 393

Query: 201 GECWSLAVK--DNMVITANAESEIKLW 225
                +A +   N ++++  +  I L+
Sbjct: 394 SIVTKVAFEKNGNCLVSSGYDKSINLY 420

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 53/109 (48%), Gaps = 1/109 (0%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L +    + +A G  DGTI+IWD++         +H S +T + F++ G  L+S   D +
Sbjct: 357 LDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKS 416

Query: 141 IILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I L+       L  L+ H D I  +   EN   ++S   D  +KLW M+
Sbjct: 417 INLYGAYNWAQLTTLQGHMDKILCVDISENASSVVSCGWDRSVKLWTMQ 465

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 94/247 (38%), Gaps = 58/247 (23%)

Query: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493
           P G+LV   + AG L + +  +  +L+N  + H   I  +  +  G  +     + +VK 
Sbjct: 190 PNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMGKIGGIHWSPTGDLITAGGEEGSVKL 249

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGED-LWCVKISPEDRFLAVSLLDNTVKVF 552
           + +K      + TL++           TL+  E+ +   K  P  RF+A +  D T +++
Sbjct: 250 FGYK------SNTLEEMA---------TLNGHENRVTDSKFHPSGRFIASASFDMTWRLW 294

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
            +++ +  L   GH   + S+    D  L+ +   D                        
Sbjct: 295 DVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGID------------------------ 330

Query: 613 MNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHD 672
                         C   G V  WD  S      L GH   +++L  S +G  V + S D
Sbjct: 331 --------------CK--GLV--WDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGD 372

Query: 673 RSIRVWE 679
            +IR+W+
Sbjct: 373 GTIRIWD 379

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 126/280 (45%), Gaps = 43/280 (15%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++DL+S  +L  ++  H   I+SLD    G +LV+ 
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 429

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP D +++A   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 545 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD TV+V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 473 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWD 530

Query: 596 L-------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLY 648
           L           C  +   H+D +++V    +     S SKD  V +WD  S + +  L 
Sbjct: 531 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 590

Query: 649 GHQGEVWALAV------SSDGQAVVSVSHDRSIRVWEETE 682
           GH+  V ++AV        D     + S D   R+W+ T+
Sbjct: 591 GHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWKYTK 630

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 101/224 (45%), Gaps = 37/224 (16%)

Query: 39  TGALEEVKCWEIKTGELLKTMRDGLPPG---------AIDTKAEKPAEAT---------- 79
           TG  +  + +++ TGEL+  + D    G         A +   EK  E++          
Sbjct: 310 TGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESSATIQPGSSSD 369

Query: 80  -YLQ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISG 135
            Y++   +  +   LA G  D  I+IWD+ ++ +L+    H   I  L +   G +L+SG
Sbjct: 370 LYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSG 429

Query: 136 SRDATIILWDLVAETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQC 192
           S D T+ +WDL   TG C L  S +D +T +     D  ++ + S D  +++WD +    
Sbjct: 430 SGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFL 487

Query: 193 VET-------HMAHTGECWSLA-VKDNM-VITANAESEIKLWEL 227
           VE           H    +S+   +D   V++ + +  +KLW+L
Sbjct: 488 VERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDL 531

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 91/207 (43%), Gaps = 39/207 (18%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P +  Y+         A G  D T+++W
Sbjct: 435 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AAGSLDRTVRVW 480

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLVAETG---- 151
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LWDL    G    
Sbjct: 481 DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSH 540

Query: 152 -LCKLR--SHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
             C++    HKD +  +    DD +++S SKD  +  WD      +     H     S+A
Sbjct: 541 ATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVA 600

Query: 208 VKDNMVI--------TANAESEIKLWE 226
           V +   +        T + + + ++W+
Sbjct: 601 VVNGFPLGPDIGVFATGSGDCKARIWK 627

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC 627
           L + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S 
Sbjct: 370 LYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSG 429

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           S D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRTVRVWD 481

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 100/227 (44%), Gaps = 24/227 (10%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   + DKL++ + +  +++W+++T  C   L     +    + PG G  +
Sbjct: 409 GHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI 468

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG+ +V+ S D++VK 
Sbjct: 469 AAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKL 528

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF 553
           WD +           K     ++ +    D    +  V  + +D ++     D  V  + 
Sbjct: 529 WDLR------GLNGQKSHATCEVTYTGHKDF---VLSVATTQDDEYILSGSKDRGVLFWD 579

Query: 554 LDSMKFFLSLYGHKLPVLSMDISH------DSKLIITSSADKNIKIW 594
             S    L L GH+  V+S+ + +      D  +  T S D   +IW
Sbjct: 580 TASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 67/150 (44%), Gaps = 20/150 (13%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTM--RDGLPPGAIDTKAEKPAEATYLQYHEE 86
           SPG    +  G+L+  V+ W+ +TG L++ +   + L  G  D+          + +  +
Sbjct: 461 SPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDS-------VYSVVFTRD 513

Query: 87  TFILAVGYADGTIKIWDMQT-------QTVLIVFHSHSSAITILRFDQTGTRLISGSRDA 139
              +  G  D ++K+WD++         T  + +  H   +  +   Q    ++SGS+D 
Sbjct: 514 GRSVVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDR 573

Query: 140 TIILWDLVAETGLCKLRSHKDAITGIWCEN 169
            ++ WD  +   L  L+ H++++  +   N
Sbjct: 574 GVLFWDTASGNPLLMLQGHRNSVISVAVVN 603

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 85/344 (24%), Positives = 143/344 (41%), Gaps = 62/344 (18%)

Query: 357 EYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTK 416
           E Y + Y    P QP  I +    +  H + +     S++ + LAT  N   K++ + T 
Sbjct: 293 EDYYVLYN---PTQPKDIDIELHRTLLHDSVVCCVKFSNNGEYLATGCNKTTKIFEVATG 349

Query: 417 TCIRNL---------DCG-------YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLE 460
             +  L         D         Y     F P G  +  G     ++++D+A   ++ 
Sbjct: 350 NLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVM 409

Query: 461 NIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDT 520
            +   H   I+SLD    G +LV+ S D+T++ WD    Q                    
Sbjct: 410 -VLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQ-----------------CSL 451

Query: 521 TLDLGEDLWCVKISPED-RFLAVSLLDNTVKVFFLDSMKFFL---------SLYGHKLPV 570
           TL + + +  V +SP +  ++A   LD TV+V+  DS   FL         +  GHK  V
Sbjct: 452 TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERLDSEGETGVGHKDSV 509

Query: 571 LSMDISHDSKLIITSSADKNIKIWGLDF-------------GDCHKSLFAHQDSIMNVKF 617
            S+  + D K I++ S D+++K+W L               G+C  +   H+D +++V  
Sbjct: 510 YSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTT 569

Query: 618 LPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSS 661
                   S SKD  V +WD  S   +  L GH+  V ++AV++
Sbjct: 570 TENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVAN 613

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 111/225 (49%), Gaps = 20/225 (8%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTL-DKFVPKMKL-IHDTTLD 523
           H + +  +  +++G+ L T   +KT K +      E+  G L  + V   K    D    
Sbjct: 317 HDSVVCCVKFSNNGEYLATG-CNKTTKIF------EVATGNLVTELVDDTKTGTEDANSA 369

Query: 524 LGEDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKL 581
              DL+   V  SP+ +FLA    D  ++++ +   K  + L GH+  + S+D       
Sbjct: 370 SSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNK 429

Query: 582 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYWDGNS 640
           +++ S D+ I+IW L  G C  +L + +D +  V   P + N+ +  S D TV+ WD NS
Sbjct: 430 LVSGSGDRTIRIWDLHTGQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNS 488

Query: 641 FDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
              +++L        GH+  V+++  + DG+ +VS S DRS+++W
Sbjct: 489 GFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLW 533

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 100/204 (49%), Gaps = 18/204 (8%)

Query: 39  TGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQ---YHEETFILAVGYA 95
           TG  +  K +E+ TG L+  + D    G  D  +   A+  Y++   +  +   LA G  
Sbjct: 335 TGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSAD-LYIRSVCFSPDGKFLATGAE 393

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D  I+IWD+  + +++V   H   I  L + Q+G +L+SGS D TI +WDL   TG C L
Sbjct: 394 DKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDL--HTGQCSL 451

Query: 156 R-SHKDAITGIWCE--NDDWLISVSKDGLIKLWDMKVHQCV-------ETHMAHTGECWS 205
             S +D +T +     N +++ + S D  +++WD      V       ET + H    +S
Sbjct: 452 TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYS 511

Query: 206 LA-VKDNM-VITANAESEIKLWEL 227
           +   +D   +++ + +  +KLW L
Sbjct: 512 VVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 77/179 (43%), Gaps = 23/179 (12%)

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY----------- 564
           L+HD+ +       CVK S    +LA    + T K+F + +      L            
Sbjct: 315 LLHDSVV------CCVKFSNNGEYLATGC-NKTTKIFEVATGNLVTELVDDTKTGTEDAN 367

Query: 565 ---GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 621
                 L + S+  S D K + T + DK I+IW +        L  H+  I ++ +    
Sbjct: 368 SASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSG 427

Query: 622 HNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           +   S S D T++ WD ++  C   L    G V  +AVS  +G  V + S DR++RVW+
Sbjct: 428 NKLVSGSGDRTIRIWDLHTGQCSLTLSIEDG-VTTVAVSPGNGNYVAAGSLDRTVRVWD 485

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 101/231 (43%), Gaps = 46/231 (19%)

Query: 33  SPGQVITGALEE-VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFI 89
           S  ++++G+ +  ++ W++ TG+  L  ++ DG     + T A  P    Y+        
Sbjct: 426 SGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDG-----VTTVAVSPGNGNYV-------- 472

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATII 142
            A G  D T+++WD  +  ++    S       H  ++  + F + G  ++SGS D ++ 
Sbjct: 473 -AAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVK 531

Query: 143 LWDLV----AET-------GLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMK 188
           LW+L     A T       G C++    HKD +  +   END +++S SKD  +  WD  
Sbjct: 532 LWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKV 591

Query: 189 VHQCVETHMAHTGECWSLAVKD--------NMVITANAESEIKLWELDLER 231
               +     H     S+AV +        N+  T + + + K+W+    R
Sbjct: 592 SGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQTIR 642

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/326 (24%), Positives = 143/326 (43%), Gaps = 27/326 (8%)

Query: 361 IPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATAS-NGNLK---VWNIKTK 416
           I Y++    Q   I L   +    R  + +   S DDK LA  S +G +K     ++  K
Sbjct: 155 IKYRRTLAHQLENIGLLGSQIASSRP-ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIK 213

Query: 417 TCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIE-EAHTAAIWSLDL 475
           + + N   G      +   G L+  G   G ++LF + S  + +  + + H   +     
Sbjct: 214 SSVENAHTGKVGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRF 273

Query: 476 TSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISP 535
              G+ + +AS D T + WD +   EL+          ++  H      G++++C+    
Sbjct: 274 HPFGRYIASASFDNTWRLWDAETNHELL----------LQEGH------GKEVFCLAFQS 317

Query: 536 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           +   L  + LD T  ++ + S    + L GH  P+ S+D S     + T+S D  + IW 
Sbjct: 318 DGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWD 377

Query: 596 LDFGDCHKSLFAHQDSIMNVKFLPESHN---FFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652
           +   +  + L AH   +  ++F  E HN     SC  D  +  + G+S++ I  L GH  
Sbjct: 378 IRKTNQPQVLLAHNSIVSGIRF--EKHNGKFLMSCGYDKNINVYSGDSWNKITILKGHTD 435

Query: 653 EVWALAVSSDGQAVVSVSHDRSIRVW 678
           ++ AL + +   +VVS   DRS++ W
Sbjct: 436 KILALDLGTHDGSVVSAGWDRSVKSW 461

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 67/152 (44%), Gaps = 3/152 (1%)

Query: 531 VKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSL-YGHKLPVLSMDISHDSKLIITSSADK 589
           VK SP+D+ LAV   D  +K     S+    S+   H   V  +D +    L+ T   D 
Sbjct: 184 VKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGGEDG 243

Query: 590 NIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL 647
            +K++ +  G+  +   L  H+  +   +F P      S S D T + WD  +   +   
Sbjct: 244 LVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQ 303

Query: 648 YGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
            GH  EV+ LA  SDG  + S   D +  +W+
Sbjct: 304 EGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWD 335

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 73/172 (42%), Gaps = 13/172 (7%)

Query: 32  NSPGQVITGALEE--VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFI 89
           NS G ++    E+  VK + +++GEL +           D +  +   A   ++H     
Sbjct: 230 NSSGDLLATGGEDGLVKLFTVQSGELRQVA---------DLQGHERRVAG-CRFHPFGRY 279

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           +A    D T ++WD +T   L++   H   +  L F   G+ L S   D T ++WD+ + 
Sbjct: 280 IASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSG 339

Query: 150 TGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHT 200
                L  H   I  + W      + + S DG + +WD++     +  +AH 
Sbjct: 340 NCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHN 391

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 93/220 (42%), Gaps = 23/220 (10%)

Query: 383 GHRTDLRAADISSDDKLLATASNGNL-KVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH   +         + +A+AS  N  ++W+ +T   +  L  G+     C  F   G+L
Sbjct: 263 GHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELL-LQEGHGKEVFCLAFQSDGSL 321

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV 498
           +          ++D+ S      +   HT  I+S+D +  G  + TAS D TV  WD + 
Sbjct: 322 LCSAGLDCTGMIWDIRSGNCAM-VLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRK 380

Query: 499 EQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSLLDNTVKVFFLDSM 557
             +          P++ L H++ +        ++    + +FL     D  + V+  DS 
Sbjct: 381 TNQ----------PQVLLAHNSIVS------GIRFEKHNGKFLMSCGYDKNINVYSGDSW 424

Query: 558 KFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLD 597
                L GH   +L++D+      ++++  D+++K W +D
Sbjct: 425 NKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 66/156 (42%), Gaps = 4/156 (2%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGS 136
           E   L +  +  +L     D T  IWD+++    +V   H+  I  + +   G  + + S
Sbjct: 309 EVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATAS 368

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGIWCE--NDDWLISVSKDGLIKLWDMKVHQCVE 194
            D T+ +WD+        L +H   ++GI  E  N  +L+S   D  I ++       + 
Sbjct: 369 GDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKIT 428

Query: 195 THMAHTGECWS--LAVKDNMVITANAESEIKLWELD 228
               HT +  +  L   D  V++A  +  +K W +D
Sbjct: 429 ILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 93/230 (40%), Gaps = 26/230 (11%)

Query: 459 LENI-----EEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPK 513
           LENI     + A +  I S+  + D K L   S D  +K         + AG+L+    K
Sbjct: 165 LENIGLLGSQIASSRPISSVKFSPDDKHLAVGSWDGGIK--------TISAGSLN---IK 213

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDS--MKFFLSLYGHKLPVL 571
             + +  T  +GE  W    +     LA    D  VK+F + S  ++    L GH+  V 
Sbjct: 214 SSVENAHTGKVGEVDW----NSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVA 269

Query: 572 SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLF--AHQDSIMNVKFLPESHNFFSCSK 629
                   + I ++S D   ++W  D    H+ L    H   +  + F  +     S   
Sbjct: 270 GCRFHPFGRYIASASFDNTWRLW--DAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGL 327

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D T   WD  S +C   L GH   ++++  S  G  V + S D ++ +W+
Sbjct: 328 DCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWD 377

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 157/374 (41%), Gaps = 74/374 (19%)

Query: 357 EYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTK 416
           E Y + Y    P  P  +++   +S  H + +     S+D + LAT  N   +V+ +   
Sbjct: 290 EEYDVLYN---PALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATGCNKTTQVFRVSDG 346

Query: 417 TCIRNL---------------DCG----YALCCKFLPGGALVILGTRAGQLQLFDLASST 457
             +  L               D G    Y     F P G  +  G     ++++DLA   
Sbjct: 347 ELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQK 406

Query: 458 MLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLI 517
           ++  + + H   ++SLD    G +LV+ S D+TV+ WD K  Q  +              
Sbjct: 407 IVM-VLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL-------------- 451

Query: 518 HDTTLDLGEDLWCVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLSLY---------GHK 567
              TL + + +  V +SP D +++A   LD  V+V+  DS   FL            GH+
Sbjct: 452 ---TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENELGTGHR 506

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGL-------DFGD---------CHKSLFAHQDS 611
             V S+  + D   +++SS D+++K+W L       +  D         C  +   H+D 
Sbjct: 507 DSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVVCEVTYIGHKDF 566

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSS------DGQA 665
           +++V          S SKD  V +WD N+ + +  L GH+  V ++AV++      + Q 
Sbjct: 567 VLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQV 626

Query: 666 VVSVSHDRSIRVWE 679
             + S D   R+W+
Sbjct: 627 FATGSGDCRARIWK 640

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 99/211 (46%), Gaps = 20/211 (9%)

Query: 35  GQVI-TGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETF----- 88
           GQ + TG  +  + + +  GEL+  + D   P   +      + +T L      F     
Sbjct: 327 GQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGK 386

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
            LA G  D  I+IWD+  Q +++V   H   +  L +  +G +L+SGS D T+ +WDL  
Sbjct: 387 FLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDL-- 444

Query: 149 ETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HMA 198
           +TG C L  S +D +T +     D  ++ + S D  +++WD +    VE           
Sbjct: 445 KTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTG 504

Query: 199 HTGECWSLA-VKD-NMVITANAESEIKLWEL 227
           H    +S+   +D N V++++ +  +KLW L
Sbjct: 505 HRDSVYSVVFTRDGNKVVSSSLDRSVKLWNL 535

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 91/217 (41%), Gaps = 48/217 (22%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W++KTG+  L  ++ DG     + T A  P +  Y+         A G  D  +++W
Sbjct: 439 VRIWDLKTGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AAGSLDRAVRVW 484

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLVA------- 148
           D +T  ++    S       H  ++  + F + G +++S S D ++ LW+L         
Sbjct: 485 DSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENA 544

Query: 149 -------ETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMA 198
                   + +C++    HKD +  +    ND++++S SKD  +  WD      +     
Sbjct: 545 ADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQG 604

Query: 199 HTGECWSLAVKDN--------MVITANAESEIKLWEL 227
           H     S+AV +         +  T + +   ++W+ 
Sbjct: 605 HRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWKF 641

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 102/230 (44%), Gaps = 21/230 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   LV+AS DKT+  W    + + V   +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D TL           +P+  +   +  D T++++ + + + F    GHK  V+S+ I
Sbjct: 67  IVQDVTL-----------TPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAI 115

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK+IK+W +  G C  +L  H D +  V+  P      E+    S   
Sbjct: 116 DRKASMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGN 174

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D  VK W+ N F       GH G V  +  S DG  + S   D  I +W 
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWN 224

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 68/146 (46%), Gaps = 10/146 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++W++ T      F  H S +  +  D+  + +ISGSRD +I +W +  +  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWCENDD-------WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +    +D        +IS   D ++K W++   Q     + H G   ++  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 209 KDN--MVITANAESEIKLWELDLERP 232
             +  ++ +A  + EI LW L  + P
Sbjct: 205 SPDGSLIASAGKDGEIMLWNLADKVP 230

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 76/183 (41%), Gaps = 12/183 (6%)

Query: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-D 171
           F  HS  +  +     G   +S S D T+ LW++       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKAS 120

Query: 172 WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MVITANAESEIK 223
            +IS S+D  IK+W +K  QC+ T + H      + V  N         VI+A  +  +K
Sbjct: 121 MIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVK 179

Query: 224 LWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSE 283
            W L+  +     +   G+    +      L  +   DG    ++L +DK + ++ + ++
Sbjct: 180 AWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNL-ADK-VPMYTLNAQ 237

Query: 284 TEI 286
            E+
Sbjct: 238 DEV 240

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 8/146 (5%)

Query: 37  VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           +I+G+ ++ +K W IK G+ L T+      G  D  ++           E   +++ G  
Sbjct: 122 IISGSRDKSIKVWTIK-GQCLATLL-----GHNDWVSQVRVAPNDKDDDETVTVISAGN- 174

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D  +K W++    +   F  H+  +  +     G+ + S  +D  I+LW+L  +  +  L
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTL 234

Query: 156 RSHKDAITGIWCENDDWLISVSKDGL 181
            +  +     +  N  WL + +  G+
Sbjct: 235 NAQDEVFALAFSPNRYWLAAATASGI 260

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 16/124 (12%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDC-GYALCCKFLPGGALVI 440
           GH  ++     S D  L+A+A  +G + +WN+  K  +  L+         F P    + 
Sbjct: 194 GHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRYWLA 253

Query: 441 LGTRAGQLQLFDLASSTMLENIE----------EAHTAAIWSLDLTSDGKRLVTASADKT 490
             T +G +++F L    +++++           E H     SL  ++DG+ L     D  
Sbjct: 254 AATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAV---SLTWSADGQTLFAGYTDNV 309

Query: 491 VKFW 494
           ++ W
Sbjct: 310 IRVW 313

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 115/264 (43%), Gaps = 29/264 (10%)

Query: 429 CCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEE------------AHTAAIWSLDLT 476
           C +F     LV  G +   ++L+ L  + +   +               H+  ++S+  +
Sbjct: 492 CLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFS 551

Query: 477 SDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPE 536
            D + LV+AS DKTV+ W       LV                +       +W VK SP 
Sbjct: 552 PDNRYLVSASEDKTVRLWSLDTYTCLV----------------SYKGHNHPVWDVKFSPL 595

Query: 537 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596
             + A    D T +++  D +       GH   V  +    +   ++T S+DK  ++W +
Sbjct: 596 GHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

Query: 597 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGH-QGEVW 655
             GD  +    H  S+++V   P+     + S+DG +  WD  +   I+++ GH +  V+
Sbjct: 656 QTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVY 715

Query: 656 ALAVSSDGQAVVSVSHDRSIRVWE 679
           +L+ + +G  +VS   D+S+RVW+
Sbjct: 716 SLSFNKEGNILVSGGADQSVRVWD 739

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 90/186 (48%), Gaps = 18/186 (9%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------F 560
           M   H+T      ++ C++ S + R +A    D+ +K++ LD                  
Sbjct: 480 MYTFHNTN----REMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNT 535

Query: 561 LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
           ++L GH  PV S+  S D++ ++++S DK +++W LD   C  S   H   + +VKF P 
Sbjct: 536 VTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPL 595

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE- 679
            H F + S D T + W  +    ++   GH  +V  +    +G  V++ S D++ R+W+ 
Sbjct: 596 GHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

Query: 680 ETEDQV 685
           +T D V
Sbjct: 656 QTGDSV 661

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 69/142 (48%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A G  D T ++W       L +F  H + +  + F   GT +++GS D T  +WD+   
Sbjct: 599 FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTG 658

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAH-TGECWSLA 207
             +     H  ++  +    D  WL + S+DG+I +WD+   + ++    H     +SL+
Sbjct: 659 DSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLS 718

Query: 208 V--KDNMVITANAESEIKLWEL 227
              + N++++  A+  +++W+L
Sbjct: 719 FNKEGNILVSGGADQSVRVWDL 740

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+QT   + +F  H++++  +     G  L +GS D  
Sbjct: 632 VTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGV 691

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           II+WD+     + ++R H K A+  + + +  + L+S   D  +++WD+K
Sbjct: 692 IIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 96/218 (44%), Gaps = 21/218 (9%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALC--CKFLPGGALV 439
           GH   + +   S D++ L +AS +  +++W++ T TC+ +           KF P G   
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 440 ILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVE 499
             G+     +L+       L  I   H   +  +    +G  ++T S+DKT + WD +  
Sbjct: 600 ATGSHDQTARLWSCDHIYPLR-IFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTG 658

Query: 500 QELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF 559
             +          ++ L H  ++        V +SP+ R+L     D  + V+ + + K 
Sbjct: 659 DSV----------RLFLGHTASV------VSVAVSPDGRWLTTGSEDGVIIVWDIGTGKR 702

Query: 560 FLSLYGH-KLPVLSMDISHDSKLIITSSADKNIKIWGL 596
              + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 703 IKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 67/153 (43%), Gaps = 9/153 (5%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +  +   L     D T+++W + T T L+ +  H+  +  ++F   G    +GS D T
Sbjct: 548 VSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQT 607

Query: 141 IILWDLVAETGLCKLRSHKDAITGIWC----ENDDWLISVSKDGLIKLWDMKVHQCVETH 196
             LW       +  LR     +  + C     N  ++++ S D   ++WD++    V   
Sbjct: 608 ARLWSC---DHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 664

Query: 197 MAHTGECWSLAVKDNM--VITANAESEIKLWEL 227
           + HT    S+AV  +   + T + +  I +W++
Sbjct: 665 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDI 697

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 65/149 (43%), Gaps = 19/149 (12%)

Query: 99  IKIWDMQTQT---VLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           IK+ ++QT      +  FH+ +  +T LRF      + +G +D+ I LW L       +L
Sbjct: 466 IKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQL 525

Query: 156 RSH-KDAITGI-------------WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG 201
            S  KDA   +             +  ++ +L+S S+D  ++LW +  + C+ ++  H  
Sbjct: 526 PSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNH 585

Query: 202 ECWSLAVKD--NMVITANAESEIKLWELD 228
             W +      +   T + +   +LW  D
Sbjct: 586 PVWDVKFSPLGHYFATGSHDQTARLWSCD 614

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQ---------------TQTVLIVFHSHSSAIT 121
           E T L++ +++ ++A G+ D  IK+W +                + TV ++   HS  + 
Sbjct: 489 EMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI--GHSGPVY 546

Query: 122 ILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDG 180
            + F      L+S S D T+ LW L   T L   + H   +  + +     +  + S D 
Sbjct: 547 SVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQ 606

Query: 181 LIKLWDMKVHQCVETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
             +LW       +     H    +C +       V+T +++   ++W++
Sbjct: 607 TARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 399 LLATASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGALVILGTRAGQLQLFDLAS 455
           +L  +S+   ++W+I+T   +R L  G+    +     P G  +  G+  G + ++D+ +
Sbjct: 641 VLTGSSDKTCRMWDIQTGDSVR-LFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGT 699

Query: 456 STMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
              ++ +     +A++SL    +G  LV+  AD++V+ WD K
Sbjct: 700 GKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 85/351 (24%), Positives = 145/351 (41%), Gaps = 77/351 (21%)

Query: 368 PLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNL----- 422
           P  P  I +   +S  H + +     S+D K LAT  N   +V+N+ +   I  L     
Sbjct: 335 PALPRNIDVELHKSLDHTSVVCCVRFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSA 394

Query: 423 ------------DCG-------------------YALCCKFLPGGALVILGTRAGQLQLF 451
                       + G                   Y     F P G  +  G     ++++
Sbjct: 395 SHITPGQNSKDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIW 454

Query: 452 DLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFV 511
           D+A   ++  + + H   I+SLD    G++LV+ S D+TV+ WD +  Q  +        
Sbjct: 455 DIAQKKIIM-VLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSL-------- 505

Query: 512 PKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLSLY------ 564
                    TL + + +  V +SPED +++A   LD  V+V+  DS   FL         
Sbjct: 506 ---------TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENE 554

Query: 565 ---GHKLPVLSMDISHDSKLIITSSADKNIKIWGLD-----------FGDCHKSLFAHQD 610
              GHK  V S+  + D   +++ S D+++K+W L+            G C  +   H+D
Sbjct: 555 LGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKD 614

Query: 611 SIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSS 661
            +++V          S SKD  V +WD  S + +  L GH+  V ++AV++
Sbjct: 615 FVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVAN 665

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 111/240 (46%), Gaps = 30/240 (12%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLG 525
           HT+ +  +  ++DGK L T   +KT + ++     EL+A   D     +    ++    G
Sbjct: 351 HTSVVCCVRFSNDGKFLATG-CNKTTQVYNV-ASGELIARLSDDSASHITPGQNSKDSEG 408

Query: 526 -----------------EDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH 566
                             DL+   V  SP+ +FLA    D  ++++ +   K  + L GH
Sbjct: 409 GEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGH 468

Query: 567 KLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFS 626
           +  + S+D     + +++ S D+ ++IW L  G C  +L + +D +  V   PE   + +
Sbjct: 469 EQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPEDGKYIA 527

Query: 627 C-SKDGTVKYWDGNSFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
             S D  V+ WD  +   +++L        GH+  V+++  + DG  VVS S DRS+++W
Sbjct: 528 AGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLW 587

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 102/226 (45%), Gaps = 36/226 (15%)

Query: 37  VITGALEEVKCWEIKTGELLKTMRDG----LPPGAIDTKAEKPAEAT------------- 79
           + TG  +  + + + +GEL+  + D     + PG     +E   E               
Sbjct: 367 LATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGEENNDTTTYSTSATTSS 426

Query: 80  --YLQ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLIS 134
             Y++   +  +   LA G  D  I+IWD+  + +++V   H   I  L +  +G +L+S
Sbjct: 427 DLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVS 486

Query: 135 GSRDATIILWDLVAETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQ 191
           GS D T+ +WDL   TG C L  S +D +T +    +D  ++ + S D  +++WD +   
Sbjct: 487 GSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGF 544

Query: 192 CVET-------HMAHTGECWSLA-VKD-NMVITANAESEIKLWELD 228
            VE           H    +S+   +D N V++ + +  +KLW L+
Sbjct: 545 LVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLN 590

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 102/232 (43%), Gaps = 49/232 (21%)

Query: 25  WLPSQAKNSPGQVITGALEE-VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYL 81
           + PS  K     +++G+ +  V+ W+++TG+  L  ++ DG     + T A  P +  Y+
Sbjct: 477 YFPSGEK-----LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-----VTTVAVSPEDGKYI 526

Query: 82  QYHEETFILAVGYADGTIKIWDMQTQTVLIVFHS-------HSSAITILRFDQTGTRLIS 134
                    A G  D  +++WD +T  ++    S       H  ++  + F + G  ++S
Sbjct: 527 ---------AAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVS 577

Query: 135 GSRDATIILWDLVAET---------GLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLI 182
           GS D ++ LW+L             G C++    HKD +  +   + D++++S SKD  +
Sbjct: 578 GSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGV 637

Query: 183 KLWDMKVHQCVETHMAHTGECWSLAVKD--------NMVITANAESEIKLWE 226
             WD K    +     H     S+AV +         +  T + + + ++W+
Sbjct: 638 LFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIWK 689

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 570 VLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSK 629
           + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S S 
Sbjct: 430 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSG 489

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSS-DGQAVVSVSHDRSIRVWE 679
           D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+
Sbjct: 490 DRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPEDGKYIAAGSLDRAVRVWD 539

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 96/228 (42%), Gaps = 22/228 (9%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDC--GYALCCKFLPGGALV 439
           GH  D+ + D   S +KL++ + +  +++W+++T  C   L    G          G  +
Sbjct: 467 GHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKYI 526

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG  +V+ S D++VK 
Sbjct: 527 AAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKL 586

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGED-LWCVKISPEDRFLAVSLLDNTVKVF 552
           W+      L         P +    + T    +D +  V  +  D ++     D  V  +
Sbjct: 587 WN------LNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFW 640

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKL------IITSSADKNIKIW 594
              S    L L GH+  V+S+ +++   L        T S D   +IW
Sbjct: 641 DTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIW 688

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 125/280 (44%), Gaps = 43/280 (15%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++DL +  +L  ++  H   I+SLD    G +LV+ 
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 412

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP D +++A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 545 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD TV+V+  DS   FL            GHK  V S+  + D + +I+ S D+++K+W 
Sbjct: 456 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWD 513

Query: 596 L-------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLY 648
           L           C  +   H+D +++V    +     S SKD  V +WD  S + +  L 
Sbjct: 514 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 573

Query: 649 GHQGEVWALAV------SSDGQAVVSVSHDRSIRVWEETE 682
           GH+  V ++AV        D     + S D   R+W+ T+
Sbjct: 574 GHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTK 613

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 99/224 (44%), Gaps = 37/224 (16%)

Query: 39  TGALEEVKCWEIKTGELLKTMRD----------GLPP---GAIDTKAE-----KPAEATY 80
           TG  +  + +++ TGELL  + D             P   G  D   E     +PA ++ 
Sbjct: 293 TGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASSSD 352

Query: 81  LQYHEETF-----ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISG 135
           L      F      LA G  D  I+IWD+ T+ +L+    H   I  L +   G +L+SG
Sbjct: 353 LYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSG 412

Query: 136 SRDATIILWDLVAETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQC 192
           S D T+ +WDL   TG C L  S +D +T +     D  ++ + S D  +++WD +    
Sbjct: 413 SGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFL 470

Query: 193 VET-------HMAHTGECWSLA-VKDNM-VITANAESEIKLWEL 227
           VE           H    +S+   +D   VI+ + +  +KLW+L
Sbjct: 471 VERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL 514

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 91/207 (43%), Gaps = 39/207 (18%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P +  Y+         A G  D T+++W
Sbjct: 418 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AAGSLDRTVRVW 463

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLVAETG---- 151
           D +T  ++    S       H  ++  + F + G  +ISGS D ++ LWDL    G    
Sbjct: 464 DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSH 523

Query: 152 -LCKLR--SHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
             C++    HKD +  +    DD +++S SKD  +  WD      +     H     S+A
Sbjct: 524 ATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVA 583

Query: 208 VKDNMVI--------TANAESEIKLWE 226
           V +   +        T + + + ++W+
Sbjct: 584 VVNGFPLGPDVGVFATGSGDCKARIWK 610

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   + DKL++ + +  +++W+++T  C   L     +    + PG G  +
Sbjct: 392 GHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI 451

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG+ +++ S D++VK 
Sbjct: 452 AAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKL 511

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGED-LWCVKISPEDRFLAVSLLDNTVKVF 552
           WD +       G   +   K     + T    +D +  V  + +D ++     D  V  +
Sbjct: 512 WDLR-------GLNGQ---KSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFW 561

Query: 553 FLDSMKFFLSLYGHKLPVLSMDI------SHDSKLIITSSADKNIKIW 594
              S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 562 DTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 144/318 (45%), Gaps = 63/318 (19%)

Query: 390 AADISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQ 449
           AAD++ D + L T+S+ +  ++       IR      ++C  F P G  +  G     ++
Sbjct: 424 AADLAKDVENLNTSSSPSSDLY-------IR------SVC--FSPDGKFLATGAEDRLIR 468

Query: 450 LFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDK 509
           ++D+ +  ++  I + H   I+SLD    G +LV+ S D+TV+ WD +  Q  +      
Sbjct: 469 IWDIENRKIVM-ILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL------ 521

Query: 510 FVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSLLDNTVKVFFLDSMKFFL------- 561
                      TL + + +  V +SP D +++A   LD  V+V+  DS   FL       
Sbjct: 522 -----------TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSE 568

Query: 562 --SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL------------DFGDCHKSLFA 607
             S  GHK  V S+  + D + +++ S D+++K+W L            + G C  +   
Sbjct: 569 NESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIG 628

Query: 608 HQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDG---- 663
           H+D +++V          S SKD  V +WD  S + +  L GH+  V ++AV++      
Sbjct: 629 HKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPLGP 688

Query: 664 --QAVVSVSHDRSIRVWE 679
                 + S D   R+W+
Sbjct: 689 EYNVFATGSGDCKARIWK 706

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 84/171 (49%), Gaps = 17/171 (9%)

Query: 72  AEKPAEATYLQ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQT 128
           +  P+   Y++   +  +   LA G  D  I+IWD++ + ++++   H   I  L +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 129 GTRLISGSRDATIILWDLVAETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLW 185
           G +L+SGS D T+ +WDL   TG C L  S +D +T +     D  ++ + S D  +++W
Sbjct: 497 GDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

Query: 186 DMKVHQCV-------ETHMAHTGECWSLA-VKDNM-VITANAESEIKLWEL 227
           D +    V       E+   H    +S+   +D   V++ + +  +KLW L
Sbjct: 555 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 96/219 (43%), Gaps = 44/219 (20%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P +  Y+         A G  D  +++W
Sbjct: 509 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AAGSLDRAVRVW 554

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDL--------- 146
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L         
Sbjct: 555 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDS 614

Query: 147 -VAETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGE 202
               +G C++    HKD +  +   +ND++++S SKD  +  WD      +     H   
Sbjct: 615 KTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRNS 674

Query: 203 CWSLAVKD--------NMVITANAESEIKLWELDLERPN 233
             S+AV +        N+  T + + + ++W+     PN
Sbjct: 675 VISVAVANGSPLGPEYNVFATGSGDCKARIWKYRKIAPN 713

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 13/134 (9%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++T    +         T+      G  + +GS D  
Sbjct: 491 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 550

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDMK-V 189
           + +WD  +ETG    R          HKD++ + ++  +   ++S S D  +KLW+++  
Sbjct: 551 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNA 608

Query: 190 HQCVETHMAHTGEC 203
           +   ++   ++G C
Sbjct: 609 NNKSDSKTPNSGTC 622

 Score = 38.5 bits (88), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 71/161 (44%), Gaps = 29/161 (18%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPA---EATY-LQYH 84
           SPG    +  G+L+  V+ W+ +TG L++ +         D++ E      ++ Y + + 
Sbjct: 535 SPGDGKYIAAGSLDRAVRVWDSETGFLVERL---------DSENESGTGHKDSVYSVVFT 585

Query: 85  EETFILAVGYADGTIKIWDMQ------------TQTVLIVFHSHSSAITILRFDQTGTRL 132
            +   +  G  D ++K+W++Q            + T  + +  H   +  +   Q    +
Sbjct: 586 RDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYI 645

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWL 173
           +SGS+D  ++ WD  +   L  L+ H++++  +   N   L
Sbjct: 646 LSGSKDRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPL 686

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 92.4 bits (228), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 121/280 (43%), Gaps = 31/280 (11%)

Query: 432 FLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTV 491
            +   AL   G+ AG +++ D  +  ++  IE  H   I  L   S    LV+ + D  V
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 492 KFWDF----KVEQELVA--GTLDKFV-----PKMKLIHDTTLDLGEDLWCVKISPEDRF- 539
           K   F    K+ +EL A  G   + V     P  + +   + D+   LW ++   E +F 
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 540 ------------------LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKL 581
                             L    LDN   V+ + + K  ++L GH  P+ S+D S D   
Sbjct: 314 EGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYH 373

Query: 582 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES-HNFFSCSKDGTVKYWDGNS 640
           I T   D  I IW +        L AH + +  V+F   + H   SC  D  ++ +  ++
Sbjct: 374 IATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDN 433

Query: 641 FDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEE 680
           +  ++ L GH  ++  + +S D Q +VS   DRS+++W++
Sbjct: 434 WIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQ 473

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 1/109 (0%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +A    D T ++WD++++T L     H   +  L F   G  L SG  D  
Sbjct: 281 VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 141 IILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
            I+WD+     +  L+ H   I  + W  +   + +   DG+I +WD++
Sbjct: 341 AIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIR 389

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 71/154 (46%), Gaps = 4/154 (2%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGS 136
           E   L +  +  +L  G  D    +WD++T   ++    H+  I  + +   G  + +G 
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGIWCENDDW--LISVSKDGLIKLWDMKVHQCVE 194
            D  I +WD+   T   +L +H + +TG+  +      L+S   D  I+++       V+
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 195 THMAHTGECWSLAVKDN--MVITANAESEIKLWE 226
           T   HT +   + + ++  +++++  +  +KLW+
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 60/145 (41%), Gaps = 7/145 (4%)

Query: 90  LAVGYADGTIKIW----DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWD 145
           L  G  D  +KI     D++    L     H+  +  + F  +G  + S S D T  LWD
Sbjct: 244 LVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWD 303

Query: 146 LVAETGLCKLRSHKDAITGIWCENDDWLI-SVSKDGLIKLWDMKVHQCVETHMAHTGECW 204
           + +ET L     H   +  +  +ND  L+ S   D    +WD++  + +     H    +
Sbjct: 304 IESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIY 363

Query: 205 SL--AVKDNMVITANAESEIKLWEL 227
           S+  +     + T   +  I +W++
Sbjct: 364 SVDWSPDGYHIATGGGDGVINIWDI 388

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 116/251 (46%), Gaps = 33/251 (13%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++DL +  ++  ++  H   I+SLD    G +LV+ 
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSG 466

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISP-EDRFLAVSL 544
           S D+TV+ WD      L  GT              TL + + +  V +SP E +F+A   
Sbjct: 467 SGDRTVRIWD------LTTGTCS-----------LTLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 545 LDNTVKVFFLDSMKFFLSL-------YGHKLPVLSMDISHDSKLIITSSADKNIKIWGLD 597
           LD TV+V+  D+      L        GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 598 -------FGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGH 650
                    +C  +   H+D +++V          S SKD  V +WD  S + +  L GH
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 651 QGEVWALAVSS 661
           +  V ++ V++
Sbjct: 630 RNSVISVTVAN 640

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 88/162 (54%), Gaps = 11/162 (6%)

Query: 527 DLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
           DL+   V  SP+ +FLA    D  ++++ L++ K  ++L GH+  + S+D       +++
Sbjct: 406 DLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVS 465

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYWDGNSFDC 643
            S D+ ++IW L  G C  +L + +D +  V   P    F +  S D TV+ WD ++   
Sbjct: 466 GSGDRTVRIWDLTTGTCSLTL-SIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFL 524

Query: 644 IQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           +++L        GH+  V+++  + DG+ VVS S DRS+++W
Sbjct: 525 VERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLW 566

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 75/151 (49%), Gaps = 14/151 (9%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           LA G  D  I+IWD++T+ +++    H   I  L +  +G +L+SGS D T+ +WDL   
Sbjct: 421 LATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT-- 478

Query: 150 TGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HMAH 199
           TG C L  S +D +T +     +  ++ + S D  +++WD      VE           H
Sbjct: 479 TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGH 538

Query: 200 TGECWSLA-VKDNM-VITANAESEIKLWELD 228
               +S+   +D   V++ + +  +KLW L+
Sbjct: 539 RDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 59/113 (52%), Gaps = 2/113 (1%)

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC 627
           L + S+  S D K + T + DK I+IW L+      +L  H+  I ++ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           S D TV+ WD  +  C   L    G V  +AVS  +G+ + + S DR++RVW+
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSIEDG-VTTVAVSPGEGKFIAAGSLDRTVRVWD 518

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 92/214 (42%), Gaps = 34/214 (15%)

Query: 39  TGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADG 97
           TGA ++ ++ W+++T +++ T++                +   L Y      L  G  D 
Sbjct: 423 TGAEDKLIRIWDLETKKIVMTLKG------------HEQDIYSLDYFPSGNKLVSGSGDR 470

Query: 98  TIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLR- 156
           T++IWD+ T T  +         T+      G  + +GS D T+ +WD  ++TG    R 
Sbjct: 471 TVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD--SDTGFLVERL 528

Query: 157 --------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDM------KVH-QCVETHMAHT 200
                    H+D++ + ++  +   ++S S D  +KLW++      K H +C  T+  H 
Sbjct: 529 DSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHK 588

Query: 201 GECWSLAV--KDNMVITANAESEIKLWELDLERP 232
               S+A    D  +++ + +  +  W+     P
Sbjct: 589 DFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNP 622

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%)

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSH 671
           I +V F P+     + ++D  ++ WD  +   +  L GH+ ++++L     G  +VS S 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 672 DRSIRVWEET 681
           DR++R+W+ T
Sbjct: 469 DRTVRIWDLT 478

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 66/150 (44%), Gaps = 20/150 (13%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTM--RDGLPPGAIDTKAEKPAEATYLQYHEE 86
           SPG+   +  G+L+  V+ W+  TG L++ +   + L  G  D+          + +  +
Sbjct: 498 SPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDS-------VYSVVFTRD 550

Query: 87  TFILAVGYADGTIKIWDMQTQT-------VLIVFHSHSSAITILRFDQTGTRLISGSRDA 139
              +  G  D ++K+W++   +         + +  H   +  +   Q    ++SGS+D 
Sbjct: 551 GKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDR 610

Query: 140 TIILWDLVAETGLCKLRSHKDAITGIWCEN 169
            ++ WD  +   L  L+ H++++  +   N
Sbjct: 611 GVLFWDTKSGNPLLMLQGHRNSVISVTVAN 640

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 125/282 (44%), Gaps = 48/282 (17%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++D+ +  ++  I + H   I+SLD    G +LV+ 
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVM-ILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP D +++A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 545 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 596 L------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           L            + G C  +   H+D +++V          S SKD  V +WD  S + 
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 644 IQKLYGHQGEVWALAVSSDG------QAVVSVSHDRSIRVWE 679
           +  L GH+  V ++AV++            + S D   R+W+
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 89/170 (52%), Gaps = 11/170 (6%)

Query: 519 DTTLDLGEDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 576
           +T+     DL+   V  SP+ +FLA    D  ++++ +++ K  + L GH+  + S+D  
Sbjct: 435 NTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYF 494

Query: 577 HDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKY 635
                +++ S D+ ++IW L  G C  +L + +D +  V   P    + +  S D  V+ 
Sbjct: 495 PSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRV 553

Query: 636 WDGNSFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           WD  +   +++L        GH+  V+++  + DGQ+VVS S DRS+++W
Sbjct: 554 WDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLW 603

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 84/171 (49%), Gaps = 17/171 (9%)

Query: 72  AEKPAEATYLQ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQT 128
           +  P+   Y++   +  +   LA G  D  I+IWD++ + ++++   H   I  L +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 129 GTRLISGSRDATIILWDLVAETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLW 185
           G +L+SGS D T+ +WDL   TG C L  S +D +T +     D  ++ + S D  +++W
Sbjct: 497 GDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

Query: 186 DMKVHQCV-------ETHMAHTGECWSLA-VKDNM-VITANAESEIKLWEL 227
           D +    V       E+   H    +S+   +D   V++ + +  +KLW L
Sbjct: 555 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 104/229 (45%), Gaps = 45/229 (19%)

Query: 36  QVITGALEE-VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92
           ++++G+ +  V+ W+++TG+  L  ++ DG     + T A  P +  Y+         A 
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AA 544

Query: 93  GYADGTIKIWDMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWD 145
           G  D  +++WD +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+
Sbjct: 545 GSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 146 L----------VAETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQC 192
           L             +G C++    HKD +  +   +ND++++S SKD  +  WD K    
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 193 VETHMAHTGECWSLAVKD--------NMVITANAESEIKLWELDLERPN 233
           +     H     S+AV +        N+  T + + + ++W+     PN
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN 713

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 100/227 (44%), Gaps = 19/227 (8%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   S DKL++ + +  +++W+++T  C   L     +    + PG G  +
Sbjct: 483 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI 542

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG+ +V+ S D++VK 
Sbjct: 543 AAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKL 602

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF 553
           W+ +          D   P       T +   + +  V  +  D ++     D  V  + 
Sbjct: 603 WNLQNAN----NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

Query: 554 LDSMKFFLSLYGHKLPVLSMDISHDSKL------IITSSADKNIKIW 594
             S    L L GH+  V+S+ +++ S L        T S D   +IW
Sbjct: 659 KKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC 627
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           S D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 13/134 (9%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++T    +         T+      G  + +GS D  
Sbjct: 491 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 550

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDMK-V 189
           + +WD  +ETG    R          HKD++ + ++  +   ++S S D  +KLW+++  
Sbjct: 551 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNA 608

Query: 190 HQCVETHMAHTGEC 203
           +   ++   ++G C
Sbjct: 609 NNKSDSKTPNSGTC 622

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 71/161 (44%), Gaps = 29/161 (18%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPA---EATY-LQYH 84
           SPG    +  G+L+  V+ W+ +TG L++ +         D++ E      ++ Y + + 
Sbjct: 535 SPGDGKYIAAGSLDRAVRVWDSETGFLVERL---------DSENESGTGHKDSVYSVVFT 585

Query: 85  EETFILAVGYADGTIKIWDMQ------------TQTVLIVFHSHSSAITILRFDQTGTRL 132
            +   +  G  D ++K+W++Q            + T  + +  H   +  +   Q    +
Sbjct: 586 RDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYI 645

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWL 173
           +SGS+D  ++ WD  +   L  L+ H++++  +   N   L
Sbjct: 646 LSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPL 686

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 127/295 (43%), Gaps = 40/295 (13%)

Query: 387 DLRAADISSDDKLLATA-SNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRA 445
           D+ + + S D +L A    +  +K+W++   + I N    Y                 + 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSY-----------------KR 526

Query: 446 GQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAG 505
            +++  D A+ST++      H+ +++S   + D + L++ S DKTV+ W       LV+ 
Sbjct: 527 KEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVS- 580

Query: 506 TLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYG 565
                                 +W VK SP   + A +  D T +++  D +       G
Sbjct: 581 ---------------YKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 625

Query: 566 HKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 625
           H   V ++    +   + T S+DK  ++W +  GD  +  + H   I++    P+     
Sbjct: 626 HLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLC 685

Query: 626 SCSKDGTVKYWDGNSFDCIQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           + S DG +  WD  +   I+++ GH +  V +L ++ +G  ++S   D S+RVW+
Sbjct: 686 TGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWD 740

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 23/185 (12%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFL------------ 561
           M   H+T      D+  ++ S + R  A    D+ +K++ LD                  
Sbjct: 475 MYTFHNTN----RDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEME 530

Query: 562 -------SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMN 614
                  +L GH   V S   S DS+ +++ S DK +++W LD      S   H   + +
Sbjct: 531 TTDPATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWD 590

Query: 615 VKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRS 674
           VKF P  H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++
Sbjct: 591 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKT 650

Query: 675 IRVWE 679
            R+W+
Sbjct: 651 CRMWD 655

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H S +  + F   G  + +GS D T  +WD+   
Sbjct: 600 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTG 659

Query: 150 TGLCKLRSHKDAI-TGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGEC---WS 205
             +     H   I + +   +  WL + S DGLI LWD+   + ++    H        +
Sbjct: 660 DSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLT 719

Query: 206 LAVKDNMVITANAESEIKLWEL 227
           L  + N++++  A+  +++W+L
Sbjct: 720 LNKEGNVLLSGGADHSVRVWDL 741

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   +  F  H++ I        G  L +GS D  
Sbjct: 633 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGL 692

Query: 141 IILWDLVAETGLCKLRSH-KDAITGIWCEND-DWLISVSKDGLIKLWDMK 188
           I LWD+     + ++R H K+A+  +    + + L+S   D  +++WD+K
Sbjct: 693 INLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 66/173 (38%), Gaps = 22/173 (12%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQ-------------------TQTVLIVFHSHS 117
           + T L++ +++ + A G+ D  IK+W +                    T         HS
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 118 SAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISV 176
            ++    F      L+SGS D T+ LW L   T L   + H   +  + +     +  + 
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--MVITANAESEIKLWEL 227
           S D   +LW       +     H  +  +++   N   V T +++   ++W++
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDI 656

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 5/149 (3%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRN--LDCGYALCCKFLPGGALV 439
           GH +D+       +   + T +S+   ++W+I T   +R   +     L     P G  +
Sbjct: 625 GHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWL 684

Query: 440 ILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVE 499
             G+  G + L+D+ +   ++ +      A+ SL L  +G  L++  AD +V+ WD K  
Sbjct: 685 CTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK-- 742

Query: 500 QELVAGTLDKFVPKMKLIHDTTLDLGEDL 528
           +      L+   P +  I D T  + +D+
Sbjct: 743 KATNEPGLEPEQPFIGHIGDVTASINQDV 771

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L  G  DG I +WD+ T   +     H  +A+  L  ++ G  L+SG  D ++ +WDL  
Sbjct: 684 LCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLKK 743

Query: 149 ETGLCKLRSHKDAITGI 165
            T    L   +  I  I
Sbjct: 744 ATNEPGLEPEQPFIGHI 760

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 115/226 (50%), Gaps = 15/226 (6%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQ---ELVAGTLDKFVPKMKLIHDTTL 522
           H + +  +  + DGK L T   ++T + +D    +   +L+  T++  +      ++ T+
Sbjct: 278 HDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETV 336

Query: 523 DLGEDLWCVKI--SPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSK 580
               DL+   I  SP+  FLA    D  ++++ +   K  + L GH+  + S+D   D +
Sbjct: 337 TTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQ 396

Query: 581 LIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYWDGN 639
            +++ S D++I+IW L  G C  +L + +D +  V   P      +  S D +V+ WD +
Sbjct: 397 KLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSS 455

Query: 640 SFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           +   +++L        GHQ  V+++A + DGQ VVS S DR++++W
Sbjct: 456 TGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 80/352 (22%), Positives = 147/352 (41%), Gaps = 71/352 (20%)

Query: 369 LQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKT-KTCIRNLDCG-- 425
           L PT + +  + S  H + +     S D K LAT  N   +++++ T +  ++ LD    
Sbjct: 263 LTPTELDVDLLHSLPHDSVVCCVKFSQDGKYLATGCNRTTQIFDVATGELYVKLLDDTVN 322

Query: 426 --------------------YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEA 465
                               Y     F P G  +  G     ++++++    ++  + + 
Sbjct: 323 TAIVTTTTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVM-VLKG 381

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQ----------------------ELV 503
           H   I+SLD   DG++LV+ S D++++ WD K  Q                       + 
Sbjct: 382 HEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIA 441

Query: 504 AGTLDK-----------FVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVF 552
           AG+LD+            V ++   +++     + ++ V  + + + +    LD TVK++
Sbjct: 442 AGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

Query: 553 FLD-----SMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFA 607
            L      + K  ++  GHK  VLS+  S+D K I + S D+ + IW  D G+    L  
Sbjct: 502 NLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQG 561

Query: 608 HQDSIMNVKFLPESHNFFSCSKDG-TVKYWDGNSFDCIQKL--YGHQGEVWA 656
           H++S+++V  +       S   DG   K +   S DC  ++  Y   GEV A
Sbjct: 562 HRNSVISVATV------NSNVDDGKNYKLFATGSGDCKARIWKYFKMGEVTA 607

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 14/150 (9%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           LA G  D  I+IW+++ + +++V   H   I  L +   G +L+SGS D +I +WDL  +
Sbjct: 356 LATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDL--K 413

Query: 150 TGLCKLR-SHKDAITGIWCE-NDDWLISV-SKDGLIKLWDMKVHQCV-------ETHMAH 199
           TG C L  S +D +T +    N+  LI+  S D  +++WD      V       E+   H
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGH 473

Query: 200 TGECWSLA-VKDNM-VITANAESEIKLWEL 227
               +S+A  KD   V++ + +  +KLW L
Sbjct: 474 QDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 79/174 (45%), Gaps = 24/174 (13%)

Query: 530 CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHK---------------------L 568
           CVK S + ++LA    + T ++F + + + ++ L                         L
Sbjct: 284 CVKFSQDGKYLATGC-NRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVTTTADL 342

Query: 569 PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCS 628
            + S+  S D + + T + DK I+IW +        L  H+  I ++ + P+     S S
Sbjct: 343 YIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGS 402

Query: 629 KDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWEET 681
            D +++ WD  +  C   L    G V  +AVS ++G+ + + S DRS+R+W+ +
Sbjct: 403 GDRSIRIWDLKTGQCSLTLSIEDG-VTTVAVSPNEGKLIAAGSLDRSVRIWDSS 455

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 93  GYADGTIKIW---DMQTQT--VLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLV 147
           G  D T+K+W   D Q+ T    + +  H   +  +        + SGS+D  +I+WD  
Sbjct: 492 GSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKD 551

Query: 148 AETGLCKLRSHKDAITGIWCENDD 171
           +   +  L+ H++++  +   N +
Sbjct: 552 SGNPILMLQGHRNSVISVATVNSN 575

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 118/258 (45%), Gaps = 42/258 (16%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++D+ +  ++  I + H   I+SLD    G +LV+ 
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVM-ILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP D +++A   
Sbjct: 508 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 550

Query: 545 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 551 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWN 608

Query: 596 L------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           L            + G C  +   H+D +++V          S SKD  V +WD  S + 
Sbjct: 609 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 668

Query: 644 IQKLYGHQGEVWALAVSS 661
           +  L GH+  V ++AV++
Sbjct: 669 LLMLQGHRNSVISVAVAN 686

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 86/162 (53%), Gaps = 11/162 (6%)

Query: 527 DLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
           DL+   V  SP+ +FLA    D  ++++ +++ K  + L GH+  + S+D       +++
Sbjct: 447 DLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVS 506

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYWDGNSFDC 643
            S D+ ++IW L  G C  +L + +D +  V   P    + +  S D  V+ WD  +   
Sbjct: 507 GSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFL 565

Query: 644 IQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           +++L        GH+  V+++  + DG++VVS S DRS+++W
Sbjct: 566 VERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 76/150 (50%), Gaps = 14/150 (9%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           LA G  D  I+IWD++ + ++++   H   I  L +  +G +L+SGS D T+ +WDL   
Sbjct: 462 LATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL--R 519

Query: 150 TGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCV-------ETHMAH 199
           TG C L  S +D +T +     D  ++ + S D  +++WD +    V       E+   H
Sbjct: 520 TGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGH 579

Query: 200 TGECWSLA-VKDN-MVITANAESEIKLWEL 227
               +S+   +D   V++ + +  +KLW L
Sbjct: 580 KDSVYSVVFTRDGESVVSGSLDRSVKLWNL 609

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 85/188 (45%), Gaps = 36/188 (19%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P +  Y+         A G  D  +++W
Sbjct: 513 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AAGSLDRAVRVW 558

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDL--------- 146
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L         
Sbjct: 559 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDS 618

Query: 147 -VAETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGE 202
               +G C++    HKD +  +   +ND++++S SKD  +  WD K    +     H   
Sbjct: 619 KTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNS 678

Query: 203 CWSLAVKD 210
             S+AV +
Sbjct: 679 VISVAVAN 686

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC 627
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           S D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWD 559

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 94/208 (45%), Gaps = 13/208 (6%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   S DKL++ + +  +++W+++T  C   L     +    + PG G  +
Sbjct: 487 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI 546

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG+ +V+ S D++VK 
Sbjct: 547 AAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKL 606

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF 553
           W+ +          D   P       T +   + +  V  +  D ++     D  V  + 
Sbjct: 607 WNLQNAN----NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 662

Query: 554 LDSMKFFLSLYGHKLPVLSMDISHDSKL 581
             S    L L GH+  V+S+ +++ S L
Sbjct: 663 KKSGNPLLMLQGHRNSVISVAVANGSPL 690

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 61/134 (45%), Gaps = 13/134 (9%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++T    +         T+      G  + +GS D  
Sbjct: 495 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 554

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDMK-V 189
           + +WD  +ETG    R          HKD++ + ++  + + ++S S D  +KLW+++  
Sbjct: 555 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNA 612

Query: 190 HQCVETHMAHTGEC 203
           +   ++   ++G C
Sbjct: 613 NNKSDSKTPNSGTC 626

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 66/153 (43%), Gaps = 21/153 (13%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETF 88
           SPG    +  G+L+  V+ W+ +TG L++ +      G   T  +    +       E+ 
Sbjct: 539 SPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESG---TGHKDSVYSVVFTRDGESV 595

Query: 89  ILAVGYADGTIKIWDMQ------------TQTVLIVFHSHSSAITILRFDQTGTRLISGS 136
           +   G  D ++K+W++Q            + T  + +  H   +  +   Q    ++SGS
Sbjct: 596 V--SGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGS 653

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGIWCEN 169
           +D  ++ WD  +   L  L+ H++++  +   N
Sbjct: 654 KDRGVLFWDKKSGNPLLMLQGHRNSVISVAVAN 686

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 123/282 (43%), Gaps = 48/282 (17%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++D+    ++  I + H   I+SLD    G +LV+ 
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVM-ILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP D +++A   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 545 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD  V+V+  DS   FL         S  GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 596 L------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           L            + G C  +   H+D +++V          S SKD  V +WD  S + 
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 644 IQKLYGHQGEVWALAVSSDG------QAVVSVSHDRSIRVWE 679
           +  L GH+  V ++AV++            + S D   R+W+
Sbjct: 661 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 11/170 (6%)

Query: 519 DTTLDLGEDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 576
           +T+     DL+   V  SP+ +FLA    D  ++++ ++  K  + L GH+  + S+D  
Sbjct: 431 NTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYF 490

Query: 577 HDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKY 635
                +++ S D+ ++IW L  G C  +L + +D +  V   P    + +  S D  V+ 
Sbjct: 491 PSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRV 549

Query: 636 WDGNSFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           WD  +   +++L        GH+  V+++  + DG +VVS S DRS+++W
Sbjct: 550 WDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLW 599

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 85/171 (49%), Gaps = 17/171 (9%)

Query: 72  AEKPAEATYLQ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQT 128
           +  P+   Y++   +  +   LA G  D  I+IWD++ + ++++   H   I  L +  +
Sbjct: 433 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPS 492

Query: 129 GTRLISGSRDATIILWDLVAETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLW 185
           G +L+SGS D T+ +WDL   TG C L  S +D +T +     D  ++ + S D  +++W
Sbjct: 493 GDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 550

Query: 186 DMKVHQCV-------ETHMAHTGECWSLA-VKD-NMVITANAESEIKLWEL 227
           D +    V       E+   H    +S+   +D + V++ + +  +KLW L
Sbjct: 551 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNL 601

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 104/229 (45%), Gaps = 45/229 (19%)

Query: 36  QVITGALEE-VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92
           ++++G+ +  V+ W+++TG+  L  ++ DG     + T A  P +  Y+         A 
Sbjct: 495 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AA 540

Query: 93  GYADGTIKIWDMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWD 145
           G  D  +++WD +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+
Sbjct: 541 GSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 146 L----------VAETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQC 192
           L             +G C++    HKD +  +   +ND++++S SKD  +  WD K    
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 193 VETHMAHTGECWSLAVKD--------NMVITANAESEIKLWELDLERPN 233
           +     H     S+AV +        N+  T + + + ++W+     PN
Sbjct: 661 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN 709

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC 627
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           S D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWD 551

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 13/134 (9%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++T    +         T+      G  + +GS D  
Sbjct: 487 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 546

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDMK-V 189
           + +WD  +ETG    R          HKD++ + ++  +   ++S S D  +KLW+++  
Sbjct: 547 VRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNA 604

Query: 190 HQCVETHMAHTGEC 203
           +   ++   ++G C
Sbjct: 605 NNKSDSKAPNSGTC 618

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 71/161 (44%), Gaps = 29/161 (18%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPA---EATY-LQYH 84
           SPG    +  G+L+  V+ W+ +TG L++ +         D++ E      ++ Y + + 
Sbjct: 531 SPGDGKYIAAGSLDRAVRVWDSETGFLVERL---------DSENESGTGHKDSVYSVVFT 581

Query: 85  EETFILAVGYADGTIKIWDMQ------------TQTVLIVFHSHSSAITILRFDQTGTRL 132
            +   +  G  D ++K+W++Q            + T  + +  H   +  +   Q    +
Sbjct: 582 RDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYI 641

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWL 173
           +SGS+D  ++ WD  +   L  L+ H++++  +   N   L
Sbjct: 642 LSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPL 682

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 99/217 (45%), Gaps = 19/217 (8%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   + D + L++ S DKTV+ W       LV+                    
Sbjct: 523 GHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVS----------------YKGH 566

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSMDISHDSKLII 583
              +W V+ SP   + A +  D T +++  D + F L ++ GH   V  +    +   + 
Sbjct: 567 NHPIWDVQFSPLGHYFATASHDQTARLWSCDHI-FPLRIFAGHLNDVDCVSFHPNGYYVF 625

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           T S+DK  ++W +  GD  +    H  ++++    P+     + S DGT+  WD  S   
Sbjct: 626 TGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKR 685

Query: 644 IQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           ++ L GH +  V++L  S +G  +VS   D+S+RVW+
Sbjct: 686 LKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWD 722

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 562 SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 621
           +L GH   V S   S D++ +I+ S DK +++W LD      S   H   I +V+F P  
Sbjct: 520 TLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLG 579

Query: 622 HNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE-E 680
           H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+  
Sbjct: 580 HYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDIS 639

Query: 681 TEDQV 685
           T D V
Sbjct: 640 TGDSV 644

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 84/200 (42%), Gaps = 28/200 (14%)

Query: 424 CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLV 483
            G      F P    +I G+    ++L+ L + T L + +  H   IW +  +  G    
Sbjct: 525 SGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYK-GHNHPIWDVQFSPLGHYFA 583

Query: 484 TASADKTVKFW--DFKVEQELVAGTLD-----KFVPKMKLIHDTTLDLGEDLWCVK---- 532
           TAS D+T + W  D      + AG L+      F P    +   + D    +W +     
Sbjct: 584 TASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDS 643

Query: 533 ---------------ISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSMDIS 576
                          +SP+ R+L     D T+ V+ + S K   SL GH K  V S+  S
Sbjct: 644 VRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYS 703

Query: 577 HDSKLIITSSADKNIKIWGL 596
            +  L+++S AD+++++W L
Sbjct: 704 KEGNLLVSSGADQSVRVWDL 723

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 2/109 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H   + +  G +D T ++WD+ T   + +F  H+SA+        G  L +GS D T
Sbjct: 615 VSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGT 674

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDM 187
           I +WD+ +   L  LR H K+A+  + + +  + L+S   D  +++WD+
Sbjct: 675 INVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/217 (20%), Positives = 76/217 (35%), Gaps = 31/217 (14%)

Query: 42  LEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKI 101
           LE  K  E +    L T  + LP   + T      + T L++ ++  + + G+ D  IKI
Sbjct: 422 LEIQKVRESRESIRLDTNPNSLPSVCMYTFHNTNQDMTSLEFSDDCRLASTGFQDSYIKI 481

Query: 102 WDMQTQTVLIVFH----------------------------SHSSAITILRFDQTGTRLI 133
           W +   ++   F                              HS  +    F      LI
Sbjct: 482 WSLDGTSLNTKFTQANKDRNRITITDRSLTHMDNELSATLIGHSGTVYSTSFSPDNRYLI 541

Query: 134 SGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQC 192
           SGS D T+ LW L   T L   + H   I  + +     +  + S D   +LW       
Sbjct: 542 SGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHIFP 601

Query: 193 VETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
           +     H    +C S       V T +++   ++W++
Sbjct: 602 LRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDI 638

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 101/219 (46%), Gaps = 19/219 (8%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+ AI+S   + D K LV+AS DKT++ W       LV                T    
Sbjct: 551 GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV----------------TYKGH 594

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSMDISHDSKLII 583
              +W V+ SP   + A +  D T +++  D + F L ++ GH   V  +    +   I 
Sbjct: 595 NHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYIF 653

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           T S+DK  ++W +  G+  +    H   I++V   P+     + S+DG +  WD  +   
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKS 713

Query: 644 IQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWEET 681
           ++KL GH +  V +L+ + +   +VS   D S+R+W+ T
Sbjct: 714 LKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 91/220 (41%), Gaps = 28/220 (12%)

Query: 424 CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLV 483
            G      F P   L++  +    ++L+ + + T L   +  H   +W +  +  G    
Sbjct: 553 SGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYK-GHNHPVWDVQFSPVGHYFA 611

Query: 484 TASADKTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLA 541
           TAS D+T + W  D      + +G +                   D+ CV   P   ++ 
Sbjct: 612 TASHDQTARLWSCDHIFPLRIFSGHI------------------SDVDCVTFHPNGCYIF 653

Query: 542 VSLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
               D T +++ +   +S++ F+   GH  P+LS+ ++ D   + T S D  I IW +  
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFI---GHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGT 710

Query: 599 GDCHKSLFAHQDSIMN-VKFLPESHNFFSCSKDGTVKYWD 637
           G   K L  H  S +N + +  ES+   S   D +V+ WD
Sbjct: 711 GKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWD 750

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 61/121 (50%)

Query: 561 LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
           + L GH   + S   S D+KL++++S DK I++W +D      +   H   + +V+F P 
Sbjct: 547 VKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPV 606

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEE 680
            H F + S D T + W  +    ++   GH  +V  +    +G  + + S D++ R+W+ 
Sbjct: 607 GHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDI 666

Query: 681 T 681
           T
Sbjct: 667 T 667

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 65/145 (44%), Gaps = 9/145 (6%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           +L     D TI++W M T+T L+ +  H+  +  ++F   G    + S D T  LW    
Sbjct: 567 LLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSC-- 624

Query: 149 ETGLCKLRSHKDAITGIWC----ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECW 204
              +  LR     I+ + C     N  ++ + S D   ++WD+   + V   + HT    
Sbjct: 625 -DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPIL 683

Query: 205 SLAVKDN--MVITANAESEIKLWEL 227
           S+AV  +   + T + +  I +W++
Sbjct: 684 SVAVAPDGLRLATGSEDGVIHIWDI 708

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 2/111 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ I  +     G RL +GS D  
Sbjct: 643 VTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGV 702

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMKV 189
           I +WD+     L KL  H K A+  + + +  + L+S   D  +++WD+ V
Sbjct: 703 IHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLTV 753

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           +Q+       A    D T ++W       L +F  H S +  + F   G  + +GS D T
Sbjct: 601 VQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKT 660

Query: 141 IILWDLVAETGLCKLRSHKDAITGIWCENDDW-LISVSKDGLIKLWDMKVHQCVETHMAH 199
             +WD+     +     H   I  +    D   L + S+DG+I +WD+   + ++  + H
Sbjct: 661 CRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGH 720

Query: 200 TGEC---WSLAVKDNMVITANAESEIKLWEL 227
                   S   + N++++  +++ +++W+L
Sbjct: 721 GKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 98/233 (42%), Gaps = 28/233 (12%)

Query: 375 KLHSIESP-------GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGY 426
           K  S E+P       GH   + +   S D+KLL +AS +  +++W++ T+T +       
Sbjct: 536 KTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHN 595

Query: 427 ALC--CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVT 484
                 +F P G      +     +L+       L  I   H + +  +    +G  + T
Sbjct: 596 HPVWDVQFSPVGHYFATASHDQTARLWSCDHIFPLR-IFSGHISDVDCVTFHPNGCYIFT 654

Query: 485 ASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSL 544
            S+DKT + WD    + +          ++ + H         +  V ++P+   LA   
Sbjct: 655 GSSDKTCRMWDITTGESV----------RLFIGHTAP------ILSVAVAPDGLRLATGS 698

Query: 545 LDNTVKVFFLDSMKFFLSLYGH-KLPVLSMDISHDSKLIITSSADKNIKIWGL 596
            D  + ++ + + K    L GH K  V S+  + +S ++++  +D +++IW L
Sbjct: 699 EDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 78/200 (39%), Gaps = 13/200 (6%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   +E  K  E +    L  ++  LP   + T      E   L Y  +  + A G
Sbjct: 434 PKNALDLKIEIQKVKEYRDYVPLYDLKTALPSVCMFTFLNTNNEMLSLSYSNDCRLAAAG 493

Query: 94  YADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGL- 152
           + D  IK+W +   T+        S  T ++  ++   L +G  D  I       ET + 
Sbjct: 494 FKDSYIKVWSLDGTTL-------ESKATKIQPSKSQAALRAG-LDNKINEKTRSQETPIT 545

Query: 153 -CKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKD 210
             KL  H  AI    +  ++  L+S S+D  I+LW M     + T+  H    W +    
Sbjct: 546 TVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSP 605

Query: 211 --NMVITANAESEIKLWELD 228
             +   TA+ +   +LW  D
Sbjct: 606 VGHYFATASHDQTARLWSCD 625

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 129/289 (44%), Gaps = 49/289 (16%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++DL++  ++  ++  H   I+SLD    G +LV+ 
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 438

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISP-EDRFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP E +F+A   
Sbjct: 439 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 545 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD T++V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 482 LDRTLRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWN 539

Query: 596 L-------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFD 642
           L                 C  +   H+D +++V          S SKD  V +WD  S +
Sbjct: 540 LHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGN 599

Query: 643 CIQKLYGHQGEVWALAVSS------DGQAVVSVSHDRSIRVWEETEDQV 685
            +  L GH+  V ++AV++      D     + S D   R+W+ ++++ 
Sbjct: 600 PLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSKNKA 648

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 74/150 (49%), Gaps = 14/150 (9%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           LA G  D  I+IWD+ T+ +++    H   I  L +  +G +L+SGS D T+ +WDL   
Sbjct: 393 LATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL--R 450

Query: 150 TGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HMAH 199
           TG C L  S +D +T +     +  ++ + S D  +++WD +    VE           H
Sbjct: 451 TGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGH 510

Query: 200 TGECWSLA-VKDNM-VITANAESEIKLWEL 227
               +S+   +D   V++ + +  +KLW L
Sbjct: 511 KDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 94/222 (42%), Gaps = 45/222 (20%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P E  ++         A G  D T+++W
Sbjct: 444 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGEGKFI---------AAGSLDRTLRVW 489

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDL--------- 146
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L         
Sbjct: 490 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKN 549

Query: 147 ----VAETGLCKLRSHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG 201
                A T       HKD +  +   +ND +++S SKD  +  WD +    +     H  
Sbjct: 550 DSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRN 609

Query: 202 ECWSLAVKDNMVI--------TANAESEIKLWELDLERPNGS 235
              S+AV +   +        T + + + ++W+    + N S
Sbjct: 610 SVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSKNKANAS 651

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 70/177 (39%), Gaps = 27/177 (15%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++T    +         T+      G  + +GS D T
Sbjct: 426 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRT 485

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDM--- 187
           + +WD  +ETG    R          HKD++ + ++  +   ++S S D  +KLW++   
Sbjct: 486 LRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNT 543

Query: 188 ----------KVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWELDLERP 232
                         C  T+  H     S+A    D  +++ + +  +  W+     P
Sbjct: 544 GSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNP 600

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 115/258 (44%), Gaps = 42/258 (16%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++D+A   ++  + + H   I+SLD    G +LV+ 
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVM-VLQGHEQDIYSLDYFPSGDKLVSG 435

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP D +F+A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 545 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 479 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWN 536

Query: 596 LDF------------GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           L              G C  +   H+D +++V          S SKD  V +WD  S + 
Sbjct: 537 LRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNP 596

Query: 644 IQKLYGHQGEVWALAVSS 661
           +  L GH+  V ++AV++
Sbjct: 597 LLMLQGHRNSVISVAVAN 614

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 111/240 (46%), Gaps = 31/240 (12%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV-EQELVAGTLDKFVPKMKLIHDTTLDL 524
           HT+ +  +  ++DG+ L T   +KT +   F+V +  L+A   D    ++     +  + 
Sbjct: 300 HTSVVCCVRFSNDGEYLATG-CNKTTQV--FRVSDGALIARLSDDAASQVAAPAGSPANA 356

Query: 525 GE----------------DLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH 566
            E                DL+   V  SP+ +FLA    D  ++++ +   +  + L GH
Sbjct: 357 DEPNNDVNSFVTAKSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGH 416

Query: 567 KLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFS 626
           +  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P    F +
Sbjct: 417 EQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKFIA 475

Query: 627 C-SKDGTVKYWDGNSFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
             S D  V+ WD  +   +++L        GH+  V+++  + DG  VVS S DRS+++W
Sbjct: 476 AGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 535

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 79/159 (49%), Gaps = 14/159 (8%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
            LA G  D  I+IWD+  + +++V   H   I  L +  +G +L+SGS D T+ +WDL  
Sbjct: 389 FLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 446

Query: 149 ETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HMA 198
            TG C L  S +D +T +     D  ++ + S D  +++WD +    VE           
Sbjct: 447 RTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTG 506

Query: 199 HTGECWSLA-VKD-NMVITANAESEIKLWELDLERPNGS 235
           H    +S+   +D N V++ + +  +KLW L  ++ N S
Sbjct: 507 HKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSS 545

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 93/212 (43%), Gaps = 44/212 (20%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P +  ++         A G  D  +++W
Sbjct: 441 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGKFI---------AAGSLDRAVRVW 486

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLVAE------ 149
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L  +      
Sbjct: 487 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSS 546

Query: 150 ----TGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGE 202
                G C++    HKD +  +   +ND +++S SKD  +  WD +    +     H   
Sbjct: 547 GKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRNS 606

Query: 203 CWSLAVKDNMVI--------TANAESEIKLWE 226
             S+AV +   +        T + + + ++W+
Sbjct: 607 VISVAVANGFPLGPQYGVFATGSGDCKARIWK 638

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 570 VLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSK 629
           + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S S 
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 437

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+
Sbjct: 438 DRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKFIAAGSLDRAVRVWD 487

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 103/239 (43%), Gaps = 26/239 (10%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   S DKL++ + +  +++W+++T  C   L     +    + PG G  +
Sbjct: 415 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFI 474

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG  +V+ S D++VK 
Sbjct: 475 AAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKL 534

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF 553
           W+ + ++           P       T     + +  V  +  D+++     D  V  + 
Sbjct: 535 WNLRGDKN----NSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWD 590

Query: 554 LDSMKFFLSLYGHKLPVLSMDISHDSKL------IITSSADKNIKIW-------GLDFG 599
             S    L L GH+  V+S+ +++   L        T S D   +IW       G+D G
Sbjct: 591 TQSGNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKTDAGIDSG 649

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 72/176 (40%), Gaps = 26/176 (14%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++T    +         T+      G  + +GS D  
Sbjct: 423 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRA 482

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDMKVH 190
           + +WD  +ETG    R          HKD++ + ++  + + ++S S D  +KLW+++  
Sbjct: 483 VRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGD 540

Query: 191 Q------------CVETHMAHTGECWSLAV--KDNMVITANAESEIKLWELDLERP 232
           +            C  T+  H     S+A    D  +++ + +  +  W+     P
Sbjct: 541 KNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNP 596

 Score = 35.4 bits (80), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 30/155 (19%), Positives = 67/155 (43%), Gaps = 25/155 (16%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTM--RDGLPPGAIDTKAEKPAEATYLQYHEE 86
           SPG    +  G+L+  V+ W+ +TG L++ +   + L  G  D+          + +  +
Sbjct: 467 SPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDS-------VYSVVFTRD 519

Query: 87  TFILAVGYADGTIKIWDMQ------------TQTVLIVFHSHSSAITILRFDQTGTRLIS 134
              +  G  D ++K+W+++              T  + +  H   +  +   Q    ++S
Sbjct: 520 GNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILS 579

Query: 135 GSRDATIILWDLVAETGLCKLRSHKDAITGIWCEN 169
           GS+D  ++ WD  +   L  L+ H++++  +   N
Sbjct: 580 GSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVAN 614

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 93/416 (22%), Positives = 163/416 (39%), Gaps = 107/416 (25%)

Query: 350 TTANNTIEYYSIPYKKK----EPLQPTAIKLHSIESP----------------------- 382
           T A   I +Y +PY ++    +P+ P  + L S +SP                       
Sbjct: 259 TPAAADINHYLVPYNQRASSLKPIPPFLLNLESSDSPSKYKKQSDDYYVVFNPALPLELD 318

Query: 383 -------GHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNLD------------ 423
                   H + +     S+D + LAT  N   +++ +     I  L             
Sbjct: 319 VELHHSLNHSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSA 378

Query: 424 -CG-------YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDL 475
             G       Y     F P G  +  G     ++++D+    ++  + + H   ++SLD 
Sbjct: 379 TSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVM-VLKGHEQDVYSLDY 437

Query: 476 TSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISP 535
             +G++LV+ S D+TV+ WD +  Q                    TL +   +  V +SP
Sbjct: 438 FPNGEKLVSGSGDRTVRIWDLRTGQ-----------------CSLTLSIEYGVTTVAVSP 480

Query: 536 ED-RFLAVSLLDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISHDSKLIITS 585
            D +F+A   LD  V+V+  DS   FL            GH+  V S+  + D   +++ 
Sbjct: 481 NDGKFIAAGSLDRAVRVW--DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSG 538

Query: 586 SADKNIKIWGL-----------DFGD----CHKSLFAHQDSIMNVKFLPESHNFFSCSKD 630
           S DK +K+W +           D G     C  +   H+D +++V    +     S SKD
Sbjct: 539 SLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKD 598

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAV-------VSVSHDRSIRVWE 679
             + +WD  S + +  L GH+  V ++AV ++G A+        + S D   R+W+
Sbjct: 599 RGILFWDKESGNPLLMLQGHRNSVISVAV-ANGSALGPKYNVFATGSGDCKARIWK 653

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 99/212 (46%), Gaps = 21/212 (9%)

Query: 35  GQVI-TGALEEVKCWEIKTGELLKTMRDGL---PPGAIDTKAEKPAEATYLQ---YHEET 87
           GQ + TG  +  + + +  GEL+  + D     P  +  T    P+   Y++   +  + 
Sbjct: 340 GQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDG 399

Query: 88  FILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLV 147
             LA G  D  I+IWD+Q + +++V   H   +  L +   G +L+SGS D T+ +WDL 
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDL- 458

Query: 148 AETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HM 197
             TG C L  S +  +T +    +D  ++ + S D  +++WD      VE          
Sbjct: 459 -RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGT 517

Query: 198 AHTGECWSLA-VKD-NMVITANAESEIKLWEL 227
            H    +S+   +D N V++ + +  +KLW +
Sbjct: 518 GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNM 549

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 111/282 (39%), Gaps = 69/282 (24%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL- 524
           H++ +  +  ++DG+ L T   +KT + +    + EL+A   D  V        T+    
Sbjct: 327 HSSVVCCVKFSNDGQFLATG-CNKTTQIYRVS-DGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 525 GEDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLI 582
             DL+   V  SP+  FLA    D  ++++ +   K  + L GH+  V S+D   + + +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 583 ITSSADKNIKIWGLDFGDCHKSL------------------------------------- 605
           ++ S D+ ++IW L  G C  +L                                     
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGF 504

Query: 606 ------------FAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD----GNSFD------- 642
                         H+DS+ +V F  + +   S S D TVK W+    GNS +       
Sbjct: 505 LVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGS 564

Query: 643 ----CIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEE 680
               C     GH+  V ++  S D + ++S S DR I  W++
Sbjct: 565 ASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDK 606

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 84/195 (43%), Gaps = 25/195 (12%)

Query: 510 FVPKMKLIHDT----TLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYG 565
           F P + L  D     +L+    + CVK S + +FLA    + T +++ +   +    L  
Sbjct: 309 FNPALPLELDVELHHSLNHSSVVCCVKFSNDGQFLATGC-NKTTQIYRVSDGELIAKLSD 367

Query: 566 HK------------------LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFA 607
                               L + S+  S D + + T + DK I+IW +        L  
Sbjct: 368 DSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKG 427

Query: 608 HQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAV 666
           H+  + ++ + P      S S D TV+ WD  +  C   L    G V  +AVS +DG+ +
Sbjct: 428 HEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYG-VTTVAVSPNDGKFI 486

Query: 667 VSVSHDRSIRVWEET 681
            + S DR++RVW+ T
Sbjct: 487 AAGSLDRAVRVWDST 501

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 89/213 (41%), Gaps = 43/213 (20%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           V+ W+++TG+   T+        + T A  P +  ++         A G  D  +++WD 
Sbjct: 453 VRIWDLRTGQCSLTLSIEY---GVTTVAVSPNDGKFI---------AAGSLDRAVRVWDS 500

Query: 105 QTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLV---------- 147
            T  ++    S       H  ++  + F + G  ++SGS D T+ LW++           
Sbjct: 501 TTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESN 560

Query: 148 ---AETGLCKLR--SHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTG 201
              + +  C++    HKD +  +    DD +++S SKD  I  WD +    +     H  
Sbjct: 561 DKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRN 620

Query: 202 ECWSLAV--------KDNMVITANAESEIKLWE 226
              S+AV        K N+  T + + + ++W+
Sbjct: 621 SVISVAVANGSALGPKYNVFATGSGDCKARIWK 653

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 109/255 (42%), Gaps = 29/255 (11%)

Query: 438 LVILGTRAGQLQLFDLASSTMLENIEE------------AHTAAIWSLDLTSDGKRLVTA 485
           L   G +  Q++LF L  S +    +              H+  ++S   + D + LV++
Sbjct: 510 LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSPDNRYLVSS 569

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLL 545
           S DKTV+ W       LV+                       +W VK SP   + A +  
Sbjct: 570 SEDKTVRLWSLDTHSALVS----------------YKGHNHPVWDVKFSPLGHYFATASH 613

Query: 546 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSL 605
           D+T +++  D +       GH   V  +    +   + T S+DK  ++W +  GDC +  
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF 673

Query: 606 FAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGH-QGEVWALAVSSDGQ 664
                 +++    P+     + S+DG +  WD  +   ++++ GH +  +++LA   +G 
Sbjct: 674 LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGN 733

Query: 665 AVVSVSHDRSIRVWE 679
           A++S   D S+RVW+
Sbjct: 734 ALISGGADHSVRVWD 748

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 17/179 (9%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------F 560
           M   H+T      D+  ++ S + R  A    D+ +K+F LD                  
Sbjct: 489 MYTFHNTN----RDMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATS 544

Query: 561 LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
            +L GH   V S   S D++ +++SS DK +++W LD      S   H   + +VKF P 
Sbjct: 545 KTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPL 604

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
            H F + S D T + W  +    ++   GH  +V  ++   +G  + + S D++ R+W+
Sbjct: 605 GHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWD 663

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 8/144 (5%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H + +  + F   G  L +GS D T  +WD+   
Sbjct: 608 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIA-- 665

Query: 150 TGLCK---LRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAH-TGECWS 205
           TG C    L      I+     +  WL + S+DG+I +WD+   + ++    H     +S
Sbjct: 666 TGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYS 725

Query: 206 LAV--KDNMVITANAESEIKLWEL 227
           LA   + N +I+  A+  +++W+L
Sbjct: 726 LAYCKEGNALISGGADHSVRVWDL 749

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     L  G +D T ++WD+ T   + +F   ++ +        G  L +GS D  
Sbjct: 641 VSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGI 700

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+AI  + +C+  + LIS   D  +++WD+K
Sbjct: 701 INVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 54/119 (45%), Gaps = 5/119 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIR---NLDCGYALCCKFLPGGAL 438
           GH  D+       +   L T +S+   ++W+I T  C+R    L       C   P G  
Sbjct: 633 GHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTC-VSPDGRW 691

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
           +  G+  G + ++D+ +   L+ +      AI+SL    +G  L++  AD +V+ WD K
Sbjct: 692 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+ G  DG I +WD+ T   L     H  +AI  L + + G  LISG  D ++ +WDL  
Sbjct: 692 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLKK 751

Query: 149 ET 150
            T
Sbjct: 752 AT 753

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/210 (18%), Positives = 75/210 (35%), Gaps = 16/210 (7%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   LE  +  E +    L  ++  LP   + T      + T L++ ++  + A G
Sbjct: 455 PKTTLDIKLEVQRVKESRDAIKLDNLQLALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAG 514

Query: 94  YADGTIKIW-------------DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + D  IK++             D+           HS  +    F      L+S S D T
Sbjct: 515 FQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSPDNRYLVSSSEDKT 574

Query: 141 IILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAH 199
           + LW L   + L   + H   +  + +     +  + S D   +LW       +     H
Sbjct: 575 VRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGH 634

Query: 200 TG--ECWSLAVKDNMVITANAESEIKLWEL 227
               +C S       + T +++   ++W++
Sbjct: 635 LNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 101/229 (44%), Gaps = 22/229 (9%)

Query: 452 DLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFV 511
           D  ++T++      H+ A++S   + D K L++ S DKTV+ W       LV+       
Sbjct: 576 DFTNTTLI-----GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVS------- 623

Query: 512 PKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 571
                           +W VK SP   + A +  D T +++  D +       GH   V 
Sbjct: 624 ---------YKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVD 674

Query: 572 SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDG 631
            +    +   + T S+DK  ++W +  GD  +    H   +++    P+     + S+DG
Sbjct: 675 CVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDG 734

Query: 632 TVKYWDGNSFDCIQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
            +  WD  +   ++ + GH +  +++L+ S +G  +VS   D S+RVW+
Sbjct: 735 IINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWD 783

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 95/221 (42%), Gaps = 17/221 (7%)

Query: 472 SLDLTSDGKRLVTASADKTVKFW-----------DFKVEQELVAGTLDKFVPKMKLIHDT 520
           SLD + D +       D  +K W           D        A T DK+    K   +T
Sbjct: 524 SLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKY---SKDFTNT 580

Query: 521 TLDLGED--LWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHD 578
           TL +G    ++    SP++++L     D TV+++ LD+    +S  GH  PV  +  S  
Sbjct: 581 TL-IGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPL 639

Query: 579 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDG 638
                T+S D+  ++W  D     +    H   +  V F P     F+ S D T + WD 
Sbjct: 640 GHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDV 699

Query: 639 NSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           ++ D ++   GH   V + AVS DG+ + + S D  I VW+
Sbjct: 700 STGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWD 740

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 562 SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 621
           +L GH   V S   S D+K +I+ S DK +++W LD      S   H   + +VKF P  
Sbjct: 581 TLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLG 640

Query: 622 HNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE-E 680
           H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+  
Sbjct: 641 HYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 700

Query: 681 TEDQV 685
           T D V
Sbjct: 701 TGDSV 705

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H S +  + F   G  + +GS D T  +WD+   
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAH-TGECWSLA 207
             +     H   +       D  WL + S+DG+I +WD+   + ++    H     +SL+
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLS 762

Query: 208 V--KDNMVITANAESEIKLWEL 227
              + N+++++ A+  +++W+L
Sbjct: 763 YSKEGNVLVSSGADHSVRVWDL 784

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ +        G  L +GS D  
Sbjct: 676 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 735

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L  +R H K+AI  + + +  + L+S   D  +++WD+K
Sbjct: 736 INVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 80/225 (35%), Gaps = 34/225 (15%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   LE  K  E +    L  ++  LP   + T      + T L + E++ + A G
Sbjct: 478 PKTALDIKLEIQKVKESRESIRLNNLQAALPSVCLYTFHNTNRDMTSLDFSEDSRLAAGG 537

Query: 94  YADGTIKIWDMQ----------------------------TQTVLIVFHSHSSAITILRF 125
           + D  IK+W +                             T T LI    HS A+    F
Sbjct: 538 FQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNTTLI---GHSGAVYSTSF 594

Query: 126 DQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKL 184
                 LISGS D T+ LW L   T L   + H   +  + +     +  + S D   +L
Sbjct: 595 SPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARL 654

Query: 185 WDMKVHQCVETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
           W       +     H    +C S       V T +++   ++W++
Sbjct: 655 WSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDV 699

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 70/151 (46%), Gaps = 9/151 (5%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH +D+       +   + T +S+   ++W++ T   +R L  G+    +     P G  
Sbjct: 668 GHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR-LFLGHTAPVISTAVSPDGRW 726

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDF-K 497
           +  G+  G + ++D+ +   L+ +      AI+SL  + +G  LV++ AD +V+ WD  K
Sbjct: 727 LSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLKK 786

Query: 498 VEQELVAGTLDKFVPKMKLIHDTTLDLGEDL 528
              E  A   + FV     + D T  + +D+
Sbjct: 787 ATAEPSAEPEEPFV---GYLGDVTASINQDI 814

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+ G  DG I +WD+ T   L +   H  +AI  L + + G  L+S   D ++ +WDL  
Sbjct: 727 LSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLKK 786

Query: 149 ETG 151
            T 
Sbjct: 787 ATA 789

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +  W+I TG+ LK MR G    AI +          L Y +E  +L    AD ++++WD+
Sbjct: 736 INVWDIGTGKRLKLMR-GHGKNAIYS----------LSYSKEGNVLVSSGADHSVRVWDL 784

Query: 105 QTQTV 109
           +  T 
Sbjct: 785 KKATA 789

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 115/269 (42%), Gaps = 26/269 (9%)

Query: 436 GALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWD 495
           G  +  G   G +++    +  + ++I+ AH   I  LD   DG  L++   D  VK WD
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 496 FKVE--QELV--AGTLD--KFVPKMKLIHDTTLDLGEDLW-------------------C 530
                 +EL   AG +   K  P  +L    + DL   LW                    
Sbjct: 244 MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYT 303

Query: 531 VKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKN 590
           +    +   LA + LD    ++ L S +  + L GH   +  +D S +   + T+ AD  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 591 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF-SCSKDGTVKYWDGNSFDCIQKLYG 649
           +++W +       +L AHQ + ++VKF   +  F  SC  D  V  ++ +++  +  L G
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 650 HQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           H   V+ + ++ DG  + S   DRS++ W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 1/114 (0%)

Query: 76  AEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISG 135
              + ++ H    + A    D T  +WD++ +  L +   HS A+  + F   G  L S 
Sbjct: 257 GRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASA 316

Query: 136 SRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
             DA   +WDL +   + KL  H  AI+G+ W  N   L +   DG +++WD++
Sbjct: 317 GLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIR 370

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594
           P+   L     DN VK++ + S  F   L GH   V  + +    +L  ++S D    +W
Sbjct: 225 PDGNHLLSGGGDNLVKLWDMTSNSFE-ELRGHAGRVSRVKVHPSGRLAASASFDLTWILW 283

Query: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654
            L+     +    H  ++  + F  +     S   D     WD  S + I KL GH G +
Sbjct: 284 DLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAI 343

Query: 655 WALAVSSDGQAVVSVSHDRSIRVWE 679
             +  S +G  + +   D ++RVW+
Sbjct: 344 SGVDWSPNGYQLATAGADGTVRVWD 368

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 71/158 (44%), Gaps = 5/158 (3%)

Query: 79  TYLQYHEETFILAVGYADGTIKIWDMQTQTVL-IVFHSHSSAITILRFDQTGTRLISGSR 137
           + +  H +   LA G   G+IK+   +T  +   +  +H   I  L +   G  L+SG  
Sbjct: 176 SQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGG 235

Query: 138 DATIILWDLVAETGLCKLRSHKDAITGIWCENDDWL-ISVSKDGLIKLWDMKVHQCVETH 196
           D  + LWD+ + +   +LR H   ++ +       L  S S D    LWD++    ++  
Sbjct: 236 DNLVKLWDMTSNS-FEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQ 294

Query: 197 MAHTGECWSLAVKDNMVITANA--ESEIKLWELDLERP 232
             H+   +++A + +  + A+A  ++   +W+L    P
Sbjct: 295 EGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEP 332

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/347 (23%), Positives = 137/347 (39%), Gaps = 73/347 (21%)

Query: 368 PLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNLDCG-- 425
           P  P  + +   +S  H + +     S D + LAT  N   +V+ + T   I  L     
Sbjct: 426 PALPRTLDVELHKSLDHSSVVCCVKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDNV 485

Query: 426 -----------YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474
                      Y     F P G  +  G     ++++D+    ++  + + H   ++SLD
Sbjct: 486 KLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVM-VLKGHEQDVYSLD 544

Query: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534
              DG++LV+ S D+TV+ WD +  Q                    TL + + +  V +S
Sbjct: 545 YFPDGQKLVSGSGDRTVRIWDLRTGQ-----------------CSLTLSIEDGVTTVAVS 587

Query: 535 PED-RFLAVSLLDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISHDSKLIIT 584
           P D RF+A   LD  V+V+  DS   FL            GH+  V S+  + D   +++
Sbjct: 588 PHDGRFIAAGSLDRAVRVW--DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVS 645

Query: 585 SSADKNIKIWGLDF------------------------------GDCHKSLFAHQDSIMN 614
            S DK++K+W L                                  C  +   H+D +++
Sbjct: 646 GSLDKSVKLWNLGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLS 705

Query: 615 VKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSS 661
           V          S SKD  V +WD  S + +  L GH+  V ++AV++
Sbjct: 706 VTTSQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAVAN 752

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 111/223 (49%), Gaps = 19/223 (8%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLG 525
           H++ +  +  + DG+ L T   +KT + +      EL+A   D  V   KL  ++T    
Sbjct: 442 HSSVVCCVKFSYDGEFLATG-CNKTTQVYRVSTG-ELIAKLSDDNV---KLDSNST---S 493

Query: 526 EDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
            DL+   V  SP+ +FLA    D  ++++ +   K  + L GH+  V S+D   D + ++
Sbjct: 494 TDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLV 553

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYWDGNSFD 642
           + S D+ ++IW L  G C  +L + +D +  V   P    F +  S D  V+ WD  +  
Sbjct: 554 SGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGF 612

Query: 643 CIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
            +++L        GHQ  V+++  + DG  VVS S D+S+++W
Sbjct: 613 LVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLW 655

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 94/206 (45%), Gaps = 25/206 (12%)

Query: 39  TGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETF-----ILAVG 93
           TG  +  + + + TGEL+  + D       + K +  + +T L      F      LA G
Sbjct: 460 TGCNKTTQVYRVSTGELIAKLSDD------NVKLDSNSTSTDLYIRSVCFSPDGKFLATG 513

Query: 94  YADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLC 153
             D  I+IWD+Q   +++V   H   +  L +   G +L+SGS D T+ +WDL   TG C
Sbjct: 514 AEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDL--RTGQC 571

Query: 154 KLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HMAHTGEC 203
            L  S +D +T +     D  ++ + S D  +++WD      VE           H    
Sbjct: 572 SLTLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSV 631

Query: 204 WSLA-VKD-NMVITANAESEIKLWEL 227
           +S+   +D N V++ + +  +KLW L
Sbjct: 632 YSVVFTRDGNEVVSGSLDKSVKLWNL 657

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 521 TLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFL-----------DSMKFFLSLYGHKLP 569
           +LD    + CVK S +  FLA    + T +V+ +           D++K   +     L 
Sbjct: 439 SLDHSSVVCCVKFSYDGEFLATGC-NKTTQVYRVSTGELIAKLSDDNVKLDSNSTSTDLY 497

Query: 570 VLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSK 629
           + S+  S D K + T + DK I+IW +  G     L  H+  + ++ + P+     S S 
Sbjct: 498 IRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSG 557

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSS-DGQAVVSVSHDRSIRVWEET 681
           D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+ T
Sbjct: 558 DRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPHDGRFIAAGSLDRAVRVWDST 609

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 94/230 (40%), Gaps = 62/230 (26%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P        H+  FI A G  D  +++W
Sbjct: 561 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSP--------HDGRFI-AAGSLDRAVRVW 606

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLV-------- 147
           D  T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L         
Sbjct: 607 DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNNN 666

Query: 148 --------------------AETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKL 184
                                 +  C++    HKD +  +   +ND++++S SKD  +  
Sbjct: 667 GNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLF 726

Query: 185 WDMKVHQCVETHMAHTGECWSLAV--------KDNMVITANAESEIKLWE 226
           WD K    +     H     S+AV        K N+  T + + + ++W+
Sbjct: 727 WDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 124/283 (43%), Gaps = 47/283 (16%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++D+A   ++  + + H   I+SLD    G +LV+ 
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVM-VLQGHEQDIYSLDYFPSGDKLVSG 522

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q                    TL + + +  V +SP D +++A   
Sbjct: 523 SGDRTVRIWDLRNGQ-----------------CSLTLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 545 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 566 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 623

Query: 596 LDF-----------GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
           L             G C  +   H+D +++V          S SKD  V +WD  S + +
Sbjct: 624 LRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPL 683

Query: 645 QKLYGHQGEVWALAVSSD---GQAV---VSVSHDRSIRVWEET 681
             L GH+  V ++AV++    G  V    + S D   R+W+ T
Sbjct: 684 LMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWKYT 726

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 114/242 (47%), Gaps = 33/242 (13%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV-EQELVAGTLD----KFVPKMKLIHDT 520
           HT+ +  +  ++DG+ L T   +KT +   F+V + ELVA   D    + V       + 
Sbjct: 385 HTSVVCCVRFSNDGQFLATG-CNKTTQV--FRVSDGELVARLSDDSTSQGVQGQSDAANG 441

Query: 521 TLD--LGE------------DLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY 564
           T D   GE            DL+   V  SP+ +FLA    D  ++++ +   K  + L 
Sbjct: 442 TADGTSGETNSFATSTSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ 501

Query: 565 GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNF 624
           GH+  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P    +
Sbjct: 502 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTL-SIEDGVTTVAVSPGDGKY 560

Query: 625 FSC-SKDGTVKYWDGNSFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIR 676
            +  S D  V+ WD  +   +++L        GH+  V+++  + DG  VVS S DRS++
Sbjct: 561 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVK 620

Query: 677 VW 678
           +W
Sbjct: 621 LW 622

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 74/150 (49%), Gaps = 14/150 (9%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           LA G  D  I+IWD+  + +++V   H   I  L +  +G +L+SGS D T+ +WDL   
Sbjct: 477 LATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL--R 534

Query: 150 TGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HMAH 199
            G C L  S +D +T +     D  ++ + S D  +++WD +    VE           H
Sbjct: 535 NGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGH 594

Query: 200 TGECWSLA-VKD-NMVITANAESEIKLWEL 227
               +S+   +D N V++ + +  +KLW L
Sbjct: 595 KDSVYSVVFTRDGNNVVSGSLDRSVKLWNL 624

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 86/194 (44%), Gaps = 35/194 (18%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++ G+  L  ++ DG     + T A  P +  Y+         A G  D  +++W
Sbjct: 528 VRIWDLRNGQCSLTLSIEDG-----VTTVAVSPGDGKYI---------AAGSLDRAVRVW 573

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLVAET----- 150
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L  +      
Sbjct: 574 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVK 633

Query: 151 ----GLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGEC 203
               G C++    HKD +  +   +ND++++S SKD  +  WD K    +     H    
Sbjct: 634 PNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 693

Query: 204 WSLAVKDNMVITAN 217
            S+AV +   +  N
Sbjct: 694 ISVAVANGFPLGPN 707

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 69/153 (45%), Gaps = 14/153 (9%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++     +         T+      G  + +GS D  
Sbjct: 510 LDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 569

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDMKV- 189
           + +WD  +ETG    R          HKD++ + ++  + + ++S S D  +KLW+++  
Sbjct: 570 VRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGD 627

Query: 190 -HQCVETHMAHTGECWSLAVKDNMVITANAESE 221
            +Q V+ ++  T E      KD ++  A  +++
Sbjct: 628 NNQDVKPNVPGTCEVTYTGHKDFVLSVATTQND 660

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 101/216 (46%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S+  + D + LV+AS DKTV+ W           +LD F   +          
Sbjct: 525 GHSGPVYSVSFSPDNRYLVSASEDKTVRLW-----------SLDTFTCLVSYKGHN---- 569

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W VK SP   + A    D T +++  D +       GH   V  +    +   ++T
Sbjct: 570 -HPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLT 628

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  GD  +    H  S+++V   P+     + S+DG +  WD  +   I
Sbjct: 629 GSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI 688

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  V +L+ + +G  +VS   D+S+RVW+
Sbjct: 689 KQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 89/186 (47%), Gaps = 18/186 (9%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------F 560
           M   H+T      D+  ++ S + R +A    D+ +K++ LD                  
Sbjct: 465 MYTFHNTN----RDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNT 520

Query: 561 LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
            +L GH  PV S+  S D++ ++++S DK +++W LD   C  S   H   + +VKF P 
Sbjct: 521 TTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPL 580

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE- 679
            H F + S D T + W  +    ++   GH  +V  +A   +G  V++ S D++ R+W+ 
Sbjct: 581 GHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDI 640

Query: 680 ETEDQV 685
           +T D V
Sbjct: 641 QTGDSV 646

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 112/279 (40%), Gaps = 48/279 (17%)

Query: 387 DLRAADISSDDKLLATA-SNGNLKVWNI-----------------KTKTCIRNLDCGYAL 428
           D+ +   S D +L+A    + ++K+W++                  T T I +   G   
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGH--SGPVY 531

Query: 429 CCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASAD 488
              F P    ++  +    ++L+ L + T L + +  H   +W +  +  G    T S D
Sbjct: 532 SVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYK-GHNHPVWDVKFSPLGHYFATVSHD 590

Query: 489 KTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLD 546
           +T + W  D      + AG L+                  D+ CV   P   ++     D
Sbjct: 591 QTARLWSCDHIYPLRIFAGHLN------------------DVDCVAFHPNGTYVLTGSSD 632

Query: 547 NTVKVFFL---DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHK 603
            T +++ +   DS++ FL   GH   V+S+ +S D + + T S D  I +W +  G   K
Sbjct: 633 KTCRMWDIQTGDSVRLFL---GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIK 689

Query: 604 SLFAHQDSIMN-VKFLPESHNFFSCSKDGTVKYWDGNSF 641
            +  H  S +N + F  E +   S   D +V+ WD   F
Sbjct: 690 QMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKF 728

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 64/136 (47%), Gaps = 4/136 (2%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T ++W       L +F  H + +  + F   GT +++GS D T  +WD+     +   
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 156 RSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGEC---WSLAVKDN 211
             H  ++  +    D  WL + S+DG+I +WD+   + ++    H        S   + N
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGN 709

Query: 212 MVITANAESEIKLWEL 227
           ++++  A+  +++W+L
Sbjct: 710 ILVSGGADQSVRVWDL 725

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+QT   + +F  H++++  +     G  L +GS D  
Sbjct: 617 VAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGV 676

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           II+WD+     + ++R H K A+  + + +  + L+S   D  +++WD+K
Sbjct: 677 IIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 68/170 (40%), Gaps = 22/170 (12%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDM----------------QTQTVLIVFHSHSSAI 120
           + T LQ+ E++ ++A G+ D  IKIW +                   T LI    HS  +
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLI---GHSGPV 530

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKD 179
             + F      L+S S D T+ LW L   T L   + H   +  + +     +  +VS D
Sbjct: 531 YSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHD 590

Query: 180 GLIKLWDMKVHQCVETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
              +LW       +     H    +C +       V+T +++   ++W++
Sbjct: 591 QTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDI 640

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 137/292 (46%), Gaps = 22/292 (7%)

Query: 393 ISSDDKLLATAS-NGNLKVWNIKT---KTCIRNLDCGYALCCKFLPGGALVILGTRAGQL 448
           I+ +D++ AT   NG+LK++N KT      I N+  G      +   G +++ G   G +
Sbjct: 184 IAPNDEVFATGDWNGDLKLFNSKTLEPTVKIDNVHSGKIGGLDWNKTGGMLVTGAEDGMV 243

Query: 449 QLFDLASSTMLEN-IEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTL 507
           +L+   S+ + E  + + H   + +       + L + S D T + WD    QEL+    
Sbjct: 244 KLYSYTSNEIKETTVLKGHEKRVVATKFHPSTRFLGSTSFDTTWRLWDIATSQELL---- 299

Query: 508 DKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHK 567
                 ++  H       ++++ +    +   +    LDNT  ++ +   K  ++L GH 
Sbjct: 300 ------LQEGHS------KEVYSLSFQGDGSLVCTGGLDNTALLWDIRCGKSIMTLNGHS 347

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE-SHNFFS 626
            PV  +D S +   + T   D  I IW +   +   ++ AH + I +++F  + S    S
Sbjct: 348 KPVYCVDWSCNGYNVATGGGDGLINIWDIRKTNLVNTILAHNNIISDLRFAKQDSKCLVS 407

Query: 627 CSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           CS D  +  +  +++  ++ L GH   + ++ ++++ +A++S   DRS+++W
Sbjct: 408 CSYDKKINIYSSDNWLKVKTLEGHSHNILSVDMTNNAKALISGGWDRSVKLW 459

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 77/170 (45%), Gaps = 12/170 (7%)

Query: 33  SPGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILA 91
           + G ++TGA +  VK +   + E+ +T         +    EK   AT  ++H  T  L 
Sbjct: 230 TGGMLVTGAEDGMVKLYSYTSNEIKET--------TVLKGHEKRVVAT--KFHPSTRFLG 279

Query: 92  VGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETG 151
               D T ++WD+ T   L++   HS  +  L F   G+ + +G  D T +LWD+     
Sbjct: 280 STSFDTTWRLWDIATSQELLLQEGHSKEVYSLSFQGDGSLVCTGGLDNTALLWDIRCGKS 339

Query: 152 LCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHT 200
           +  L  H   +  + W  N   + +   DGLI +WD++    V T +AH 
Sbjct: 340 IMTLNGHSKPVYCVDWSCNGYNVATGGGDGLINIWDIRKTNLVNTILAHN 389

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 83/248 (33%), Gaps = 60/248 (24%)

Query: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493
           P   +   G   G L+LF+  +      I+  H+  I  LD    G  LVT + D  VK 
Sbjct: 186 PNDEVFATGDWNGDLKLFNSKTLEPTVKIDNVHSGKIGGLDWNKTGGMLVTGAEDGMVKL 245

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCV--KISPEDRFLAVSLLDNTVKV 551
           + +   +                I +TT+  G +   V  K  P  RFL  +  D T ++
Sbjct: 246 YSYTSNE----------------IKETTVLKGHEKRVVATKFHPSTRFLGSTSFDTTWRL 289

Query: 552 FFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 611
           + + + +  L   GH   V S+    D  L+ T          GLD              
Sbjct: 290 WDIATSQELLLQEGHSKEVYSLSFQGDGSLVCTG---------GLD-------------- 326

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSH 671
                               T   WD      I  L GH   V+ +  S +G  V +   
Sbjct: 327 -------------------NTALLWDIRCGKSIMTLNGHSKPVYCVDWSCNGYNVATGGG 367

Query: 672 DRSIRVWE 679
           D  I +W+
Sbjct: 368 DGLINIWD 375

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 67/153 (43%), Gaps = 4/153 (2%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGS 136
           E   L +  +  ++  G  D T  +WD++    ++  + HS  +  + +   G  + +G 
Sbjct: 307 EVYSLSFQGDGSLVCTGGLDNTALLWDIRCGKSIMTLNGHSKPVYCVDWSCNGYNVATGG 366

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVE 194
            D  I +WD+     +  + +H + I+ +     D   L+S S D  I ++       V+
Sbjct: 367 GDGLINIWDIRKTNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIYSSDNWLKVK 426

Query: 195 THMAHTGECWSLAVKDN--MVITANAESEIKLW 225
           T   H+    S+ + +N   +I+   +  +KLW
Sbjct: 427 TLEGHSHNILSVDMTNNAKALISGGWDRSVKLW 459

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 81/162 (50%), Gaps = 12/162 (7%)

Query: 74  KPAEATYLQYHEETFILAVGYADGTIKIWDMQT-QTVLIVFHSHSSAITILRFDQTGTRL 132
           +P     +  ++E F  A G  +G +K+++ +T +  + + + HS  I  L +++TG  L
Sbjct: 177 RPISKIAIAPNDEVF--ATGDWNGDLKLFNSKTLEPTVKIDNVHSGKIGGLDWNKTGGML 234

Query: 133 ISGSRDATIILWDL----VAETGLCKLRSH-KDAITGIWCENDDWLISVSKDGLIKLWDM 187
           ++G+ D  + L+      + ET +  L+ H K  +   +  +  +L S S D   +LWD+
Sbjct: 235 VTGAEDGMVKLYSYTSNEIKETTV--LKGHEKRVVATKFHPSTRFLGSTSFDTTWRLWDI 292

Query: 188 KVHQCVETHMAHTGECWSLAVKDN--MVITANAESEIKLWEL 227
              Q +     H+ E +SL+ + +  +V T   ++   LW++
Sbjct: 293 ATSQELLLQEGHSKEVYSLSFQGDGSLVCTGGLDNTALLWDI 334

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 101/233 (43%), Gaps = 22/233 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++AS DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSL-LDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           ++ D TL             +D   A+S   D T++++ + + + +    GHK  V+S+ 
Sbjct: 67  IVQDCTL------------TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVA 114

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN-----FFSCSK 629
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGN 173

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETE 682
           D  VK W+ N F       GH G V A+  S DG  + S   D  I +W   E
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLE 226

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 9/140 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC----ENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVK 209
             H D ++ +      +NDD   +IS   D ++K W++   Q     + H G   ++   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 210 DN--MVITANAESEIKLWEL 227
            +  ++ +A  + EI LW L
Sbjct: 205 PDGSLIASAGKDGEIMLWNL 224

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 64/139 (46%), Gaps = 9/139 (6%)

Query: 555 DSMKFFL---SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 611
           D  KF +   S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQ-----AV 666
           +M+V    ++    S S+D T+K W      C+  L GH   V  + ++   Q      V
Sbjct: 110 VMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDTVTV 168

Query: 667 VSVSHDRSIRVWEETEDQV 685
           +S  +D+ ++ W   + Q+
Sbjct: 169 ISAGNDKMVKAWNLNQFQI 187

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 106/255 (41%), Gaps = 42/255 (16%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           + H+  +    LT DG   ++AS DKT++ WD    +                       
Sbjct: 62  KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM 121

Query: 502 LVAGTLDKFVPKMKLIHDTTLD--LGEDLWC--VKISPEDR-----FLAVSLLDNTVKVF 552
           +++G+ DK + K+  I    L   LG + W   V+I+P D+      +  +  D  VK +
Sbjct: 122 IISGSRDKTI-KVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAW 180

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
            L+  +      GH   V ++  S D  LI ++  D  I +W L       +L A QD +
Sbjct: 181 NLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSA-QDEV 239

Query: 613 MNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWALAV--SSDGQ 664
             + F P  +   + +  G VK +  +    I  L      Y    E  A+++  S+DGQ
Sbjct: 240 FALAFSPNRYWLAAATASG-VKIFSLDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQ 298

Query: 665 AVVSVSHDRSIRVWE 679
            + +   D  IRVW+
Sbjct: 299 TLFAGYTDNVIRVWQ 313

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 67/179 (37%), Gaps = 9/179 (5%)

Query: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-D 171
           F  HS  +      Q G   +S S D T+ LWD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 172 WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN-------MVITANAESEIKL 224
            +IS S+D  IK+W +K  QC+ T + H      + +           VI+A  +  +K 
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKA 179

Query: 225 WELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSE 283
           W L+  +     +   G+    +      L  +   DG    ++L     M     + E
Sbjct: 180 WNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSAQDE 238

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   +       D  + +S S D  ++LW
Sbjct: 33  LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLW 92

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWEL 227
           D+   +  +  + H  +  S+A+  K +M+I+ + +  IK+W +
Sbjct: 93  DVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI 136

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 77/182 (42%), Gaps = 23/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKSDVMSVAI------------DRKASMIISGSRDKTIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++     T    +++T  +     D  +K W++    +   F  H+  
Sbjct: 145 L-----GHNDWVSQVRIAPT--DQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGN 197

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           +  +     G+ + S  +D  I+LW+L+ +T +  L +  +     +  N  WL + +  
Sbjct: 198 VNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSAQDEVFALAFSPNRYWLAAATAS 257

Query: 180 GL 181
           G+
Sbjct: 258 GV 259

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   + D K L++AS DKTV+ W       LV+                    
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVS----------------YKGH 517

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 518 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFT 577

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S DK  ++W +  GD  +    H   +++    P+     + S+DG +  WD  +   +
Sbjct: 578 GSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRL 637

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  V++L+ S +G  +VS   D S+RVW+
Sbjct: 638 KQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 79/179 (44%), Gaps = 17/179 (9%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------F 560
           M   H+T      D+ C++ S +    A    D+ +K++ LD                  
Sbjct: 414 MYTFHNT----NRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINN 469

Query: 561 LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
            +L GH   V S   S D+K ++++S DK +++W +D      S   H   + +V F P 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPL 529

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
            H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+
Sbjct: 530 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWD 588

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H + +  + F   GT + +GS D T  +WD+   
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAH-TGECWSLA 207
             +     H   +       D  WL + S+DG+I +WD+   + ++    H     +SL+
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 652

Query: 208 V--KDNMVITANAESEIKLWEL 227
              +  ++++  A+  +++W+L
Sbjct: 653 YSKEGTVLVSGGADHSVRVWDL 674

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G  D T ++WD+ T   + +F  H++ +        G  L +GS D  
Sbjct: 566 VSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 625

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+A+  + + +    L+S   D  +++WD+K
Sbjct: 626 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 19/149 (12%)

Query: 99  IKIWDMQT---QTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           IK+ ++Q+      +  FH+ +  +T L F    T   +G +D+ I LW L       KL
Sbjct: 400 IKLDNLQSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKL 459

Query: 156 RS-------------HKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG 201
            S             H   +    +  ++ +L+S S+D  ++LW M  +  + ++  H  
Sbjct: 460 PSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNH 519

Query: 202 ECW--SLAVKDNMVITANAESEIKLWELD 228
             W  S +   +   TA+ +   +LW  D
Sbjct: 520 PVWDVSFSPLGHYFATASHDQTARLWSCD 548

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 55/119 (46%), Gaps = 5/119 (4%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH  D+       +   + T S +   ++W+I T   +R L  G+    +     P G  
Sbjct: 558 GHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVR-LFLGHTAPVISTAVSPDGRW 616

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
           +  G+  G + ++D+ +   L+ +      A++SL  + +G  LV+  AD +V+ WD K
Sbjct: 617 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 14/117 (11%)

Query: 37  VITGALEEV-KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           V TG+ ++  + W+I TG+ ++       P  + + A  P          +   L+ G  
Sbjct: 575 VFTGSTDKTCRMWDIGTGDSVRLFLGHTAP--VISTAVSP----------DGRWLSTGSE 622

Query: 96  DGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVAETG 151
           DG I +WD+ T   L     H  +A+  L + + GT L+SG  D ++ +WDL   T 
Sbjct: 623 DGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTA 679

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 73/205 (35%), Gaps = 22/205 (10%)

Query: 42  LEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKI 101
           LE  K  E +    L  ++   P   + T      + T L++ ++  + A G+ D  IK+
Sbjct: 388 LEIQKVRESRDAIKLDNLQSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKL 447

Query: 102 WDMQ----------------TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWD 145
           W +                   T LI    HS  +    F      L+S S D T+ LW 
Sbjct: 448 WSLDGTPLDSKLPSKQREKINNTTLI---GHSGTVYSTSFSPDNKYLLSASEDKTVRLWS 504

Query: 146 LVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG--E 202
           +   + L   + H   +  + +     +  + S D   +LW       +     H    +
Sbjct: 505 MDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVD 564

Query: 203 CWSLAVKDNMVITANAESEIKLWEL 227
           C S       V T + +   ++W++
Sbjct: 565 CVSFHPNGTYVFTGSTDKTCRMWDI 589

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 113/255 (44%), Gaps = 38/255 (14%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++D+    ++  + + H   I+SLD    G +LV+ 
Sbjct: 557 YIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVM-VLKGHEQDIYSLDYFPSGDKLVSG 615

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD K  Q  +                 TL + + +  V +SP D +F+A   
Sbjct: 616 SGDRTVRIWDLKTGQCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 658

Query: 545 LDNTVKVFFLDSMKFFLSL-------YGHKLPVLSMDISHDSKLIITSSADKNIKIWGL- 596
           LD  V+V+  D+      L        GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 659 LDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

Query: 597 -----------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQ 645
                        G C  +   H+D +++V    +     S SKD  V +WD  S + + 
Sbjct: 719 NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL 778

Query: 646 KLYGHQGEVWALAVS 660
            L GH+  V ++AV+
Sbjct: 779 MLQGHRNSVISVAVN 793

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 111/229 (48%), Gaps = 19/229 (8%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVA------GTLDKFVPKMKLIHD 519
           HT+ +  +  ++DG+ L T   +KT + +    + ELVA         DK         +
Sbjct: 490 HTSVVCCVKFSNDGEFLATG-CNKTTQIYRVS-DGELVARFSDENAHTDKADGNDNAEAE 547

Query: 520 TTLDLGEDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISH 577
           T+     DL+   V  SP+ +FLA    D  ++++ ++  K  + L GH+  + S+D   
Sbjct: 548 TSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFP 607

Query: 578 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYW 636
               +++ S D+ ++IW L  G C  +L + +D +  V   P    F +  S D  V+ W
Sbjct: 608 SGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 666

Query: 637 DGNSFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           D ++   +++L        GH+  V+++  + DG  VVS S DRS+++W
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 715

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 100/212 (47%), Gaps = 25/212 (11%)

Query: 39  TGALEEVKCWEIKTGELLKTMRD-----GLPPGAIDTKAEKPAEAT---YLQ---YHEET 87
           TG  +  + + +  GEL+    D         G  + +AE  A AT   Y++   +  + 
Sbjct: 508 TGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSPDG 567

Query: 88  FILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLV 147
             LA G  D  I+IWD++ + +++V   H   I  L +  +G +L+SGS D T+ +WDL 
Sbjct: 568 KFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL- 626

Query: 148 AETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HM 197
            +TG C L  S +D +T +     D  ++ + S D  +++WD      VE          
Sbjct: 627 -KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGT 685

Query: 198 AHTGECWSLA-VKD-NMVITANAESEIKLWEL 227
            H    +S+   +D N V++ + +  +KLW L
Sbjct: 686 GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL 717

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 108/244 (44%), Gaps = 44/244 (18%)

Query: 464 EAHTAAIWSLDL-------TSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516
           EA T+A  + DL       + DGK L T + DK ++ WD  +EQ+ +   L         
Sbjct: 545 EAETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWD--IEQKKIVMVLKG------- 595

Query: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 576
            H+      +D++ +   P    L     D TV+++ L + +  L+L      V ++ +S
Sbjct: 596 -HE------QDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDG-VTTVAVS 647

Query: 577 H-DSKLIITSSADKNIKIWGLDFG------DCHKSL-FAHQDSIMNVKFLPESHNFFSCS 628
             D K I   S D+ +++W  D G      D    L   H+DS+ +V F  + +   S S
Sbjct: 648 PGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGS 707

Query: 629 KDGTVKYW----------DG--NSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIR 676
            D +VK W          DG   S  C     GH+  V ++A + D + ++S S DR + 
Sbjct: 708 LDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVL 767

Query: 677 VWEE 680
            W++
Sbjct: 768 FWDK 771

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 99/229 (43%), Gaps = 21/229 (9%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   S DKL++ + +  +++W++KT  C   L     +    + PG G  +
Sbjct: 595 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFI 654

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG  +V+ S D++VK 
Sbjct: 655 AAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKL 714

Query: 494 WDFK-VEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVF 552
           W+ + V      G      P       T     + +  V  + +D ++     D  V  +
Sbjct: 715 WNLRNVNHNNADGK-----PTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFW 769

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDC 601
              S    L L GH+  V+S+ ++H   L        N  I+    GDC
Sbjct: 770 DKVSGNPLLMLQGHRNSVISVAVNHGHPL------GPNYHIFATGSGDC 812

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 84/195 (43%), Gaps = 36/195 (18%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W++KTG+  L  ++ DG     + T A  P +  ++         A G  D  +++W
Sbjct: 621 VRIWDLKTGQCTLTLSIEDG-----VTTVAVSPGDGKFI---------AAGSLDRAVRVW 666

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLV-------- 147
           D  T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L         
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNAD 726

Query: 148 --AETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGE 202
               +G C++    HKD +  +   E+D++++S SKD  +  WD      +     H   
Sbjct: 727 GKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNS 786

Query: 203 CWSLAVKDNMVITAN 217
             S+AV     +  N
Sbjct: 787 VISVAVNHGHPLGPN 801

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 101/237 (42%), Gaps = 22/237 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++ S DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSL-LDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           ++ D TL             +D   A+S   D T++++ + + + +    GHK  V+S+ 
Sbjct: 67  IVQDCTL------------TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVA 114

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN-----FFSCSK 629
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGN 173

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQVF 686
           D  VK W+ N F       GH G V A+  S DG  + S   D  I +W   E +  
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 9/140 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC----ENDDW--LISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVK 209
             H D ++ +      +NDD   +IS   D ++K W++   Q     + H G   ++   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 210 DN--MVITANAESEIKLWEL 227
            +  ++ +A  + EI LW L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 109/255 (42%), Gaps = 42/255 (16%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           + H+  +    LT DG   ++AS DKT++ WD    +                       
Sbjct: 62  KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM 121

Query: 502 LVAGTLDKFVPKMKLIHDTTLD--LGEDLWC--VKISPEDRFL-AVSLL----DNTVKVF 552
           +++G+ DK + K+  I    L   LG + W   V+I+P D+   AV+++    D  VK +
Sbjct: 122 IISGSRDKTI-KVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAW 180

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
            L+  +      GH   V ++  S D  LI ++  D  I +W L       +L A QD +
Sbjct: 181 NLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEV 239

Query: 613 MNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWA--LAVSSDGQ 664
            ++ F P  +   + +  G +K +  +    I  L      Y    E  A  LA S+DGQ
Sbjct: 240 FSLAFSPNRYWLAAATASG-IKIFCLDPQSLIDDLRPEFAGYNKSAEPHAVSLAWSADGQ 298

Query: 665 AVVSVSHDRSIRVWE 679
            + +   D  IRVW+
Sbjct: 299 TLFAGYTDSVIRVWQ 313

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 77/182 (42%), Gaps = 23/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKSDVMSVAI------------DRKASMIISGSRDKTIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++     T  Q  +   +++ G  D  +K W++    +   F  H+  
Sbjct: 145 L-----GHNDWVSQVRIAPTD-QNDDAVTVISAGN-DKMVKAWNLNQFQIEADFVGHNGN 197

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           +  +     GT + S  +D  I+LW+L  +  +  L +  +  +  +  N  WL + +  
Sbjct: 198 VNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNRYWLAAATAS 257

Query: 180 GL 181
           G+
Sbjct: 258 GI 259

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 99/236 (41%), Gaps = 19/236 (8%)

Query: 458 MLENIEEAHTAAIWSLDLT-SDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516
           +L    E H   + SL  + +    L++ S DK++  W    + +     +  F     +
Sbjct: 8   VLRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHI 67

Query: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 576
           + D T           ++P+  +   +  D TV+++ L S K      GHK  VLS+ I 
Sbjct: 68  VQDCT-----------VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTID 116

Query: 577 HDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSKD 630
             +  I+++S DK +K+W    G+C  +L  H D +  V+  P      E+    S   D
Sbjct: 117 RRASQIVSASRDKTVKVWNT-LGECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMD 175

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQVF 686
             VK W+ +SF       GH   V  +  S DG  V S   D  I +W  TE +  
Sbjct: 176 KVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEAL 231

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 115/260 (44%), Gaps = 26/260 (10%)

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
           C   P G   +  +    ++L++LAS   ++     H + + S+ +     ++V+AS DK
Sbjct: 71  CTVTPDGEYALSASWDKTVRLWELASGKCIQRFV-GHKSDVLSVTIDRRASQIVSASRDK 129

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAV--SLLDN 547
           TVK W+   E  +     + +V ++++  + T             PED  + V  + +D 
Sbjct: 130 TVKVWNTLGECMVTLLGHNDWVSQVRVAPNET-------------PEDETVTVISAGMDK 176

Query: 548 TVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFA 607
            VKV+ L S +      GH   V ++  S D  L+ ++  D  I +W L   +   +L A
Sbjct: 177 VVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNA 236

Query: 608 HQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWA--LAV 659
            QD +  V F P  +   + +  G +K ++      + +L      Y    E  A  LA 
Sbjct: 237 -QDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVDELKPEFAGYTKAAEPHAISLAW 294

Query: 660 SSDGQAVVSVSHDRSIRVWE 679
           S+DGQ + +   D  IRVW+
Sbjct: 295 SADGQTLFAGYTDNVIRVWQ 314

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++W++ +   +  F  H S +  +  D+  ++++S SRD T+ +W+ + E  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 156 RSHKDAITGIWCENDD-------WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +    ++        +IS   D ++K+W++   Q     + H     ++  
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 209 KDN--MVITANAESEIKLWEL 227
             +  +V +A  + +I LW L
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 53/110 (48%), Gaps = 1/110 (0%)

Query: 85  EETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILW 144
           +ET  +     D  +K+W++ +  +   F  H++ +  +     GT + S  +D  I+LW
Sbjct: 164 DETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLW 223

Query: 145 DLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVE 194
           +L  +  L  L +  +     +  N  WL + +  G IK+++++  + V+
Sbjct: 224 NLTEKEALYTLNAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 52/102 (50%), Gaps = 8/102 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCEND-DWLISVSKDGLIKLW 185
           L+SGSRD ++I W L  +       +   R H   +       D ++ +S S D  ++LW
Sbjct: 33  LLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLW 92

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLW 225
           ++   +C++  + H  +  S+ +  + + +++A+ +  +K+W
Sbjct: 93  ELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW 134

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 71/176 (40%), Gaps = 24/176 (13%)

Query: 66  GAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW-----DMQTQTVLIVFHSHSSAI 120
           G + + A  PA+           +L  G  D ++  W     D Q    +  F  HS  +
Sbjct: 18  GWVTSLATSPAQPN---------LLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIV 68

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-DWLISVSKD 179
                   G   +S S D T+ LW+L +   + +   HK  +  +  +     ++S S+D
Sbjct: 69  QDCTVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRD 128

Query: 180 GLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MVITANAESEIKLWEL 227
             +K+W+  + +C+ T + H      + V  N         VI+A  +  +K+W L
Sbjct: 129 KTVKVWNT-LGECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNL 183

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 121/284 (42%), Gaps = 50/284 (17%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++D+    ++  + + H   ++SLD    G +LV+ 
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVM-VLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD K  Q  +                 TL + + +  V +SP D +F+A   
Sbjct: 444 SGDRTVRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 486

Query: 545 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 487 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWN 544

Query: 596 L--------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSF 641
           L                  C  +   H+D +++V          S SKD  V +WD  S 
Sbjct: 545 LRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSG 604

Query: 642 DCIQKLYGHQGEVWALAVSSDG------QAVVSVSHDRSIRVWE 679
           + +  L GH+  V ++AV++        Q   + S D   R+W+
Sbjct: 605 NPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWK 648

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 101/222 (45%), Gaps = 35/222 (15%)

Query: 39  TGALEEVKCWEIKTGELLKTMRDGLPPGAIDTK---AEKPAEAT---------------Y 80
           TG  +  + +++ TGEL+  + D     A+ +       PA                  Y
Sbjct: 326 TGCNKTSQIYKVSTGELIAKLSDDNANSAVSSNNNDQNAPANVNGANANSGNNTNSNDLY 385

Query: 81  LQ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSR 137
           ++   +  +   LA G  D  I+IWD+Q + +++V   H   +  L +  +G +L+SGS 
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 445

Query: 138 DATIILWDLVAETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVE 194
           D T+ +WDL  +TG C L  S +D +T +     D  ++ + S D  +++WD +    VE
Sbjct: 446 DRTVRIWDL--KTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVE 503

Query: 195 T-------HMAHTGECWSLA-VKD-NMVITANAESEIKLWEL 227
                      H    +S+   KD N V++ + +  +KLW L
Sbjct: 504 RLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 566 HKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 625
           + L + S+  S D K + T + DK I+IW +        L  H   + ++ + P      
Sbjct: 382 NDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLV 441

Query: 626 SCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           S S D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++RVW+
Sbjct: 442 SGSGDRTVRIWDLKTGQCSLTLSIEDG-VTTVAVSPGDGKFIAAGSLDRAVRVWD 495

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 90/215 (41%), Gaps = 46/215 (21%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W++KTG+  L  ++ DG     + T A  P +  ++         A G  D  +++W
Sbjct: 449 VRIWDLKTGQCSLTLSIEDG-----VTTVAVSPGDGKFI---------AAGSLDRAVRVW 494

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDL--------- 146
           D +T  ++    S       H  ++  + F + G +++SGS D ++ LW+L         
Sbjct: 495 DSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSS 554

Query: 147 ---VAETGLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHT 200
                    C +    HKD +  +    ND++++S SKD  +  WD K    +     H 
Sbjct: 555 NNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHR 614

Query: 201 GECWSLAV--------KDNMVITANAESEIKLWEL 227
               S+AV        K  +  T + +   ++W+ 
Sbjct: 615 NSVISVAVANRTPLGPKYQVFATGSGDCRARIWKF 649

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/157 (18%), Positives = 67/157 (42%), Gaps = 27/157 (17%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTM--RDGLPPGAIDTKAEKPAEATYLQYHEE 86
           SPG    +  G+L+  V+ W+ +TG L++ +   + L  G  D+          + + ++
Sbjct: 475 SPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDS-------VYSVVFTKD 527

Query: 87  TFILAVGYADGTIKIWDMQ--------------TQTVLIVFHSHSSAITILRFDQTGTRL 132
              +  G  D ++K+W+++                T  + +  H   +  +        +
Sbjct: 528 GNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYI 587

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEN 169
           +SGS+D  ++ WD  +   L  L+ H++++  +   N
Sbjct: 588 LSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVAN 624

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 107/250 (42%), Gaps = 24/250 (9%)

Query: 433 LPGGALVILGTRAGQLQLF--DLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKT 490
           L G +L+     + Q   F  D   ST++      H+  ++S   + D   LV+ S DKT
Sbjct: 502 LDGSSLINPKYSSSQFDRFSQDNTCSTLV-----GHSGTVYSTSFSPDNMYLVSGSEDKT 556

Query: 491 VKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVK 550
           VK W       LV                        +W VK SP   + A +  D T +
Sbjct: 557 VKLWSMDTHTALV----------------NYKGHNHPVWDVKFSPLGHYFASASHDQTAR 600

Query: 551 VFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQD 610
           ++  D +       GH   V ++    +   + T S+DK  ++W +  GD  +    H  
Sbjct: 601 LWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 660

Query: 611 SIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGH-QGEVWALAVSSDGQAVVSV 669
            +++ +  P+     + S+DG +  WD  +   I+++ GH +  V +L+ + +G  ++S 
Sbjct: 661 PVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISG 720

Query: 670 SHDRSIRVWE 679
             D S+RVW+
Sbjct: 721 GADHSVRVWD 730

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 23/191 (12%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFF------------- 560
           M   H+T      D+  ++ S + R  A    D+ +K++ LD                  
Sbjct: 466 MYTFHNTN----RDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFS 521

Query: 561 -----LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 615
                 +L GH   V S   S D+  +++ S DK +K+W +D      +   H   + +V
Sbjct: 522 QDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDV 581

Query: 616 KFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSI 675
           KF P  H F S S D T + W  +    ++   GH  +V  ++   +G  V + S D++ 
Sbjct: 582 KFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTC 641

Query: 676 RVWE-ETEDQV 685
           R+W+  T D V
Sbjct: 642 RMWDVSTGDSV 652

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H++ +  + F   G  + +GS D T  +WD+   
Sbjct: 590 FASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTG 649

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGEC---WS 205
             +     H   +       D  WL + S+DG+I LWD+   + ++    H        S
Sbjct: 650 DSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 206 LAVKDNMVITANAESEIKLWEL 227
              + N++I+  A+  +++W++
Sbjct: 710 FNKEGNVLISGGADHSVRVWDV 731

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 61/148 (41%), Gaps = 3/148 (2%)

Query: 83  YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATII 142
           +  +   L  G  D T+K+W M T T L+ +  H+  +  ++F   G    S S D T  
Sbjct: 541 FSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTAR 600

Query: 143 LWDLVAETGLCKLRSH-KDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG 201
           LW       L     H  D  T  +  N  ++ + S D   ++WD+     V   + HT 
Sbjct: 601 LWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 660

Query: 202 ECWSLAVKDNM--VITANAESEIKLWEL 227
              S  V  +   + T + +  I LW++
Sbjct: 661 PVLSTQVSPDGRWLATGSEDGVICLWDI 688

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ +   +    G  L +GS D  
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV 682

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I LWD+     + ++R H K+A+  + + +  + LIS   D  +++WD+K
Sbjct: 683 ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/215 (20%), Positives = 83/215 (38%), Gaps = 21/215 (9%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   +E  K  E +    L  ++  LP   + T      + T L++ ++  + A G
Sbjct: 432 PKTALDIKIEIQKVKESRDAIKLDNLQAALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAG 491

Query: 94  YADGTIKIWDMQTQTVLIVFHS------------------HSSAITILRFDQTGTRLISG 135
           + D  IKIW +   +++   +S                  HS  +    F      L+SG
Sbjct: 492 FQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSG 551

Query: 136 SRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVE 194
           S D T+ LW +   T L   + H   +  + +     +  S S D   +LW       + 
Sbjct: 552 SEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLR 611

Query: 195 THMAHTGECWSLAVKDN--MVITANAESEIKLWEL 227
               HT +  +++   N   V T +++   ++W++
Sbjct: 612 IFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 5/119 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH  D+       +   + T +S+   ++W++ T   +R L  G+    L  +  P G  
Sbjct: 615 GHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR-LFLGHTAPVLSTQVSPDGRW 673

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
           +  G+  G + L+D+ +   ++ +      A+ SL    +G  L++  AD +V+ WD K
Sbjct: 674 LATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   + D K L++ S DKTV+ W       LV+                    
Sbjct: 525 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS----------------YKGH 568

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFT 628

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  GD  +    H   ++++   P+     + S+DG +  WD  +   +
Sbjct: 629 GSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRL 688

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  +++L+ S +G  ++S   D S+RVW+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 96/219 (43%), Gaps = 28/219 (12%)

Query: 425 GYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVT 484
           G      F P    ++ G+    ++L+ + + T L + +  H   +W ++ +  G    T
Sbjct: 528 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK-GHNHPVWDVNFSPLGHYFAT 586

Query: 485 ASADKTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAV 542
           AS D+T + W  D      + AG L+                  D+ CV   P   +L  
Sbjct: 587 ASHDQTARLWSCDHIYPLRIFAGHLN------------------DVDCVSFHPNGCYLFT 628

Query: 543 SLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFG 599
              D T +++ +   DS++ FL   GH  PV+S+ +S D + + T S D  I +W +  G
Sbjct: 629 GSSDKTCRMWNVSTGDSVRLFL---GHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTG 685

Query: 600 DCHKSLFAH-QDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
              K +  H +++I ++ +  E +   S   D +V+ WD
Sbjct: 686 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 19/178 (10%)

Query: 520 TTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------------F 560
           T  +  +D+ C+  S + R  A    D+ +K++ LD                        
Sbjct: 461 TFQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTC 520

Query: 561 LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
            +L GH   V S   S D+K +++ S DK +++W +D      S   H   + +V F P 
Sbjct: 521 KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPL 580

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
            H F + S D T + W  +    ++   GH  +V  ++   +G  + + S D++ R+W
Sbjct: 581 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMW 638

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H + +  + F   G  L +GS D T  +W++   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGEC---WS 205
             +     H   +  I    D  WL + S+DG+I +WD+   + ++    H        S
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 206 LAVKDNMVITANAESEIKLWEL 227
            + + N++I+  A+  +++W+L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     L  G +D T ++W++ T   + +F  H++ +  +     G  L +GS D  
Sbjct: 617 VSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGI 676

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+AI  + + +  + LIS   D  +++WD+K
Sbjct: 677 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 6/133 (4%)

Query: 399 LLATASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGALVILGTRAGQLQLFDLAS 455
           L   +S+   ++WN+ T   +R L  G+    +     P G  +  G+  G + ++D+ +
Sbjct: 626 LFTGSSDKTCRMWNVSTGDSVR-LFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGT 684

Query: 456 STMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
              L+ +      AI+SL  + +G  L++  AD +V+ WD K      +   D+  P + 
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKKATTEPSAEPDE--PFIG 742

Query: 516 LIHDTTLDLGEDL 528
            + D T  + +D+
Sbjct: 743 YLGDVTASINQDI 755

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 79/219 (36%), Gaps = 28/219 (12%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   LE  K  E +    L  ++  LP   + T      + + L + ++  + A G
Sbjct: 425 PKTALDLKLEIQKVKESRDAIKLDNLQLALPSVCMYTFQNTNKDMSCLDFSDDCRVAAAG 484

Query: 94  YADGTIKIWDMQTQTVL---IVFHS----------------HSSAITILRFDQTGTRLIS 134
           + D  IKIW +   ++    IV ++                HS  +    F      L+S
Sbjct: 485 FQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCKTLVGHSGTVYSTSFSPDNKYLLS 544

Query: 135 GSRDATIILWDLVAETGLCKLRSHKDAITGIWCEN----DDWLISVSKDGLIKLWDMKVH 190
           GS D T+ LW +   T L   + H      +W  N      +  + S D   +LW     
Sbjct: 545 GSEDKTVRLWSMDTHTALVSYKGHNHP---VWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 191 QCVETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
             +     H    +C S       + T +++   ++W +
Sbjct: 602 YPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNV 640

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+ G  DG I +WD+ T   L     H  +AI  L + + G  LISG  D ++ +WDL  
Sbjct: 668 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKK 727

Query: 149 ET 150
            T
Sbjct: 728 AT 729

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 11/65 (16%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +  W+I TG+ LK MR G    AI +          L Y +E  +L  G AD ++++WD+
Sbjct: 677 INVWDIGTGKRLKQMR-GHGKNAIYS----------LSYSKEGNVLISGGADHSVRVWDL 725

Query: 105 QTQTV 109
           +  T 
Sbjct: 726 KKATT 730

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 125/284 (44%), Gaps = 45/284 (15%)

Query: 401 ATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLE 460
           A+A++ N K       +   +L   Y     F P G  +  G     ++++DLA+  ++ 
Sbjct: 450 ASATSENAKASPAVATSASSDL---YIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVM 506

Query: 461 NIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDT 520
            ++  H   I+SLD    G +LV+ S D+TV+ WD +  Q                    
Sbjct: 507 TLQ-GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQ-----------------CSL 548

Query: 521 TLDLGEDLWCVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLSLY---------GHKLPV 570
           TL + + +  V +SP D + +A   LD TV+++  DS   FL            GHK  V
Sbjct: 549 TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIW--DSETGFLVERLDSENELGTGHKDSV 606

Query: 571 LSMDISHDSKLIITSSADKNIKIWGL------------DFGDCHKSLFAHQDSIMNVKFL 618
            S+  + D   +++ S D+++K+W L            +      +   H+D +++V   
Sbjct: 607 YSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATT 666

Query: 619 PESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSD 662
                  S SKD  V +WD  S + +  L GH+  V ++AV++D
Sbjct: 667 QNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVAND 710

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 84/162 (51%), Gaps = 11/162 (6%)

Query: 527 DLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
           DL+   V  SP+ +FLA    D  ++++ L + +  ++L GH+  + S+D       +++
Sbjct: 470 DLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVS 529

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC-SKDGTVKYWDGNSFDC 643
            S D+ ++IW L  G C  +L + +D +  V   P      +  S D TV+ WD  +   
Sbjct: 530 GSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFL 588

Query: 644 IQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           +++L        GH+  V+++  + DG  VVS S DRS+++W
Sbjct: 589 VERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 630

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 114/250 (45%), Gaps = 39/250 (15%)

Query: 37  VITGALEEVKCWEIKTGELLKTMRD--GLPPGAIDTKA------EKPAEAT------YLQ 82
           + TG  +  + +++ TGEL+  + +     P   D  A        PA AT      Y++
Sbjct: 415 LATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIR 474

Query: 83  ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDA 139
              +  +   LA G  D  I+IWD+ T+ +++    H   I  L +  +G +L+SGS D 
Sbjct: 475 SVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDR 534

Query: 140 TIILWDLVAETGLCKLR-SHKDAITGIWCENDDW--LISVSKDGLIKLWDMKVHQCVET- 195
           T+ +WDL   TG C L  S +D +T +     D   + + S D  +++WD +    VE  
Sbjct: 535 TVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERL 592

Query: 196 ------HMAHTGECWSLA-VKDNM-VITANAESEIKLWELDLERPNGSMLLEKGSYEKQS 247
                    H    +S+   +D   V++ + +  +KLW  +L   NG      G+ E ++
Sbjct: 593 DSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW--NLRSANG------GTAEGKA 644

Query: 248 KQRCTELSFT 257
               +E+++T
Sbjct: 645 NTAASEVTYT 654

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 2/111 (1%)

Query: 570 VLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSK 629
           + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S S 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++R+W+
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGDGKLIAAGSLDRTVRIWD 582

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 102/228 (44%), Gaps = 21/228 (9%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   S DKL++ + +  +++W+++T  C   L     +    + PG G L+
Sbjct: 510 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLI 569

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG  +V+ S D++VK 
Sbjct: 570 AAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKL 629

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGED-LWCVKISPEDRFLAVSLLDNTVKVF 552
           W+ +       GT +          + T    +D +  V  +  D F+     D  V  +
Sbjct: 630 WNLRSAN---GGTAEGKA--NTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFW 684

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKL------IITSSADKNIKIW 594
              S    L L GH+  V+S+ +++D  L        T S D   +IW
Sbjct: 685 DTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 94/219 (42%), Gaps = 44/219 (20%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++TG+  L  ++ DG     + T A  P +           ++A G  D T++IW
Sbjct: 536 VRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGDGK---------LIAAGSLDRTVRIW 581

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCK- 154
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L +  G    
Sbjct: 582 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAE 641

Query: 155 -----------LRSHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGE 202
                         HKD +  +   +ND++++S SKD  +  WD      +     H   
Sbjct: 642 GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNS 701

Query: 203 CWSLAVKDN--------MVITANAESEIKLWELDLERPN 233
             S+AV ++        +  T + + + ++W+   +  N
Sbjct: 702 VISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTSN 740

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 69/159 (43%), Gaps = 25/159 (15%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTM--RDGLPPGAIDTKAEKPAEATYLQYHEE 86
           SPG    +  G+L+  V+ W+ +TG L++ +   + L  G  D+          + +  +
Sbjct: 562 SPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDS-------VYSVVFTRD 614

Query: 87  TFILAVGYADGTIKIWDMQ------------TQTVLIVFHSHSSAITILRFDQTGTRLIS 134
              +  G  D ++K+W+++            T    + +  H   +  +   Q    ++S
Sbjct: 615 GHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILS 674

Query: 135 GSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWL 173
           GS+D  ++ WD  +   L  L+ H++++  +   ND  L
Sbjct: 675 GSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPL 713

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   + D K L++ S DKTV+ W       LV                +    
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 566

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 567 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  GD  +    H   ++++   P+     + S+DG +  WD  +   +
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  +++L+ S +G  ++S   D ++RVW+
Sbjct: 687 KQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWD 722

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 18/184 (9%)

Query: 520 TTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFL-----------------S 562
           T  +  +D+ C+  S + R  A    D+ +K++ LD                       +
Sbjct: 461 TFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKT 520

Query: 563 LYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESH 622
           L GH   V S   S D+K +++ S DK +++W +D      S   H   + +V F P  H
Sbjct: 521 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGH 580

Query: 623 NFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE-ET 681
            F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+  T
Sbjct: 581 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 640

Query: 682 EDQV 685
            D V
Sbjct: 641 GDSV 644

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 28/219 (12%)

Query: 425 GYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVT 484
           G      F P    ++ G+    ++L+ + + T L + +  H   +W +  +  G    T
Sbjct: 526 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK-GHNHPVWDVSFSPLGHYFAT 584

Query: 485 ASADKTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAV 542
           AS D+T + W  D      + AG L+                  D+ CV   P   ++  
Sbjct: 585 ASHDQTARLWSCDHIYPLRIFAGHLN------------------DVDCVSFHPNGCYVFT 626

Query: 543 SLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFG 599
              D T +++ +   DS++ FL   GH  PV+S+ +  D + + T S D  I +W +  G
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFL---GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG 683

Query: 600 DCHKSLFAH-QDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
              K +  H +++I ++ +  E +   S   D TV+ WD
Sbjct: 684 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWD 722

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ +  +     G  L +GS D  
Sbjct: 615 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGI 674

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+AI  + + +  + LIS   D  +++WD+K
Sbjct: 675 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 3/141 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           L  G  D T+++W M T T L+ +  H+  +  + F   G    + S D T  LW     
Sbjct: 540 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 599

Query: 150 TGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             L     H + +  + +  N  ++ + S D   ++WD+     V   + HT    S+AV
Sbjct: 600 YPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAV 659

Query: 209 --KDNMVITANAESEIKLWEL 227
                 + T + +  I +W++
Sbjct: 660 CPDGRWLSTGSEDGIINVWDI 680

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 68/150 (45%), Gaps = 7/150 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH  D+       +   + T +S+   ++W++ T   +R L  G+    +     P G  
Sbjct: 607 GHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR-LFLGHTAPVISIAVCPDGRW 665

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV 498
           +  G+  G + ++D+ +   L+ +      AI+SL  + +G  L++  AD TV+ WD K 
Sbjct: 666 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKK 725

Query: 499 EQELVAGTLDKFVPKMKLIHDTTLDLGEDL 528
                +   D+  P +  + D T  + +D+
Sbjct: 726 ATTEPSAEPDE--PFIGYLGDVTASINQDI 753

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 76/214 (35%), Gaps = 20/214 (9%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   LE  K  E +    L  ++  LP   + T      + + L + ++  I A G
Sbjct: 425 PKTALDLKLEIQKVKESRDAIKLDNLQLALPSVCMYTFQNTNKDMSCLDFSDDCRIAAAG 484

Query: 94  YADGTIKIWDMQTQTVLI-----------------VFHSHSSAITILRFDQTGTRLISGS 136
           + D  IKIW +   ++                       HS  +    F      L+SGS
Sbjct: 485 FQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGS 544

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVET 195
            D T+ LW +   T L   + H   +  + +     +  + S D   +LW       +  
Sbjct: 545 EDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRI 604

Query: 196 HMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
              H    +C S       V T +++   ++W++
Sbjct: 605 FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 638

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+ G  DG I +WD+ T   L     H  +AI  L + + G  LISG  D T+ +WDL  
Sbjct: 666 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKK 725

Query: 149 ET 150
            T
Sbjct: 726 AT 727

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 11/65 (16%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +  W+I TG+ LK MR G    AI +          L Y +E  +L  G AD T+++WD+
Sbjct: 675 INVWDIGTGKRLKQMR-GHGKNAIYS----------LSYSKEGNVLISGGADHTVRVWDL 723

Query: 105 QTQTV 109
           +  T 
Sbjct: 724 KKATT 728

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 97/209 (46%), Gaps = 4/209 (1%)

Query: 472 SLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCV 531
           SLD +SD     T   D  +K W     +       ++   ++  I  T +   + ++ V
Sbjct: 710 SLDFSSDYTLAATGFQDSYIKIWSL---EGTSINENEQNYSQINSIFKTLVGHSDAVYSV 766

Query: 532 KISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISH-DSKLIITSSADKN 590
             SP +RFL     D T +++  D+ K  +S  GH+ P+  ++ S   + L  T+S+D  
Sbjct: 767 NFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNT 826

Query: 591 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGH 650
            ++W  D     + L  H   +  V F P     F+ S D T + WD +S D ++   GH
Sbjct: 827 ARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGH 886

Query: 651 QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
              V A AVS DG+ + + + D +I VW+
Sbjct: 887 SSAVTATAVSPDGRWLSTANEDGTITVWD 915

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 99/217 (45%), Gaps = 18/217 (8%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+ A++S++ +   + L++ S DKT + W     + LV+     +    K I       
Sbjct: 758 GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVS-----YKGHEKPI------- 805

Query: 525 GEDLWCVKISPE-DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
               W V  SP  +   A +  DNT +V+  D +     L GH   V  +    + + + 
Sbjct: 806 ----WDVNFSPTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVF 861

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           T S+DK  ++W L  GD  +    H  ++      P+     + ++DGT+  WD  S   
Sbjct: 862 TGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKK 921

Query: 644 IQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           ++ + GH +  +++L+ +  G  +VS   D S+RVW+
Sbjct: 922 LKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWD 958

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 69/143 (48%), Gaps = 4/143 (2%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           + A   +D T ++W       + +   H S +  + F   G  + +GS D T  +WDL +
Sbjct: 817 LFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSS 876

Query: 149 ETGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAH-TGECWSL 206
              +     H  A+T      D  WL + ++DG I +WD+   + +++   H     +SL
Sbjct: 877 GDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSL 936

Query: 207 AVKD--NMVITANAESEIKLWEL 227
           +     N+++++ A++ +++W++
Sbjct: 937 SYNKTGNILVSSGADNSVRVWDI 959

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ +   + +F  HSSA+T       G  L + + D T
Sbjct: 851 VSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGT 910

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+ +   L  +R H K++I  + + +  + L+S   D  +++WD+K
Sbjct: 911 ITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 66/182 (36%), Gaps = 17/182 (9%)

Query: 63  LPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM-------------QTQTV 109
           LP  ++ T        + L +  +  + A G+ D  IKIW +             Q  ++
Sbjct: 693 LPSVSMYTYTNTEKNMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSI 752

Query: 110 LIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAI--TGIWC 167
                 HS A+  + F      L+SGS D T  LW      GL   + H+  I       
Sbjct: 753 FKTLVGHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSP 812

Query: 168 ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG--ECWSLAVKDNMVITANAESEIKLW 225
             ++   + S D   ++W       V     H    +C S       V T +++   ++W
Sbjct: 813 TGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMW 872

Query: 226 EL 227
           +L
Sbjct: 873 DL 874

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 5/119 (4%)

Query: 383 GHRTDLRAADISSDDKLLATASNGNL-KVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH +D+       + + + T S+    ++W++ +   +R L  G++         P G  
Sbjct: 843 GHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVR-LFIGHSSAVTATAVSPDGRW 901

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
           +      G + ++D+ S   L+++      +I+SL     G  LV++ AD +V+ WD K
Sbjct: 902 LSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+    DGTI +WD+ +   L     H  ++I  L +++TG  L+S   D ++ +WD+  
Sbjct: 902 LSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIKK 961

Query: 149 ET 150
            T
Sbjct: 962 NT 963

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   + D + L++AS DKTV+ W       LV                     
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLV----------------NYKGH 523

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  GD  +    H   + +    P+     + S+DG +  WD  +   +
Sbjct: 584 GSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRL 643

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  V++L+ S +G  ++S   D S+RVW+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 90/220 (40%), Gaps = 28/220 (12%)

Query: 424 CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLV 483
            G      F P    ++  +    ++L+   + T L N +  H   IW +  +  G    
Sbjct: 482 SGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYK-GHNHPIWDVAFSPLGHYFA 540

Query: 484 TASADKTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLA 541
           TAS D+T + W  D      + AG L+                  D+  V   P   ++ 
Sbjct: 541 TASHDQTARLWSCDHIYPLRIFAGHLN------------------DVDTVSFHPNGTYVF 582

Query: 542 VSLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
               D T +++ +   DS++ FL   GH  PV S  +S D + + T S D  I +W +  
Sbjct: 583 TGSSDKTCRMWDITSGDSVRLFL---GHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGT 639

Query: 599 GDCHKSLFAH-QDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
           G   K +  H ++++ ++ +  E H   S   D +V+ WD
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 82/181 (45%), Gaps = 17/181 (9%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDS--MKFFL---------- 561
           M   H+T      ++  ++ S + R  A    D+ +K++ LD   +K  L          
Sbjct: 420 MYTFHNTN----SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNN 475

Query: 562 -SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
            +L GH   V S   S D++ ++++S DK +++W  D      +   H   I +V F P 
Sbjct: 476 ETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPL 535

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEE 680
            H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

Query: 681 T 681
           T
Sbjct: 596 T 596

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 67/142 (47%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H + +  + F   GT + +GS D T  +WD+ + 
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSG 598

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAH-TGECWSLA 207
             +     H   +T      D  WL + S+DG+I +WD+   + ++    H     +SL+
Sbjct: 599 DSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 208 V--KDNMVITANAESEIKLWEL 227
              + +++I+  A+  +++W++
Sbjct: 659 YSKEGHVLISGGADHSVRVWDV 680

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ +   + +F  H++ +T       G  L +GS D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGV 631

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+A+  + + +    LIS   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/202 (20%), Positives = 77/202 (38%), Gaps = 16/202 (7%)

Query: 42  LEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKI 101
           LE  K  E +    L+ ++   P   + T     +E T L++ ++  + A G+ D  IKI
Sbjct: 394 LEIQKVRESRDAIRLENLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKI 453

Query: 102 WDMQTQTVLIVFHS-------------HSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           W +  + +     S             HS  +    F      L+S S D T+ LW    
Sbjct: 454 WSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDT 513

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
            T L   + H   I  + +     +  + S D   +LW       +     H  +  +++
Sbjct: 514 YTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVS 573

Query: 208 VKDN--MVITANAESEIKLWEL 227
              N   V T +++   ++W++
Sbjct: 574 FHPNGTYVFTGSSDKTCRMWDI 595

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 37  VITGALEEV-KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           V TG+ ++  + W+I +G+ ++       P  + + A  P          +   L+ G  
Sbjct: 581 VFTGSSDKTCRMWDITSGDSVRLFLGHTAP--VTSTAVSP----------DGRWLSTGSE 628

Query: 96  DGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDL---VAETG 151
           DG I +WD+ T   L     H  +A+  L + + G  LISG  D ++ +WD+    AE G
Sbjct: 629 DGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPG 688

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   + D K L++ S DKTV+ W       LV                +    
Sbjct: 527 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 570

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 571 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 630

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  GD  +    H   ++ +   P+     + S+DG +  WD  +   +
Sbjct: 631 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 690

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  +++L+ S +G  ++S   D S+RVW+
Sbjct: 691 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 726

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 109/249 (43%), Gaps = 30/249 (12%)

Query: 395 SDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLA 454
           ++  ++  ++N N +  +   KT + +   G      F P    ++ G+    ++L+ + 
Sbjct: 502 NNPNIMLNSANNNYRDDDPTCKTLVGH--SGTVYSTSFSPDNKYLLSGSEDKTVRLWSMD 559

Query: 455 SSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFW--DFKVEQELVAGTLDKFVP 512
           + T L + +  H   +W ++ +  G    TAS D+T + W  D      + AG L+    
Sbjct: 560 THTALVSYK-GHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLN---- 614

Query: 513 KMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFL---DSMKFFLSLYGHKLP 569
                         D+ CV   P   ++     D T +++ +   DS++ FL   GH  P
Sbjct: 615 --------------DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFL---GHTAP 657

Query: 570 VLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMNVKFLPESHNFFSCS 628
           V+ + +S D + + T S D  I IW +  G   K +  H +++I ++ +  E +   S  
Sbjct: 658 VICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGG 717

Query: 629 KDGTVKYWD 637
            D +V+ WD
Sbjct: 718 ADHSVRVWD 726

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 80/187 (42%), Gaps = 21/187 (11%)

Query: 520 TTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------------- 559
           T  +  +D+ C+  S + R  A    D+ +K++ LD                        
Sbjct: 462 TFQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPT 521

Query: 560 FLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 619
             +L GH   V S   S D+K +++ S DK +++W +D      S   H   + +V F P
Sbjct: 522 CKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSP 581

Query: 620 ESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
             H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+
Sbjct: 582 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWD 641

Query: 680 -ETEDQV 685
             T D V
Sbjct: 642 VSTGDSV 648

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ +  +     G  L +GS D  
Sbjct: 619 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 678

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+AI  + + +  + LIS   D  +++WD+K
Sbjct: 679 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 60/141 (42%), Gaps = 3/141 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           L  G  D T+++W M T T L+ +  H+  +  + F   G    + S D T  LW     
Sbjct: 544 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 603

Query: 150 TGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGE--CWSL 206
             L     H + +  + +  N  ++ + S D   ++WD+     V   + HT    C ++
Sbjct: 604 YPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAV 663

Query: 207 AVKDNMVITANAESEIKLWEL 227
           +     + T + +  I +W++
Sbjct: 664 SPDGRWLSTGSEDGIINIWDI 684

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 69/150 (46%), Gaps = 7/150 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH  D+       +   + T +S+   ++W++ T   +R L  G+    +C    P G  
Sbjct: 611 GHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR-LFLGHTAPVICIAVSPDGRW 669

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV 498
           +  G+  G + ++D+ +   L+ +      AI+SL  + +G  L++  AD +V+ WD K 
Sbjct: 670 LSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKK 729

Query: 499 EQELVAGTLDKFVPKMKLIHDTTLDLGEDL 528
                +   D+  P +  + D T  + +D+
Sbjct: 730 ATTEPSAEPDE--PFIGYLGDVTASINQDI 757

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/217 (19%), Positives = 80/217 (36%), Gaps = 23/217 (10%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   +E  K  E +    L  ++  LP   + T      + + L + ++  I A G
Sbjct: 426 PKTALDLKMEIQKVKESRDAIKLDNLQLALPSVCMYTFQNTNKDMSCLNFSDDCRIAAAG 485

Query: 94  YADGTIKIWDMQTQTVL---IVFHS-----------------HSSAITILRFDQTGTRLI 133
           + D  IKIW +   ++    I+ +S                 HS  +    F      L+
Sbjct: 486 FQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGHSGTVYSTSFSPDNKYLL 545

Query: 134 SGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQC 192
           SGS D T+ LW +   T L   + H   +  + +     +  + S D   +LW       
Sbjct: 546 SGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYP 605

Query: 193 VETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
           +     H    +C S       V T +++   ++W++
Sbjct: 606 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 642

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+ G  DG I IWD+ T   L     H  +AI  L + + G  LISG  D ++ +WDL  
Sbjct: 670 LSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKK 729

Query: 149 ET 150
            T
Sbjct: 730 AT 731

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 93/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+ A++S   + D K L++ S DKTV+ W       LV+                    
Sbjct: 539 GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYK----------------GH 582

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W VK SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 583 NHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFT 642

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            SADK  ++W +  GD  +    H   ++     P+     +  +DG +  WD  +   +
Sbjct: 643 GSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRL 702

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  + + + + +G  ++S   D S+RVW+
Sbjct: 703 KQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWD 738

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 84/193 (43%), Gaps = 25/193 (12%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLS----------- 562
           M   H+T     +D+ C++ S + R  A    D+ +K++ LD      +           
Sbjct: 472 MYTFHNT----NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEIL 527

Query: 563 ---------LYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 613
                    L GH   V S   S D+K +++ S DK +++W +D      S   H   + 
Sbjct: 528 TTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVW 587

Query: 614 NVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDR 673
           +VKF P  H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D+
Sbjct: 588 DVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADK 647

Query: 674 SIRVWE-ETEDQV 685
           + R+W+  T D V
Sbjct: 648 TCRMWDISTGDSV 660

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 4/143 (2%)

Query: 88  FILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLV 147
           F+L+ G  D T+++W M T T L+ +  H+  +  ++F   G    + S D T  LW   
Sbjct: 555 FLLS-GSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCD 613

Query: 148 AETGLCKLRSH-KDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSL 206
               L     H  D  T  +  N  ++ + S D   ++WD+     V   + HT    + 
Sbjct: 614 HIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTT 673

Query: 207 AVKDNM--VITANAESEIKLWEL 227
           AV  +   + T   +  I +W++
Sbjct: 674 AVTPDGRWLCTGGEDGVINVWDI 696

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G AD T ++WD+ T   + +F  H++ +        G  L +G  D  
Sbjct: 631 VSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGV 690

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+AI    + +  + LIS   D  +++WD+K
Sbjct: 691 INVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 82/212 (38%), Gaps = 29/212 (13%)

Query: 42  LEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKI 101
           LE  K  E +    L  ++  LP   + T      + + L++ ++  + A G+ D  IKI
Sbjct: 446 LEIQKVKESRDAIRLDNIQTSLPSVCMYTFHNTNKDMSCLEFSDDCRLAATGFQDSFIKI 505

Query: 102 WDM-----------------------QTQTVLIVFHSHSSAITILRFDQTGTRLISGSRD 138
           W +                       +T ++LI    HS A+    F      L+SGS D
Sbjct: 506 WSLDGSSLVTNKLPSYKKEEILTTGDETSSLLI---GHSGAVYSTSFSPDNKFLLSGSED 562

Query: 139 ATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHM 197
            T+ LW +   T L   + H   +  + +     +  + S D   +LW       +    
Sbjct: 563 KTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFA 622

Query: 198 AHTGECWSLAVKDN--MVITANAESEIKLWEL 227
            H  +  +++   N   V T +A+   ++W++
Sbjct: 623 GHLNDVETVSFHPNGCYVFTGSADKTCRMWDI 654

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 14/116 (12%)

Query: 37  VITGALEEV-KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           V TG+ ++  + W+I TG+ ++       P  + T A  P          +   L  G  
Sbjct: 640 VFTGSADKTCRMWDISTGDSVRLFLGHTAP--VLTTAVTP----------DGRWLCTGGE 687

Query: 96  DGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVAET 150
           DG I +WD+ T   L     H  +AI    F++ G  LISG  D ++ +WDL   T
Sbjct: 688 DGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLKKAT 743

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 5/119 (4%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH  D+       +   + T S +   ++W+I T   +R L  G+    L     P G  
Sbjct: 623 GHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVR-LFLGHTAPVLTTAVTPDGRW 681

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
           +  G   G + ++D+ +   L+ +      AI S     +G  L++  AD +V+ WD K
Sbjct: 682 LCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 124/285 (43%), Gaps = 48/285 (16%)

Query: 426 YALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTA 485
           Y     F P G  +  G     ++++DL +  ++  ++  H   I+SLD    G +LV+ 
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 508

Query: 486 SADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSL 544
           S D+TV+ WD +  Q  +                 TL + + +  V +SP D + +A   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 545 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISHDSKLIITSSADKNIKIWG 595
           LD TV+++  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 552 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 609

Query: 596 LDFGDCHK------------SLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           L   +               +   H+D +++V          S SKD  V +WD  S + 
Sbjct: 610 LRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 669

Query: 644 IQKLYGHQGEVWALAVSSDGQ------AVVSVSHDRSIRVWEETE 682
           +  L GH+  V ++AV++D           + S D   R+W+ T+
Sbjct: 670 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYTK 714

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 115/252 (45%), Gaps = 41/252 (16%)

Query: 37  VITGALEEVKCWEIKTGELLKTMRD---GLPPG-------AIDTKAEKPAEAT------Y 80
           + TG  +  + +++ TGEL+  + +     P G         +   + PA +T      Y
Sbjct: 391 LATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLY 450

Query: 81  LQ---YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSR 137
           ++   +  +   LA G  D  I+IWD+ T+ +++    H   I  L +  +G +L+SGS 
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 138 DATIILWDLVAETGLCKLR-SHKDAITGIWCENDDW--LISVSKDGLIKLWDMKVHQCVE 194
           D T+ +WDL A  G C L  S +D +T +     D   + + S D  +++WD +    VE
Sbjct: 511 DRTVRIWDLRA--GQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVE 568

Query: 195 T-------HMAHTGECWSLA-VKDNM-VITANAESEIKLWELDLERPNGSMLLEKGSYEK 245
                      H    +S+   +D   V++ + +  +KLW  +L   NG      GS E 
Sbjct: 569 RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW--NLRSANG------GSTEG 620

Query: 246 QSKQRCTELSFT 257
           ++    +E+++T
Sbjct: 621 KANTAASEVTYT 632

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC 627
           L + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S 
Sbjct: 449 LYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSG 508

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS-SDGQAVVSVSHDRSIRVWE 679
           S D TV+ WD  +  C   L    G V  +AVS  DG+ + + S DR++R+W+
Sbjct: 509 SGDRTVRIWDLRAGQCSLTLSIEDG-VTTVAVSPGDGKLIAAGSLDRTVRIWD 560

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 98/227 (43%), Gaps = 19/227 (8%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFL-PG-GALV 439
           GH  D+ + D   S DKL++ + +  +++W+++   C   L     +    + PG G L+
Sbjct: 488 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLI 547

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG  +V+ S D++VK 
Sbjct: 548 AAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKL 607

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF 553
           W+ +       G   +          T     + +  V  +  D F+     D  V  + 
Sbjct: 608 WNLRSAN----GGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWD 663

Query: 554 LDSMKFFLSLYGHKLPVLSMDISHDSKL------IITSSADKNIKIW 594
             S    L L GH+  V+S+ +++D  L        T S D   +IW
Sbjct: 664 TPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 91/212 (42%), Gaps = 44/212 (20%)

Query: 45  VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW 102
           V+ W+++ G+  L  ++ DG     + T A  P +           ++A G  D T++IW
Sbjct: 514 VRIWDLRAGQCSLTLSIEDG-----VTTVAVSPGDGK---------LIAAGSLDRTVRIW 559

Query: 103 DMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWDLVAETGL--- 152
           D +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+L +  G    
Sbjct: 560 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTE 619

Query: 153 ---------CKLRSHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGE 202
                         HKD +  +   +ND++++S SKD  +  WD      +     H   
Sbjct: 620 GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNS 679

Query: 203 CWSLAVKDN--------MVITANAESEIKLWE 226
             S+AV ++        +  T + + + ++W+
Sbjct: 680 VISVAVANDHPLGPEYGVFATGSGDCKARIWK 711

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 69/159 (43%), Gaps = 25/159 (15%)

Query: 33  SPGQ---VITGALEE-VKCWEIKTGELLKTM--RDGLPPGAIDTKAEKPAEATYLQYHEE 86
           SPG    +  G+L+  V+ W+ +TG L++ +   + L  G  D+          + +  +
Sbjct: 540 SPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDS-------VYSVVFTRD 592

Query: 87  TFILAVGYADGTIKIWDMQ------------TQTVLIVFHSHSSAITILRFDQTGTRLIS 134
              +  G  D ++K+W+++            T    + +  H   +  +   Q    ++S
Sbjct: 593 GHGVVSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILS 652

Query: 135 GSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWL 173
           GS+D  ++ WD  +   L  L+ H++++  +   ND  L
Sbjct: 653 GSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPL 691

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 100/237 (42%), Gaps = 22/237 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++ S DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSL-LDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 574
           ++ D TL             +D   A+S   D T++++ + + + +    GHK  V+S+ 
Sbjct: 67  IVQDCTL------------TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVA 114

Query: 575 ISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN-----FFSCSK 629
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGN 173

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQVF 686
           D  VK W+ N F       GH G V  +  S DG  + S   D  I +W   E +  
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 9/140 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC----ENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVK 209
             H D ++ +      +NDD   +IS   D ++K W++   Q     + H G   ++   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 210 DN--MVITANAESEIKLWEL 227
            +  ++ +A  + EI LW L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 108/254 (42%), Gaps = 40/254 (15%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           + H+  +    LT DG   ++AS DKT++ WD    +                       
Sbjct: 62  KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM 121

Query: 502 LVAGTLDKFVPKMKLIHDTTLD--LGEDLWC--VKISPEDRFL-AVSLL----DNTVKVF 552
           +++G+ DK + K+  I    L   LG + W   V+I+P D+   +V+++    D  VK +
Sbjct: 122 IISGSRDKTI-KVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAW 180

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
            L+  +      GH   V ++  S D  LI ++  D  I +W L       +L A QD +
Sbjct: 181 NLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEV 239

Query: 613 MNVKFLPESHNFFSCSKDGTVKY-WDGNSF--DCIQKLYGH----QGEVWALAVSSDGQA 665
             + F P  +   + +  G   +  D  S   D   +  G+    +    +LA S+DGQ 
Sbjct: 240 FALAFSPNRYWLAAATASGIKIFCLDPQSLVDDLRPEFAGYNKSAEPHAVSLAWSADGQT 299

Query: 666 VVSVSHDRSIRVWE 679
           + +   D  IRVW+
Sbjct: 300 LFAGYTDSVIRVWQ 313

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 76/182 (41%), Gaps = 23/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKSDVMSVAI------------DRKASMIISGSRDKTIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++     T  Q  +   +++ G  D  +K W++    +   F  H+  
Sbjct: 145 L-----GHNDWVSQVRIAPTD-QNDDSVTVISAGN-DKMVKAWNLNQFQIEADFVGHNGN 197

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           +  +     GT + S  +D  I+LW+L  +  +  L +  +     +  N  WL + +  
Sbjct: 198 VNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRYWLAAATAS 257

Query: 180 GL 181
           G+
Sbjct: 258 GI 259

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   + D + L++AS DKTV+ W       LV+                    
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVS----------------YKGH 523

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  GD  +    H   +      P+     + S+DG +  WD  +   +
Sbjct: 584 GSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRL 643

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  V++L+ S +G  +VS   D S+RVW+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 81/186 (43%), Gaps = 18/186 (9%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFF------------- 560
           M   H+T      ++  ++ S + R  +    D+ VK++ LD                  
Sbjct: 420 MYTFHNTN----SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNN 475

Query: 561 LSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
            +L GH   V S   S D++ ++++S DK +++W  D      S   H   I +V F P 
Sbjct: 476 ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPL 535

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE- 679
            H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDM 595

Query: 680 ETEDQV 685
            T D V
Sbjct: 596 STGDSV 601

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 90/220 (40%), Gaps = 28/220 (12%)

Query: 424 CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLV 483
            G      F P    ++  +    ++L+   + T L + +  H   IW +  +  G    
Sbjct: 482 SGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYK-GHNHPIWDVAFSPLGHYFA 540

Query: 484 TASADKTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLA 541
           TAS D+T + W  D      + AG L+                  D+  V   P   ++ 
Sbjct: 541 TASHDQTARLWSCDHIYPLRIFAGHLN------------------DVDTVSFHPNGTYVF 582

Query: 542 VSLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
               D T +++ +   DS++ FL   GH  PV +  +S D + + T S D  I +W +  
Sbjct: 583 TGSSDKTCRMWDMSTGDSVRLFL---GHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGT 639

Query: 599 GDCHKSLFAH-QDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
           G   K +  H ++++ ++ +  E H   S   D +++ WD
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 66/142 (46%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H + +  + F   GT + +GS D T  +WD+   
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTG 598

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAH-TGECWSLA 207
             +     H   +T      D  WL + S+DG+I +WD+   + ++    H     +SL+
Sbjct: 599 DSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 208 V--KDNMVITANAESEIKLWEL 227
              + +++++  A+  +++W++
Sbjct: 659 YSKEGHVLVSGGADHSLRVWDV 680

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WDM T   + +F  H++ +T       G  L +GS D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGI 631

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+A+  + + +    L+S   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 76/202 (37%), Gaps = 16/202 (7%)

Query: 42  LEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKI 101
           LE  K  E +    L  ++   P   + T     +E T L++ ++  + + G+ D  +KI
Sbjct: 394 LEIQKVRESRDAIRLDNLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKI 453

Query: 102 WDMQTQTVLIVFHS-------------HSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           W +  + +     S             HS  +    F      L+S S D T+ LW    
Sbjct: 454 WSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDT 513

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
            T L   + H   I  + +     +  + S D   +LW       +     H  +  +++
Sbjct: 514 YTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVS 573

Query: 208 VKDN--MVITANAESEIKLWEL 227
              N   V T +++   ++W++
Sbjct: 574 FHPNGTYVFTGSSDKTCRMWDM 595

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 17/120 (14%)

Query: 37  VITGALEEV-KCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           V TG+ ++  + W++ TG+ ++       P  +   A  P          +   L+ G  
Sbjct: 581 VFTGSSDKTCRMWDMSTGDSVRLFLGHTAP--VTATAVSP----------DGRWLSTGSE 628

Query: 96  DGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDL---VAETG 151
           DG I +WD+ T   L     H  +A+  L + + G  L+SG  D ++ +WD+    AE G
Sbjct: 629 DGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVKKSTAEPG 688

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++AS DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D TL           + +  +   +  D T++++ + + + +    GHK  V+S+DI
Sbjct: 67  IVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   
Sbjct: 116 DKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D  VK W+ N F       GH   +  L  S DG  + S   D  I +W 
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 10/141 (7%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC-----ENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +        +DD   +IS   D ++K W++   Q     + H     +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 KDN--MVITANAESEIKLWEL 227
             +  ++ +A  + EI LW L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 108/259 (41%), Gaps = 24/259 (9%)

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
           C     GA  +  +    L+L+D+A+    +     H + + S+D+      +++ S DK
Sbjct: 71  CTLTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDK 129

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLL-DNT 548
           T+K W  K +        + +V +++++ +   D            +D    +S   D  
Sbjct: 130 TIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------------DDSVTIISAGNDKM 177

Query: 549 VKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAH 608
           VK + L+  +      GH   + ++  S D  LI ++  D  I +W L       +L A 
Sbjct: 178 VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA- 236

Query: 609 QDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWA--LAVS 660
           QD + ++ F P  +   + +  G +K +  +    +  L      Y    E  A  LA S
Sbjct: 237 QDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWS 295

Query: 661 SDGQAVVSVSHDRSIRVWE 679
           +DGQ + +   D  IRVW+
Sbjct: 296 ADGQTLFAGYTDNVIRVWQ 314

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 84/205 (40%), Gaps = 24/205 (11%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLD 523
           + H+  +    LT+DG   ++AS DKT++ WD    +     T  +FV            
Sbjct: 62  KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGHK--------- 107

Query: 524 LGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI------SH 577
              D+  V I  +   +     D T+KV+ +   +   +L GH   V  + +        
Sbjct: 108 --SDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADD 164

Query: 578 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
           DS  II++  DK +K W L+          H  +I  +   P+     S  KDG +  W+
Sbjct: 165 DSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

Query: 638 GNSFDCIQKLYGHQGEVWALAVSSD 662
             +   +  L   Q EV++LA S +
Sbjct: 225 LAAKKAMYTLSA-QDEVFSLAFSPN 248

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 22/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKSDVMSV------------DIDKKASMIISGSRDKTIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++           +   I++ G  D  +K W++    +   F  H+S 
Sbjct: 145 L-----GHNDWVSQVRVVPNEKADDDSVTIISAGN-DKMVKAWNLNQFQIEADFIGHNSN 198

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           I  L     GT + S  +D  I+LW+L A+  +  L +  +  +  +  N  WL + +  
Sbjct: 199 INTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATAT 258

Query: 180 GL 181
           G+
Sbjct: 259 GI 260

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 68/180 (37%), Gaps = 10/180 (5%)

Query: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-D 171
           F  HS  +        G   +S S D T+ LWD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 172 WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MVITANAESEIK 223
            +IS S+D  IK+W +K  QC+ T + H      + V  N         +I+A  +  +K
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 224 LWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSE 283
            W L+  +     +    +    +      L  +   DG    ++L + K M     + E
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDE 239

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   +       D  + +S S D  ++LW
Sbjct: 33  LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLW 92

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWEL 227
           D+   +  +  + H  +  S+ +  K +M+I+ + +  IK+W +
Sbjct: 93  DVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI 136

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++AS DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D TL           + +  +   +  D T++++ + + + +    GHK  V+S+DI
Sbjct: 67  IVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   
Sbjct: 116 DKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D  VK W+ N F       GH   +  L  S DG  + S   D  I +W 
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 10/141 (7%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC-----ENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +        +DD   +IS   D ++K W++   Q     + H     +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 KDN--MVITANAESEIKLWEL 227
             +  ++ +A  + EI LW L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 108/259 (41%), Gaps = 24/259 (9%)

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
           C     GA  +  +    L+L+D+A+    +     H + + S+D+      +++ S DK
Sbjct: 71  CTLTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDK 129

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLL-DNT 548
           T+K W  K +        + +V +++++ +   D            +D    +S   D  
Sbjct: 130 TIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------------DDSVTIISAGNDKM 177

Query: 549 VKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAH 608
           VK + L+  +      GH   + ++  S D  LI ++  D  I +W L       +L A 
Sbjct: 178 VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA- 236

Query: 609 QDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWA--LAVS 660
           QD + ++ F P  +   + +  G +K +  +    +  L      Y    E  A  LA S
Sbjct: 237 QDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWS 295

Query: 661 SDGQAVVSVSHDRSIRVWE 679
           +DGQ + +   D  IRVW+
Sbjct: 296 ADGQTLFAGYTDNVIRVWQ 314

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 84/205 (40%), Gaps = 24/205 (11%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLD 523
           + H+  +    LT+DG   ++AS DKT++ WD    +     T  +FV            
Sbjct: 62  KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGHK--------- 107

Query: 524 LGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI------SH 577
              D+  V I  +   +     D T+KV+ +   +   +L GH   V  + +        
Sbjct: 108 --SDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADD 164

Query: 578 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
           DS  II++  DK +K W L+          H  +I  +   P+     S  KDG +  W+
Sbjct: 165 DSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

Query: 638 GNSFDCIQKLYGHQGEVWALAVSSD 662
             +   +  L   Q EV++LA S +
Sbjct: 225 LAAKKAMYTLSA-QDEVFSLAFSPN 248

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 22/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKSDVMSV------------DIDKKASMIISGSRDKTIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++           +   I++ G  D  +K W++    +   F  H+S 
Sbjct: 145 L-----GHNDWVSQVRVVPNEKADDDSVTIISAGN-DKMVKAWNLNQFQIEADFIGHNSN 198

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           I  L     GT + S  +D  I+LW+L A+  +  L +  +  +  +  N  WL + +  
Sbjct: 199 INTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATAT 258

Query: 180 GL 181
           G+
Sbjct: 259 GI 260

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 68/180 (37%), Gaps = 10/180 (5%)

Query: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-D 171
           F  HS  +        G   +S S D T+ LWD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 172 WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MVITANAESEIK 223
            +IS S+D  IK+W +K  QC+ T + H      + V  N         +I+A  +  +K
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 224 LWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSE 283
            W L+  +     +    +    +      L  +   DG    ++L + K M     + E
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDE 239

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   +       D  + +S S D  ++LW
Sbjct: 33  LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLW 92

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWEL 227
           D+   +  +  + H  +  S+ +  K +M+I+ + +  IK+W +
Sbjct: 93  DVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI 136

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++AS DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D TL           + +  +   +  D T++++ + + + +    GHK  V+S+DI
Sbjct: 67  IVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   
Sbjct: 116 DKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D  VK W+ N F       GH   +  L  S DG  + S   D  I +W 
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 10/141 (7%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC-----ENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +        +DD   +IS   D ++K W++   Q     + H     +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 KDN--MVITANAESEIKLWEL 227
             +  ++ +A  + EI LW L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 108/259 (41%), Gaps = 24/259 (9%)

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
           C     GA  +  +    L+L+D+A+    +     H + + S+D+      +++ S DK
Sbjct: 71  CTLTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDK 129

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLL-DNT 548
           T+K W  K +        + +V +++++ +   D            +D    +S   D  
Sbjct: 130 TIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------------DDSVTIISAGNDKM 177

Query: 549 VKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAH 608
           VK + L+  +      GH   + ++  S D  LI ++  D  I +W L       +L A 
Sbjct: 178 VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA- 236

Query: 609 QDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWA--LAVS 660
           QD + ++ F P  +   + +  G +K +  +    +  L      Y    E  A  LA S
Sbjct: 237 QDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWS 295

Query: 661 SDGQAVVSVSHDRSIRVWE 679
           +DGQ + +   D  IRVW+
Sbjct: 296 ADGQTLFAGYTDNVIRVWQ 314

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 84/205 (40%), Gaps = 24/205 (11%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLD 523
           + H+  +    LT+DG   ++AS DKT++ WD    +     T  +FV            
Sbjct: 62  KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGHK--------- 107

Query: 524 LGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI------SH 577
              D+  V I  +   +     D T+KV+ +   +   +L GH   V  + +        
Sbjct: 108 --SDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADD 164

Query: 578 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
           DS  II++  DK +K W L+          H  +I  +   P+     S  KDG +  W+
Sbjct: 165 DSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

Query: 638 GNSFDCIQKLYGHQGEVWALAVSSD 662
             +   +  L   Q EV++LA S +
Sbjct: 225 LAAKKAMYTLSA-QDEVFSLAFSPN 248

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 22/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKSDVMSV------------DIDKKASMIISGSRDKTIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++           +   I++ G  D  +K W++    +   F  H+S 
Sbjct: 145 L-----GHNDWVSQVRVVPNEKADDDSVTIISAGN-DKMVKAWNLNQFQIEADFIGHNSN 198

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           I  L     GT + S  +D  I+LW+L A+  +  L +  +  +  +  N  WL + +  
Sbjct: 199 INTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATAT 258

Query: 180 GL 181
           G+
Sbjct: 259 GI 260

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 68/180 (37%), Gaps = 10/180 (5%)

Query: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-D 171
           F  HS  +        G   +S S D T+ LWD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 172 WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MVITANAESEIK 223
            +IS S+D  IK+W +K  QC+ T + H      + V  N         +I+A  +  +K
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 224 LWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSE 283
            W L+  +     +    +    +      L  +   DG    ++L + K M     + E
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDE 239

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   +       D  + +S S D  ++LW
Sbjct: 33  LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLW 92

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWEL 227
           D+   +  +  + H  +  S+ +  K +M+I+ + +  IK+W +
Sbjct: 93  DVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI 136

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++AS DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D TL           + +  +   +  D T++++ + + + +    GHK  V+S+DI
Sbjct: 67  IVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   
Sbjct: 116 DKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGN 174

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D  VK W+ N F       GH   +  L  S DG  + S   D  I +W 
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 10/141 (7%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC-----ENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +        +DD   +IS   D ++K W++   Q     + H     +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 209 KDN--MVITANAESEIKLWEL 227
             +  ++ +A  + EI LW L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 108/259 (41%), Gaps = 24/259 (9%)

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
           C     GA  +  +    L+L+D+A+    +     H + + S+D+      +++ S DK
Sbjct: 71  CTLTADGAYALSASWDKTLRLWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDK 129

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLL-DNT 548
           T+K W  K +        + +V +++++ +   D            +D    +S   D  
Sbjct: 130 TIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------------DDSVTIISAGNDKM 177

Query: 549 VKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAH 608
           VK + L+  +      GH   + ++  S D  LI ++  D  I +W L       +L A 
Sbjct: 178 VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA- 236

Query: 609 QDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWA--LAVS 660
           QD + ++ F P  +   + +  G +K +  +    +  L      Y    E  A  LA S
Sbjct: 237 QDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWS 295

Query: 661 SDGQAVVSVSHDRSIRVWE 679
           +DGQ + +   D  IRVW+
Sbjct: 296 ADGQTLFAGYTDNVIRVWQ 314

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 84/205 (40%), Gaps = 24/205 (11%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLD 523
           + H+  +    LT+DG   ++AS DKT++ WD    +     T  +FV            
Sbjct: 62  KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGE-----TYQRFVGHK--------- 107

Query: 524 LGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI------SH 577
              D+  V I  +   +     D T+KV+ +   +   +L GH   V  + +        
Sbjct: 108 --SDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADD 164

Query: 578 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
           DS  II++  DK +K W L+          H  +I  +   P+     S  KDG +  W+
Sbjct: 165 DSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

Query: 638 GNSFDCIQKLYGHQGEVWALAVSSD 662
             +   +  L   Q EV++LA S +
Sbjct: 225 LAAKKAMYTLSA-QDEVFSLAFSPN 248

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 22/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKSDVMSV------------DIDKKASMIISGSRDKTIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++           +   I++ G  D  +K W++    +   F  H+S 
Sbjct: 145 L-----GHNDWVSQVRVVPNEKADDDSVTIISAGN-DKMVKAWNLNQFQIEADFIGHNSN 198

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           I  L     GT + S  +D  I+LW+L A+  +  L +  +  +  +  N  WL + +  
Sbjct: 199 INTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATAT 258

Query: 180 GL 181
           G+
Sbjct: 259 GI 260

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 68/180 (37%), Gaps = 10/180 (5%)

Query: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-D 171
           F  HS  +        G   +S S D T+ LWD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 172 WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MVITANAESEIK 223
            +IS S+D  IK+W +K  QC+ T + H      + V  N         +I+A  +  +K
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 224 LWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSE 283
            W L+  +     +    +    +      L  +   DG    ++L + K M     + E
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDE 239

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   +       D  + +S S D  ++LW
Sbjct: 33  LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLW 92

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWEL 227
           D+   +  +  + H  +  S+ +  K +M+I+ + +  IK+W +
Sbjct: 93  DVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI 136

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+ A++S   + D K L++ S DKTV+ W    +  LV+                    
Sbjct: 561 GHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVS----------------YKGH 604

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 605 NHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFT 664

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  G+  +    H   ++++   P+     S S+DG +  WD  S   +
Sbjct: 665 GSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRL 724

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  V ++  S +G  ++S   D S+RVW+
Sbjct: 725 KQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWD 760

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 90/217 (41%), Gaps = 22/217 (10%)

Query: 424 CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLV 483
            G      F P   L+I G+    ++L+ + + + L + +  H   +W +  +  G    
Sbjct: 563 SGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYK-GHNHPVWDVAFSPMGHYFA 621

Query: 484 TASADKTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLA 541
           TAS D+T + W  D      + AG L                   D+ CV   P   ++ 
Sbjct: 622 TASHDQTARLWSCDHIYSLRIFAGHL------------------SDVDCVTFHPNGCYVF 663

Query: 542 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDC 601
               D T +++ + + +      GH  PV+S+ +S D + + + S D  I +W +  G  
Sbjct: 664 TGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKR 723

Query: 602 HKSLFAH-QDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
            K +  H ++++ ++ F  E     S   D +V+ WD
Sbjct: 724 LKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWD 760

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ +  L     G  L SGS D  
Sbjct: 653 VTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGL 712

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDM 187
           I +WD+ +   L ++R H ++A+  I + +    +IS   D  +++WDM
Sbjct: 713 INVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 55/142 (38%), Gaps = 33/142 (23%)

Query: 570 VLSMDISHDSKLIITSSADKNIKIWGLDFG------------------------------ 599
           +LS+D S D +L      D  IKIW LD                                
Sbjct: 491 MLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQ 550

Query: 600 ---DCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWA 656
              + +  L  H  ++ +  F P++    S S+D TV+ W  ++   +    GH   VW 
Sbjct: 551 EHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWD 610

Query: 657 LAVSSDGQAVVSVSHDRSIRVW 678
           +A S  G    + SHD++ R+W
Sbjct: 611 VAFSPMGHYFATASHDQTARLW 632

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 64/145 (44%), Gaps = 9/145 (6%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           +L  G  D T+++W M TQ+ L+ +  H+  +  + F   G    + S D T  LW    
Sbjct: 577 LLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSC-- 634

Query: 149 ETGLCKLRSHKDAITGIWC----ENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECW 204
              +  LR     ++ + C     N  ++ + S D   ++WD+   + V   + HT    
Sbjct: 635 -DHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVV 693

Query: 205 SLAVKDNM--VITANAESEIKLWEL 227
           SL V  +   + + + +  I +W++
Sbjct: 694 SLGVSPDGRWLASGSEDGLINVWDI 718

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/230 (19%), Positives = 80/230 (34%), Gaps = 36/230 (15%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   LE  K  E +    L  +R  LP   + T      E   L + ++  + A G
Sbjct: 447 PKNALNLKLEIQKVKETRECVDLSNLRSELPSVCMYTFHNTNREMLSLDFSDDCRLAAAG 506

Query: 94  YADGTIKIWDMQTQTVLIV-----------------FHS----------------HSSAI 120
           + D  IKIW +   ++  +                  HS                HS A+
Sbjct: 507 FQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQEHVNTNTKLVGHSGAV 566

Query: 121 TILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKD 179
               F      LISGS D T+ LW +  ++ L   + H   +  + +     +  + S D
Sbjct: 567 YSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHD 626

Query: 180 GLIKLWDMKVHQCVETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
              +LW       +     H    +C +       V T +++   ++W++
Sbjct: 627 QTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDV 676

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 117/276 (42%), Gaps = 31/276 (11%)

Query: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493
           P GA +  G+  G +++    S  ++ +++ AH   I  +  +SD + L T  AD  VK 
Sbjct: 192 PDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 494 WDFKVEQELVAGTLD-----------KFVPKMKLIHDTTLDLGEDLW------------- 529
           W+ + +    A  +            KF P  + +   + D+   LW             
Sbjct: 252 WNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEG 311

Query: 530 ------CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
                 C+    +   L  + LD+   V+ + + +  + L GH  P+  +  S +   + 
Sbjct: 312 HAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVA 371

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF-SCSKDGTVKYWDGNSFD 642
           T S D  +++W +   +   S+ AH   +  V F  E+ NF  S S D T+  +   S+ 
Sbjct: 372 TGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWI 431

Query: 643 CIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
            +  L GH  ++ ++ +S  G  + S   DRS+++W
Sbjct: 432 KLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIW 467

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 127/290 (43%), Gaps = 40/290 (13%)

Query: 319 LLHP--FQLVRSLF-----KLKASSWTVCTPSKLELVITTANNTIEYYSIPYKKKEPLQP 371
           +LHP   ++VRSL      K+   +W+  + S+L L    A+N ++ ++   +       
Sbjct: 208 ILHPQSLEVVRSLDGAHDDKIGGVAWS--SDSQL-LATGGADNLVKIWNPQAQSHSEASR 264

Query: 372 TAIKLHSIESPGHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYA--- 427
             ++       GH   +        D+ +A+AS +   ++W+++ +T ++ L  G+A   
Sbjct: 265 VVLR-------GHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQ-LQEGHAKEV 316

Query: 428 LCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASA 487
            C  F   G+L+          ++D+ +   L  + E H   I+ +  + +G  + T S 
Sbjct: 317 YCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLM-VLEGHAKPIYGVSWSPNGHHVATGSG 375

Query: 488 DKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPED-RFLAVSLLD 546
           D TV+ WD +   +          P   L H++ +        V    E+  FL  S  D
Sbjct: 376 DGTVQVWDIRKANK----------PSSILAHNSIVS------EVNFEKENGNFLVSSSYD 419

Query: 547 NTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596
            T+ VF   S     SL GH   +LS+DIS     + +S  D+++KIW L
Sbjct: 420 RTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 23/171 (13%)

Query: 76  AEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISG 135
           A  + +++H     +A    D T ++WD++ +T L +   H+  +  L F   G+ L S 
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 136 SRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVE 194
             D+   +WD+     L  L  H   I G+ W  N   + + S DG +++WD++      
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 195 THMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEK 245
           + +AH           N +++          E++ E+ NG+ L+   SY++
Sbjct: 392 SILAH-----------NSIVS----------EVNFEKENGNFLVSS-SYDR 420

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 70/168 (41%), Gaps = 5/168 (2%)

Query: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYG-HKLPVLSMDI 575
           +H + +     +  V  SP+   LA    +  VK+    S++   SL G H   +  +  
Sbjct: 174 LHGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAW 233

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKS----LFAHQDSIMNVKFLPESHNFFSCSKDG 631
           S DS+L+ T  AD  +KIW        ++    L  H+  +  VKF P      S S D 
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDM 293

Query: 632 TVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           T + WD      +Q   GH  EV+ L    DG  + S   D    VW+
Sbjct: 294 TWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 55/121 (45%), Gaps = 15/121 (12%)

Query: 47  CWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATY-LQYHEETFILAVGYADGTIKIWDMQ 105
            W+++TG  L  +             E  A+  Y + +      +A G  DGT+++WD++
Sbjct: 339 VWDMRTGRSLMVL-------------EGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

Query: 106 TQTVLIVFHSHSSAITILRFD-QTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITG 164
                    +H+S ++ + F+ + G  L+S S D TI ++   +   L  L+ H D I  
Sbjct: 386 KANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILS 445

Query: 165 I 165
           +
Sbjct: 446 V 446

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  +++   + D K L++ S DKTV+ W       LV                +    
Sbjct: 525 GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 568

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584
              +W V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 628

Query: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644
            S+DK  ++W +  GD  +    H   ++ +   P+     + S+DG +  WD  +   +
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 688

Query: 645 QKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           +++ GH +  +++L+ S +G  ++S   D S+RVW+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 95/219 (43%), Gaps = 28/219 (12%)

Query: 425 GYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVT 484
           G      F P    ++ G+    ++L+ + + T L + +  H   +W ++ +  G    T
Sbjct: 528 GTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK-GHNHPVWDVNFSPLGHYFAT 586

Query: 485 ASADKTVKFW--DFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAV 542
           AS D+T + W  D      + AG L+                  D+ CV   P   ++  
Sbjct: 587 ASHDQTARLWSCDHIYPLRIFAGHLN------------------DVDCVSFHPNGCYVFT 628

Query: 543 SLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFG 599
              D T +++ +   DS++ FL   GH  PV+ + +S D + + T S D  I IW +  G
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFL---GHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTG 685

Query: 600 DCHKSLFAH-QDSIMNVKFLPESHNFFSCSKDGTVKYWD 637
              K +  H +++I ++ +  E +   S   D +V+ WD
Sbjct: 686 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 77/181 (42%), Gaps = 21/181 (11%)

Query: 520 TTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFL------------------ 561
           T  +  +D+ C+  S + R  A    D+ +K++ LD                        
Sbjct: 459 TFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDP 518

Query: 562 ---SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL 618
              +L GH   V +   S D+K +++ S DK +++W +D      S   H   + +V F 
Sbjct: 519 TCKTLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFS 578

Query: 619 PESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           P  H F + S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W
Sbjct: 579 PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMW 638

Query: 679 E 679
           +
Sbjct: 639 D 639

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H + +  + F   G  + +GS D T  +WD+   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 643

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGEC---WS 205
             +     H   +  I    D  WL + S+DG+I +WD+   + ++    H        S
Sbjct: 644 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 206 LAVKDNMVITANAESEIKLWEL 227
            + + N++I+  A+  +++W+L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ +  +     G  L +GS D  
Sbjct: 617 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 676

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+AI  + + +  + LIS   D  +++WD+K
Sbjct: 677 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 69/150 (46%), Gaps = 7/150 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH  D+       +   + T +S+   ++W++ T   +R L  G+    +C    P G  
Sbjct: 609 GHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR-LFLGHTAPVICIAVSPDGRW 667

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV 498
           +  G+  G + ++D+ +   L+ +      AI+SL  + +G  L++  AD +V+ WD K 
Sbjct: 668 LSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK- 726

Query: 499 EQELVAGTLDKFVPKMKLIHDTTLDLGEDL 528
            +     + +   P +  + D T  + +D+
Sbjct: 727 -KATTEPSAEPEEPFIGYLGDVTASINQDI 755

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/218 (19%), Positives = 76/218 (34%), Gaps = 24/218 (11%)

Query: 34  PGQVITGALEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVG 93
           P   +   LE  K  E +    L  ++  LP   + T      + + L + ++  I A G
Sbjct: 423 PKTALDLKLEIQKVKESRDAIKLDNLQLALPSVCMYTFQNTNKDMSCLDFSDDCRIAAAG 482

Query: 94  YADGTIKIWDMQTQTVLI---------------------VFHSHSSAITILRFDQTGTRL 132
           + D  IKIW +   ++                           HS  +    F      L
Sbjct: 483 FQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTLVGHSGTVYATSFSPDNKYL 542

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQ 191
           +SGS D T+ LW +   T L   + H   +  + +     +  + S D   +LW      
Sbjct: 543 LSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIY 602

Query: 192 CVETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
            +     H    +C S       V T +++   ++W++
Sbjct: 603 PLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 640

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+ G  DG I IWD+ T   L     H  +AI  L + + G  LISG  D ++ +WDL  
Sbjct: 668 LSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKK 727

Query: 149 ET 150
            T
Sbjct: 728 AT 729

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 128/290 (44%), Gaps = 26/290 (8%)

Query: 394 SSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGY--ALCCKFLPGGALVILGTRAGQLQL 450
           + D   LA+AS +G +K+W+   +TC+  L  G+  ++ C    G  L+  G+    +++
Sbjct: 245 AGDKPRLASASKDGTIKIWDASRRTCLYTLS-GHTNSVSCVKWGGQGLLYTGSHDKTIRV 303

Query: 451 FDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKF 510
           +D+ +     NI ++H   +  L L          S D  ++   F        G   K 
Sbjct: 304 WDIKAGGKCINILKSHAHWVNHLSL----------STDYAIRVGPF--------GPDGKA 345

Query: 511 VPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF--LDSMKFFLSLYGHKL 568
            P  +   D      E +  V+ S +   L V+  D+     +  L S K    + GH+ 
Sbjct: 346 SPSPQEARDIAKKNYEKV--VRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQK 403

Query: 569 PVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCS 628
            V  +  S D + I+++S D +IK+W    G    +   H  S+  V +  +     SCS
Sbjct: 404 LVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCS 463

Query: 629 KDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           KD T+K WD  +      L GHQ EV+ +  S DGQ V S   D+ +R+W
Sbjct: 464 KDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 131/327 (40%), Gaps = 43/327 (13%)

Query: 390 AADISSDDKLLATASNGNLKVWNIKTKTCIRNLD--CGYALCCKFLPGGALVILGTRAGQ 447
           A D SS  +++  A +   ++W+  T+T +  L     + LC  + P G L+  G+    
Sbjct: 152 APDTSS--RMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNT 209

Query: 448 LQLFDLASSTMLENIEEAHTAAIWSLD-------LTSDGKRLVTASADKTVKFWDFKVEQ 500
           ++L++  +     +  + H+  I SL           D  RL +AS D T+K WD     
Sbjct: 210 IRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRT 269

Query: 501 ELVAGTLDKFVPKMKLI------------HDTTL---DLGEDLWCVKISPEDRFLAVSLL 545
            L   TL      +  +            HD T+   D+     C+ I          L 
Sbjct: 270 CLY--TLSGHTNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLS 327

Query: 546 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDS------------KLIITSSADKNIKI 593
            +T   + +    F         P  + DI+  +            +L++T+S D  + +
Sbjct: 328 LSTD--YAIRVGPFGPDGKASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFL 385

Query: 594 WG-LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652
           W  L        +  HQ  + +V F P+     S S D ++K WDG     I    GH  
Sbjct: 386 WNPLKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVA 445

Query: 653 EVWALAVSSDGQAVVSVSHDRSIRVWE 679
            V+ +A SSD + +VS S D +++VW+
Sbjct: 446 SVYQVAWSSDCRLLVSCSKDTTLKVWD 472

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 77/168 (45%), Gaps = 18/168 (10%)

Query: 525 GEDLWCVKISPE-DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
           G  + C   +P+    +     DNT +++   +      L GH   VL +  S D +LI 
Sbjct: 143 GSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIA 202

Query: 584 TSSADKNIKIW----GLDFGDCHKSLFAHQDSIMNVKFLP-------ESHNFFSCSKDGT 632
           T S D  I++W    G  +GD  K    H   I ++ + P       +     S SKDGT
Sbjct: 203 TGSMDNTIRLWESKAGKPWGDAMK---GHSKWITSLTWEPLHLVAAGDKPRLASASKDGT 259

Query: 633 VKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVV-SVSHDRSIRVWE 679
           +K WD +   C+  L GH   V    V   GQ ++ + SHD++IRVW+
Sbjct: 260 IKIWDASRRTCLYTLSGHTNSV--SCVKWGGQGLLYTGSHDKTIRVWD 305

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 94/423 (22%), Positives = 158/423 (37%), Gaps = 86/423 (20%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           +  G  D T +IWD  TQT L V   HS+ +  + +   G  + +GS D TI LW+  A 
Sbjct: 159 MVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAG 218

Query: 150 TGLC-KLRSHKDAITGIWCE--------NDDWLISVSKDGLIKLWDMKVHQCVETHMAHT 200
                 ++ H   IT +  E        +   L S SKDG IK+WD     C+ T   HT
Sbjct: 219 KPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGHT 278

Query: 201 GEC----WSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSF 256
                  W       ++ T + +  I++W++   +  G  +    +  K        LS 
Sbjct: 279 NSVSCVKWG---GQGLLYTGSHDKTIRVWDI---KAGGKCI----NILKSHAHWVNHLSL 328

Query: 257 TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYA 316
           +T  D          D         S  E     KK  ++   K    EE+  +  + + 
Sbjct: 329 ST--DYAIRVGPFGPDGKAS----PSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFT 382

Query: 317 NLLLHPFQLVRSLFKL----KASSWTVCTPSKLELVITTANNTIEYYSIPYKKKEPLQPT 372
             L +P +  + L ++    K  +    +P    +V  + +N+I+ +     K       
Sbjct: 383 MFLWNPLKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGK------- 435

Query: 373 AIKLHSIESPGHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCK 431
                     GH   +     SSD +LL + S +  LKVW++KT+    ++D        
Sbjct: 436 ----FIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKL--SVD-------- 481

Query: 432 FLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTV 491
            LPG                              H   ++++D + DG+R+ +   DK V
Sbjct: 482 -LPG------------------------------HQDEVYTVDWSVDGQRVCSGGKDKMV 510

Query: 492 KFW 494
           + W
Sbjct: 511 RLW 513

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 143/378 (37%), Gaps = 66/378 (17%)

Query: 351 TANNTIEYY---SIPYKKKE-PLQPTAIK---LHSIESPGHRTDLRAADISSDDKLLATA 403
           +A + + Y    S+P K KE P Q   I      S+  PG++T         D   L   
Sbjct: 70  SAEDPVPYTFSCSVPGKNKEDPPQNVDITDNLWSSLLKPGYKT-------PEDQITLVFT 122

Query: 404 SNGNLKVWNIKTKTCIRNLDCGYALCCKFLPG-GALVILGTRAGQLQLFDLASSTMLENI 462
                KV  I   +          LC  F P   + ++ G      +++D A+ T L ++
Sbjct: 123 PRAVFKVRPITRSSAAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPL-SV 181

Query: 463 EEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTL 522
            + H+  +  +  + DG+ + T S D T++ W+ K  +       D      K I   T 
Sbjct: 182 LKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAGKPWG----DAMKGHSKWITSLTW 237

Query: 523 DLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLI 582
              E L  V    + R LA +  D T+K++         +L GH   V  +       L+
Sbjct: 238 ---EPLHLVAAGDKPR-LASASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWGGQG-LL 292

Query: 583 ITSSADKNIKIWGLDFGD-CHKSLFAHQDSIMNV-----------KFLPESHN------- 623
            T S DK I++W +  G  C   L +H   + ++            F P+          
Sbjct: 293 YTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEA 352

Query: 624 ---------------------FFSCSKDGTVKYWDG-NSFDCIQKLYGHQGEVWALAVSS 661
                                  + S D T+  W+   S   + ++ GHQ  V  +A S 
Sbjct: 353 RDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP 412

Query: 662 DGQAVVSVSHDRSIRVWE 679
           DG+ +VS S D SI++W+
Sbjct: 413 DGRYIVSASFDNSIKLWD 430

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 58/128 (45%), Gaps = 9/128 (7%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLI-VFHSHSSAITILRFDQ-------TGTRL 132
           + +  +  ++A G  D TI++W+ +           HS  IT L ++           RL
Sbjct: 192 VAWSPDGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRL 251

Query: 133 ISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKV-HQ 191
            S S+D TI +WD    T L  L  H ++++ +       L + S D  I++WD+K   +
Sbjct: 252 ASASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGGK 311

Query: 192 CVETHMAH 199
           C+    +H
Sbjct: 312 CINILKSH 319

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 99/229 (43%), Gaps = 21/229 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   LV+AS DKT+  W    + +     +  F     
Sbjct: 7   VLRGTLEGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNH 65

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D  L           + +  +   +  D T++++ + + + +    GHK  V+S+ I
Sbjct: 66  IVQDCAL-----------TADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAI 114

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK IK+W +  GDC  +L  H D +  V+  P      ++    S   
Sbjct: 115 DRKASMIISGSRDKTIKVWSIK-GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGS 173

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           D  VK W+ N F       GH   + ++  S DG  V S   D  I +W
Sbjct: 174 DKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLW 222

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 69/146 (47%), Gaps = 10/146 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++W++ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  L
Sbjct: 85  DKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDC-LATL 143

Query: 156 RSHKDAITGIWC------ENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +        E+D+  LIS   D ++K W++   Q     + H     S+  
Sbjct: 144 LGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITA 203

Query: 209 KDN--MVITANAESEIKLWELDLERP 232
             +  +V +A  + +I LW L  + P
Sbjct: 204 SPDGSLVASAGKDGDIMLWNLKQKTP 229

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 562 SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 621
           S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  +M+V    ++
Sbjct: 59  SFKGHNHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA 118

Query: 622 HNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS------SDGQAVVSVSHDRSI 675
               S S+D T+K W     DC+  L GH   V  + V+       D   ++S   D+ +
Sbjct: 119 SMIISGSRDKTIKVWSIKG-DCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMV 177

Query: 676 RVWEETEDQV 685
           + W   + Q+
Sbjct: 178 KAWNINQFQI 187

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 109/266 (40%), Gaps = 38/266 (14%)

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
           C     GA  +  +    L+L+++A+    +     H + + S+ +      +++ S DK
Sbjct: 70  CALTADGAYALSASWDKTLRLWNVATGETYQRFT-GHKSDVMSVAIDRKASMIISGSRDK 128

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWC--VKISPEDR------FLA 541
           T+K W  K +      TL                LG + W   V+++P ++       L 
Sbjct: 129 TIKVWSIKGD---CLATL----------------LGHNDWVSQVRVAPNEKQEDDNVTLI 169

Query: 542 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDC 601
            +  D  VK + ++  +      GH   + S+  S D  L+ ++  D +I +W L     
Sbjct: 170 SAGSDKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTP 229

Query: 602 HKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVW 655
             +L A QD +  + F P  +   + +  G +K +       I +L      Y    E  
Sbjct: 230 LYTLSA-QDEVFALAFSPNRYWLTAATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPH 287

Query: 656 ALAV--SSDGQAVVSVSHDRSIRVWE 679
           A+++  S+DGQ + +   D  IRVW+
Sbjct: 288 AVSLTWSADGQTLFAGYTDSIIRVWQ 313

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 78/182 (42%), Gaps = 22/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 97  ETYQRFTGHKSDVMSVAI------------DRKASMIISGSRDKTIKVWSIK-GDCLATL 143

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++        Q  +   +++ G +D  +K W++    +   F  H++ 
Sbjct: 144 L-----GHNDWVSQVRVAPNEKQEDDNVTLISAG-SDKMVKAWNINQFQIEADFVGHNNY 197

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           I  +     G+ + S  +D  I+LW+L  +T L  L +  +     +  N  WL + +  
Sbjct: 198 INSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFALAFSPNRYWLTAATAT 257

Query: 180 GL 181
           G+
Sbjct: 258 GI 259

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 55/135 (40%), Gaps = 10/135 (7%)

Query: 103 DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAI 162
           D Q    +  F  H+  +        G   +S S D T+ LW++       +   HK  +
Sbjct: 50  DQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDV 109

Query: 163 TGIWCEND-DWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MV 213
             +  +     +IS S+D  IK+W +K   C+ T + H      + V  N         +
Sbjct: 110 MSVAIDRKASMIISGSRDKTIKVWSIK-GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTL 168

Query: 214 ITANAESEIKLWELD 228
           I+A ++  +K W ++
Sbjct: 169 ISAGSDKMVKAWNIN 183

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 16/124 (12%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNL---DCGYALCCKFLPGGAL 438
           GH   + +   S D  L+A+A  +G++ +WN+K KT +  L   D  +AL   F P    
Sbjct: 193 GHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFALA--FSPNRYW 250

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTA--------AIWSLDLTSDGKRLVTASADKT 490
           +   T  G ++++ L    +++ ++   T         A+ SL  ++DG+ L     D  
Sbjct: 251 LTAATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAV-SLTWSADGQTLFAGYTDSI 308

Query: 491 VKFW 494
           ++ W
Sbjct: 309 IRVW 312

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 110/262 (41%), Gaps = 36/262 (13%)

Query: 438 LVILGTRAGQLQLFDLASSTMLENIEEA-------------------HTAAIWSLDLTSD 478
           L   G +  Q+++F L  S++   + E+                   H+  ++S   + D
Sbjct: 510 LAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGHSGTVYSTSFSPD 569

Query: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538
            + LV+ S DKTV+ W       LV+                       +W V+ SP   
Sbjct: 570 NRYLVSGSEDKTVRLWSMDTHTSLVS----------------YKGHNHPVWDVEFSPLGH 613

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
           + A +  D+T +++  D +       GH   V  +    +   + T S+DK  ++W +  
Sbjct: 614 YFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITT 673

Query: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGH-QGEVWAL 657
           GD  +        +M+    P+     + S+DG +  WD  +   ++++ GH +  +++L
Sbjct: 674 GDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSL 733

Query: 658 AVSSDGQAVVSVSHDRSIRVWE 679
           + + +G  ++S   D S+RVW+
Sbjct: 734 SYNKEGNVLISGGADHSVRVWD 755

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 80/188 (42%), Gaps = 24/188 (12%)

Query: 514 MKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------- 559
           M   H+T      D+  ++ S + R  A    D+ +K+F LD                  
Sbjct: 489 MYTFHNT----DRDMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKL 544

Query: 560 ------FLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 613
                   +L GH   V S   S D++ +++ S DK +++W +D      S   H   + 
Sbjct: 545 LNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVW 604

Query: 614 NVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDR 673
           +V+F P  H F + S D T + W  +    ++   GH  +V  ++   +G  + + S D+
Sbjct: 605 DVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDK 664

Query: 674 SIRVWEET 681
           + R+W+ T
Sbjct: 665 TCRMWDIT 672

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
            A    D T ++W       L +F  H + +  + F   G  L +GS D T  +WD+   
Sbjct: 615 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTG 674

Query: 150 TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMAHTGEC-WSLA 207
             +         +       D  WL + S+DG+I +WD+   + ++    H     +SL+
Sbjct: 675 DSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLS 734

Query: 208 V--KDNMVITANAESEIKLWEL 227
              + N++I+  A+  +++W+L
Sbjct: 735 YNKEGNVLISGGADHSVRVWDL 756

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     L  G +D T ++WD+ T   + +F   ++ +        G  L +GS D  
Sbjct: 648 VSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGV 707

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I +WD+     L ++R H K+AI  + + +  + LIS   D  +++WD+K
Sbjct: 708 INVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 60/134 (44%), Gaps = 8/134 (5%)

Query: 399 LLATASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGALVILGTRAGQLQLFDLAS 455
           L   +S+   ++W+I T   +R L  G     +     P G  +  G+  G + ++D+ +
Sbjct: 657 LFTGSSDKTCRMWDITTGDSVR-LFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGT 715

Query: 456 STMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDF-KVEQELVAGTLDKFVPKM 514
              L+ +      AI+SL    +G  L++  AD +V+ WD  K   E  A   + FV   
Sbjct: 716 GKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLKKATTESGAEPEEPFV--- 772

Query: 515 KLIHDTTLDLGEDL 528
             + D T  + +D+
Sbjct: 773 GYLGDVTTSINQDI 786

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDLVA 148
           L+ G  DG I +WD+ T   L     H  +AI  L +++ G  LISG  D ++ +WDL  
Sbjct: 699 LSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLKK 758

Query: 149 ET 150
            T
Sbjct: 759 AT 760

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/175 (18%), Positives = 65/175 (37%), Gaps = 29/175 (16%)

Query: 79  TYLQYHEETFILAVGYADGTIKIWDM-----------------------QTQTVLIVFHS 115
           T L++ ++  + A G+ D  IKI+ +                       ++ + LI    
Sbjct: 500 TSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLI---G 556

Query: 116 HSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLI 174
           HS  +    F      L+SGS D T+ LW +   T L   + H   +  + +     +  
Sbjct: 557 HSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFA 616

Query: 175 SVSKDGLIKLWDMKVHQCVETHMAHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
           + S D   +LW       +     H    +C S       + T +++   ++W++
Sbjct: 617 TASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 98/421 (23%), Positives = 171/421 (40%), Gaps = 82/421 (19%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           +  G  D T +IWD  TQT ++    H++ +  + +   G  + +GS D TI LW+    
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNG 218

Query: 150 TGLCK-LRSHKDAITGIWCE--------NDDWLISVSKDGLIKLWDMKVHQCVETHMAHT 200
               + +R H+  IT +  E            L + SKDG IK+WD     C+ T   H 
Sbjct: 219 KPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCLYTLSGHV 278

Query: 201 G--ECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTT 258
               C     K N++ + + +  +++W+++L     ++L       K        LS + 
Sbjct: 279 NSVSCVKWGGK-NLLYSGSHDKTVRVWDMNLGGKCINIL-------KSHAHWVNHLSLS- 329

Query: 259 VADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYANL 318
               T +   +       I     E   AKALK  EK  K  G SDEE+  +  + +   
Sbjct: 330 ----TDYALRVGPFDHTGIMPATPEEARAKALKNYEKVAKRNG-SDEELMVTASDDFTMF 384

Query: 319 LLHPFQLVRSLFKL----KASSWTVCTPSKLELVITTANNTIEYYSIPYKKKEPLQPTAI 374
           L +P +  + + ++    K  +    +P    +V  + +N+I+ +      ++    T  
Sbjct: 385 LWNPSKSTKPISRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----SRDGKFITTF 440

Query: 375 KLHSIESPGHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFL 433
           +       GH   +     SSD +LLA+ S + +LKVW+I+TK    ++D         L
Sbjct: 441 R-------GHVASVYQVAWSSDCRLLASCSKDTSLKVWDIRTKKL--SVD---------L 482

Query: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493
           PG                              H   ++++D + DGKR+ +   DK V+ 
Sbjct: 483 PG------------------------------HLDEVYTVDWSVDGKRVCSGGKDKMVRL 512

Query: 494 W 494
           W
Sbjct: 513 W 513

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 80/168 (47%), Gaps = 18/168 (10%)

Query: 525 GEDLWCVKISPE-DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
           G  + C   +P     +     DNT +++  D+    ++L GH   VL +  S D +LI 
Sbjct: 143 GSTILCSSFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIA 202

Query: 584 TSSADKNIKIW----GLDFGDCHKSLFAHQDSIMNVKFLP-------ESHNFFSCSKDGT 632
           T S D  I++W    G  FG+   ++  HQ  I ++ + P       E     + SKDGT
Sbjct: 203 TGSMDNTIRLWEGKNGKPFGE---AMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGT 259

Query: 633 VKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVV-SVSHDRSIRVWE 679
           +K WD     C+  L GH   V    V   G+ ++ S SHD+++RVW+
Sbjct: 260 IKVWDTGRRVCLYTLSGHVNSV--SCVKWGGKNLLYSGSHDKTVRVWD 305

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 145/366 (39%), Gaps = 43/366 (11%)

Query: 353 NNTIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADIS--SDDKLLATASNGNLKV 410
           N T +  ++ Y  +   +   I   S    GH + +  +  +  +  +++  A +   ++
Sbjct: 111 NTTEDIITLIYTPRAIFKVRPITRSSAAIAGHGSTILCSSFAPHTSSRMVTGAGDNTARI 170

Query: 411 WNIKTKTCIRNLD--CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTA 468
           W+  T+T +  L     + LC  + P G L+  G+    ++L++  +          H  
Sbjct: 171 WDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNGKPFGEAMRGHQK 230

Query: 469 AIWSLD-----LTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLI---- 517
            I SL      L   G+R  L T+S D T+K WD    + +   TL   V  +  +    
Sbjct: 231 WITSLSWEPLHLVKAGERPKLATSSKDGTIKVWD--TGRRVCLYTLSGHVNSVSCVKWGG 288

Query: 518 --------HDTTL---DLGEDLWCVKISPE------------DRFLAVSLLDNTVKVFFL 554
                   HD T+   D+     C+ I               D  L V   D+T  +   
Sbjct: 289 KNLLYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPAT 348

Query: 555 DSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKS-LFAHQDSIM 613
                  +L  ++   ++     D +L++T+S D  + +W         S +  HQ  + 
Sbjct: 349 PEEARAKALKNYEK--VAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVN 406

Query: 614 NVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDR 673
           +V F P+     S S D ++K WD      I    GH   V+ +A SSD + + S S D 
Sbjct: 407 HVAFSPDGRYIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDT 466

Query: 674 SIRVWE 679
           S++VW+
Sbjct: 467 SLKVWD 472

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 119/283 (42%), Gaps = 21/283 (7%)

Query: 398 KLLATASNGNLKVWNIKTKTCIRNLDCGY--ALCCKFLPGGALVILGTRAGQLQLFDLAS 455
           KL  ++ +G +KVW+   + C+  L  G+  ++ C    G  L+  G+    ++++D+  
Sbjct: 250 KLATSSKDGTIKVWDTGRRVCLYTLS-GHVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNL 308

Query: 456 STMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
                NI ++H   +  L L          S D  ++   F     + A   +     +K
Sbjct: 309 GGKCINILKSHAHWVNHLSL----------STDYALRVGPFDHTGIMPATPEEARAKALK 358

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
                    G D   +  + +D  +    L N  K     S K    + GH+  V  +  
Sbjct: 359 NYEKVAKRNGSDEELMVTASDDFTM---FLWNPSK-----STKPISRMTGHQKLVNHVAF 410

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKY 635
           S D + I+++S D +IK+W    G    +   H  S+  V +  +     SCSKD ++K 
Sbjct: 411 SPDGRYIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSLKV 470

Query: 636 WDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           WD  +      L GH  EV+ +  S DG+ V S   D+ +R+W
Sbjct: 471 WDIRTKKLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 116/300 (38%), Gaps = 54/300 (18%)

Query: 428 LCCKFLP-GGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTAS 486
           LC  F P   + ++ G      +++D  + T +  +   HT  +  +  + DG+ + T S
Sbjct: 147 LCSSFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTLS-GHTNWVLCVAWSPDGELIATGS 205

Query: 487 ADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLG-EDLWCVKISPEDRFLAVSLL 545
            D T++ W+ K  +         F   M+        L  E L  VK   E   LA S  
Sbjct: 206 MDNTIRLWEGKNGKP--------FGEAMRGHQKWITSLSWEPLHLVKAG-ERPKLATSSK 256

Query: 546 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD-CHKS 604
           D T+KV+         +L GH   V  +       L+ + S DK +++W ++ G  C   
Sbjct: 257 DGTIKVWDTGRRVCLYTLSGHVNSVSCVKWG-GKNLLYSGSHDKTVRVWDMNLGGKCINI 315

Query: 605 LFAHQDSIMN--------VKFLPESHN-------------------------------FF 625
           L +H   + +        ++  P  H                                  
Sbjct: 316 LKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKALKNYEKVAKRNGSDEELMV 375

Query: 626 SCSKDGTVKYWD-GNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQ 684
           + S D T+  W+   S   I ++ GHQ  V  +A S DG+ +VS S D SI++W+  + +
Sbjct: 376 TASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDSRDGK 435

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/336 (21%), Positives = 133/336 (39%), Gaps = 35/336 (10%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLI-VFHSHSSAITILRFD-----QTGTR--LISGSRDAT 140
           ++A G  D TI++W+ +           H   IT L ++     + G R  L + S+D T
Sbjct: 200 LIATGSMDNTIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGT 259

Query: 141 IILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKV-HQCVETHMAH 199
           I +WD      L  L  H ++++ +     + L S S D  +++WDM +  +C+    +H
Sbjct: 260 IKVWDTGRRVCLYTLSGHVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNLGGKCINILKSH 319

Query: 200 TGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCT--ELSFT 257
                 L++  +  +         +     E      L    +YEK +K+  +  EL  T
Sbjct: 320 AHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKAL---KNYEKVAKRNGSDEELMVT 376

Query: 258 TVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKEKGMSDEEIQESFRNSYAN 317
              D T F ++  S  T  I R+    ++   +      F   G     +  SF NS   
Sbjct: 377 ASDDFTMFLWN-PSKSTKPISRMTGHQKLVNHVA-----FSPDGR--YIVSASFDNSIKL 428

Query: 318 LLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNT-IEYYSIPYKKKEPLQPTAIKL 376
                 + + +     AS + V   S   L+ + + +T ++ + I  KK           
Sbjct: 429 WDSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSLKVWDIRTKKL---------- 478

Query: 377 HSIESPGHRTDLRAADISSDDKLLATASNGNL-KVW 411
            S++ PGH  ++   D S D K + +     + ++W
Sbjct: 479 -SVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 604 SLFAHQDSIMNVKFLPE-SHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSD 662
           ++  H  +I+   F P  S    + + D T + WD ++   +  L GH   V  +A S D
Sbjct: 138 AIAGHGSTILCSSFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPD 197

Query: 663 GQAVVSVSHDRSIRVWEETEDQVF 686
           G+ + + S D +IR+WE    + F
Sbjct: 198 GELIATGSMDNTIRLWEGKNGKPF 221

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 67/165 (40%), Gaps = 4/165 (2%)

Query: 65  PGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIV-FHSHSSAITIL 123
           P     KA K  E    +   +  ++     D T+ +W+    T  I     H   +  +
Sbjct: 349 PEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHV 408

Query: 124 RFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLI 182
            F   G  ++S S D +I LWD      +   R H  ++  + W  +   L S SKD  +
Sbjct: 409 AFSPDGRYIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSL 468

Query: 183 KLWDMKVHQCVETHMAHTGECWSL--AVKDNMVITANAESEIKLW 225
           K+WD++  +       H  E +++  +V    V +   +  ++LW
Sbjct: 469 KVWDIRTKKLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 7/121 (5%)

Query: 395 SDDKLLATASNG-NLKVWNIKTKTCIRNLDCGYALCCK---FLPGGALVILGTRAGQLQL 450
           SD++L+ TAS+   + +WN    T   +   G+        F P G  ++  +    ++L
Sbjct: 369 SDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKL 428

Query: 451 FDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELV--AGTLD 508
           +D      +      H A+++ +  +SD + L + S D ++K WD + ++  V   G LD
Sbjct: 429 WDSRDGKFITTFR-GHVASVYQVAWSSDCRLLASCSKDTSLKVWDIRTKKLSVDLPGHLD 487

Query: 509 K 509
           +
Sbjct: 488 E 488

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 527 DLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKF-------------FLSLYGHKLPVLSM 573
           ++ CV+ S + R  A    D+T+KV++LD                   +L GH  PV S+
Sbjct: 500 NMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSV 559

Query: 574 DISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTV 633
             S D++ ++++S DK +++W LD   C      H   +  VKF P  H F + S D T 
Sbjct: 560 AFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTA 619

Query: 634 KYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE-ETEDQV 685
           + W  +    ++   GH  +V       +G  V + S D++ R+W+ +T D V
Sbjct: 620 RLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSV 672

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 99/220 (45%), Gaps = 25/220 (11%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTL-- 522
            H+  ++S+  + D + L++AS DKTV+ W           +LD F         T L  
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLW-----------SLDTF---------TCLVC 590

Query: 523 --DLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSK 580
                  +W VK SP   +   +  D T +++  D +       GH   V       +  
Sbjct: 591 YKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGC 650

Query: 581 LIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNS 640
            + T S+DK  ++W +  GD  +    H   +  ++  P+     + S+DGT+  WD  +
Sbjct: 651 YVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 641 FDCIQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
              I+++ GH +  ++++  + +G  +V+   D+S+RVW+
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWD 750

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 59/108 (54%), Gaps = 2/108 (1%)

Query: 83  YHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATII 142
           +H     +  G +D T ++WD+QT   + +F  H+S +T L     G  L +GS D TII
Sbjct: 645 FHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTII 704

Query: 143 LWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           +WD+     + +++ H K+ I  I + +  + L++   D  +++WD+K
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 65/152 (42%), Gaps = 4/152 (2%)

Query: 80  YLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDA 139
           Y+++            D T ++W       L +F  H + +    F   G  + +GS D 
Sbjct: 600 YVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDK 659

Query: 140 TIILWDLVAETGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDMKVHQCVETHMA 198
           T  +WD+     +     H   +T +    D  WL + S+DG I +WD+   + ++    
Sbjct: 660 TCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKG 719

Query: 199 H-TGECWSLAV--KDNMVITANAESEIKLWEL 227
           H     +S+    + N ++T  A+  +++W++
Sbjct: 720 HGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 97/221 (43%), Gaps = 27/221 (12%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCI-----RNLDCGYALCCKFLPGG 436
           GH   + +   S D++ L +AS +  +++W++ T TC+      N    Y    KF P G
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWY---VKFSPLG 607

Query: 437 ALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDF 496
              I  +     +L+       L  I   H   +       +G  + T S+DKT + WD 
Sbjct: 608 HYFITASHDQTARLWSCDHIYPLR-IFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDI 666

Query: 497 KVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDS 556
           +    +          ++ L H + +        +++SP+ R+L     D T+ V+ + +
Sbjct: 667 QTGDSV----------RLFLGHTSPVT------ALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 557 MKFFLSLYGH-KLPVLSMDISHDSKLIITSSADKNIKIWGL 596
            K    + GH K P+ S+  + +   ++T  AD+++++W +
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 77/202 (38%), Gaps = 16/202 (7%)

Query: 42  LEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKI 101
           +E  K  E +    LK ++   P   + T        T +++ ++  + A G+ D TIK+
Sbjct: 465 MEIQKVRESRDSIQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKV 524

Query: 102 WDMQTQTVLIVFHS-------------HSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           W +    +  +  S             HS  +  + F      L+S S D T+ LW L  
Sbjct: 525 WYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDT 584

Query: 149 ETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG--ECWS 205
            T L   + H   +  + +     + I+ S D   +LW       +     H    +C +
Sbjct: 585 FTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCST 644

Query: 206 LAVKDNMVITANAESEIKLWEL 227
                  V T +++   ++W++
Sbjct: 645 FHPNGCYVFTGSSDKTCRMWDI 666

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 5/119 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYALCCKFL---PGGAL 438
           GH  D+  +    +   + T +S+   ++W+I+T   +R L  G+      L   P G  
Sbjct: 635 GHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVR-LFLGHTSPVTALEVSPDGRW 693

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
           +  G+  G + ++D+ +   ++ ++      I+S+    +G  LVT  AD++V+ WD K
Sbjct: 694 LTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 99/230 (43%), Gaps = 21/230 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   LV+AS DKT+  W    + +     +  F     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D TL           +P+  +   +  D T++++ + + + +    GHK  V+S+ I
Sbjct: 67  IVQDVTL-----------TPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAI 115

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK+IK+W +  G C  +L  H D +  V+  P      ++    S   
Sbjct: 116 DRKASMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGN 174

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D  VK W+ N F       GH   V  +  S DG  + S      I +W 
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWN 224

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 10/146 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++WD+ T      F  H   +  +  D+  + +ISGSRD +I +W +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 156 RSHKDAITGIWC-----ENDD--WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +       ENDD   +IS   D ++K W++   Q     + H     ++  
Sbjct: 145 LGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNANVNTITA 204

Query: 209 KDNMVITANAE--SEIKLWELDLERP 232
             +  + A+A+   EI LW L  + P
Sbjct: 205 SPDGTLIASADKSGEIMLWNLHNKTP 230

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 65/140 (46%), Gaps = 10/140 (7%)

Query: 555 DSMKFFL---SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 611
           D  KF +   S  GH   V  + ++ D    +++S DK +++W +  G+ ++    H+  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGD 109

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSS------DGQA 665
           +M+V    ++    S S+D ++K W      C+  L GH   V  + V+       D   
Sbjct: 110 VMSVAIDRKASMIISGSRDKSIKVWTIKG-QCLATLLGHNDWVSQVRVAPTEKENDDTVT 168

Query: 666 VVSVSHDRSIRVWEETEDQV 685
           V+S  +D+ ++ W   + Q+
Sbjct: 169 VISAGNDKMVKAWNLNQFQI 188

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 105/256 (41%), Gaps = 43/256 (16%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           + H+  +  + LT DG   ++AS DKT++ WD    +                       
Sbjct: 62  KGHSHIVQDVTLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASM 121

Query: 502 LVAGTLDKFVPKMKLIHDTTLD--LGEDLWC--VKISP-----EDRFLAVSLL-DNTVKV 551
           +++G+ DK + K+  I    L   LG + W   V+++P     +D    +S   D  VK 
Sbjct: 122 IISGSRDKSI-KVWTIKGQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKA 180

Query: 552 FFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 611
           + L+  +      GH   V ++  S D  LI ++     I +W L       +L A QD 
Sbjct: 181 WNLNQFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWNLHNKTPMYTLNA-QDE 239

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWA--LAVSSDG 663
           +  V F P  +   + +  G +K +  +    I  L      Y    +  A  LA S+DG
Sbjct: 240 VFAVAFSPNRYWLAAATASG-IKIFSLDPEALIDDLRPEFVGYNKAADPHAISLAWSADG 298

Query: 664 QAVVSVSHDRSIRVWE 679
           Q + +   D  IRVW+
Sbjct: 299 QTLFAGYTDNVIRVWQ 314

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   +  +    D  + +S S D  ++LW
Sbjct: 33  LVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLRLW 92

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWEL 227
           D+   +  +  + H G+  S+A+  K +M+I+ + +  IK+W +
Sbjct: 93  DVATGETYQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVWTI 136

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 10/125 (8%)

Query: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCEND-D 171
           F  HS  +  +     G   +S S D T+ LWD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDVTLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKAS 120

Query: 172 WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV----KDN----MVITANAESEIK 223
            +IS S+D  IK+W +K  QC+ T + H      + V    K+N     VI+A  +  +K
Sbjct: 121 MIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVK 179

Query: 224 LWELD 228
            W L+
Sbjct: 180 AWNLN 184

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 76/182 (41%), Gaps = 22/182 (12%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   + DV  V                    +I+G+ ++ +K W IK G+ L T+
Sbjct: 98  ETYQRFVGHKGDVMSVAI------------DRKASMIISGSRDKSIKVWTIK-GQCLATL 144

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++     T  +  +   +++ G  D  +K W++    +   F  H++ 
Sbjct: 145 L-----GHNDWVSQVRVAPTEKENDDTVTVISAGN-DKMVKAWNLNQFQIEADFVGHNAN 198

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           +  +     GT + S  +   I+LW+L  +T +  L +  +     +  N  WL + +  
Sbjct: 199 VNTITASPDGTLIASADKSGEIMLWNLHNKTPMYTLNAQDEVFAVAFSPNRYWLAAATAS 258

Query: 180 GL 181
           G+
Sbjct: 259 GI 260

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++AS DKT+  W    + +     +  F     
Sbjct: 6   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSH 64

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D  L           + +  +   +  D T++++ + + + F    GHK  V+S+ I
Sbjct: 65  IVQDCAL-----------TADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAI 113

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK IK+W +  G+C  ++  H D +  V+  P      ++    S   
Sbjct: 114 DRKASMIISGSRDKTIKVWSIK-GECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGS 172

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D  VK W+ N F       GH   + A+  S DG  + S   D  I +W+
Sbjct: 173 DKVVKSWNVNQFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWD 222

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D TI++WD+ T      F  H   +  +  D+  + +ISGSRD TI +W +  E  L  +
Sbjct: 84  DKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKASMIISGSRDKTIKVWSIKGEC-LATM 142

Query: 156 RSHKDAITGIWCENDD-------WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +    +D        +IS   D ++K W++   Q     + H     ++  
Sbjct: 143 LGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVNQFQIDADFIGHNNYINAIVA 202

Query: 209 KDN--MVITANAESEIKLWELDLER 231
             +  ++ +A  + EI +W+L  +R
Sbjct: 203 SPDGSLIASAGKDGEIMMWDLAQKR 227

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 105/256 (41%), Gaps = 43/256 (16%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           + H+  +    LT+DG   ++AS DKT++ WD    +                       
Sbjct: 60  KGHSHIVQDCALTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKASM 119

Query: 502 LVAGTLDKFVPKMKLIHDTTLD--LGEDLWC--VKISPEDR------FLAVSLLDNTVKV 551
           +++G+ DK + K+  I    L   LG + W   V+++P D+       +  +  D  VK 
Sbjct: 120 IISGSRDKTI-KVWSIKGECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKS 178

Query: 552 FFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 611
           + ++  +      GH   + ++  S D  LI ++  D  I +W L       +L AH D 
Sbjct: 179 WNVNQFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWDLAQKRALYTLSAH-DE 237

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGE--VWALAVSSDG 663
           +  + F P  +   + +  G +K +       I  L      Y    E    +LA S+DG
Sbjct: 238 VFALAFSPNRYWLAAATSSG-IKIFSLEPQGIIDNLNPEFAGYTKAAEPHPLSLAWSADG 296

Query: 664 QAVVSVSHDRSIRVWE 679
           Q + +   D  IRVW+
Sbjct: 297 QTLFAGYTDNVIRVWQ 312

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 8/107 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   +       D  + +S S D  I+LW
Sbjct: 31  LLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTIRLW 90

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWELDLE 230
           D+   +  +  + H G+  S+A+  K +M+I+ + +  IK+W +  E
Sbjct: 91  DVSTGETFQRFVGHKGDVMSVAIDRKASMIISGSRDKTIKVWSIKGE 137

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 73/159 (45%), Gaps = 9/159 (5%)

Query: 37  VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95
           +I+G+ ++ +K W IK GE L TM      G  D  ++           +   +++ G +
Sbjct: 120 IISGSRDKTIKVWSIK-GECLATML-----GHNDWVSQVRVAPNDKPEDDTVTVISAG-S 172

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D  +K W++    +   F  H++ I  +     G+ + S  +D  I++WDL  +  L  L
Sbjct: 173 DKVVKSWNVNQFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWDLAQKRALYTL 232

Query: 156 RSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVE 194
            +H +     +  N  WL + +  G IK++ ++    ++
Sbjct: 233 SAHDEVFALAFSPNRYWLAAATSSG-IKIFSLEPQGIID 270

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 10/135 (7%)

Query: 103 DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAI 162
           D Q    +  F  HS  +        G   +S S D TI LWD+       +   HK  +
Sbjct: 49  DQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDV 108

Query: 163 TGIWCEND-DWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MV 213
             +  +     +IS S+D  IK+W +K  +C+ T + H      + V  N         V
Sbjct: 109 MSVAIDRKASMIISGSRDKTIKVWSIK-GECLATMLGHNDWVSQVRVAPNDKPEDDTVTV 167

Query: 214 ITANAESEIKLWELD 228
           I+A ++  +K W ++
Sbjct: 168 ISAGSDKVVKSWNVN 182

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 624 FFSCSKDGTVKYW----DGNSFDC-IQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
             S S+D T+  W    D   +   ++   GH   V   A+++DG   +S S D++IR+W
Sbjct: 31  LLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTIRLW 90

Query: 679 EETEDQVF 686
           + +  + F
Sbjct: 91  DVSTGETF 98

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 104/217 (47%), Gaps = 18/217 (8%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H+  ++S   ++  + L++AS DKTV+ W  + ++ LV+    +               
Sbjct: 572 GHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHE--------------- 616

Query: 525 GEDLWCVKISPE-DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLII 583
            + +W V+ SP  +   A +  D T +++  D +     + GH   V  +    + + I 
Sbjct: 617 -KPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIF 675

Query: 584 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDC 643
           T S+DK +++W ++ GD  +    H  ++ ++   P+     + S DG +  WD  S   
Sbjct: 676 TGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRK 735

Query: 644 IQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           ++ + GH +  + +L+ + +G  +VS   D+S+RVW+
Sbjct: 736 LKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWD 772

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 97/218 (44%), Gaps = 21/218 (9%)

Query: 472 SLDLTSDGKRLVTASADKTVKFWDF---------KVEQELVAGTLDKFVPKMKLIHDTTL 522
           SL+ +++ K   +   D  +K W           ++    ++ T   F+     ++ T+ 
Sbjct: 523 SLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTCKTFIGHSGTVYSTSF 582

Query: 523 DLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHD-SKL 581
             G           D +L  +  D TV+++ +   K  +S  GH+ PV  ++ S   + L
Sbjct: 583 SAG-----------DEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNL 631

Query: 582 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSF 641
             T+S D+  ++W  D     + +  H + +  V F       F+ S D TV+ WD N+ 
Sbjct: 632 FATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTG 691

Query: 642 DCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           D ++   GH   V +L+VS DG+ + + S D  I +W+
Sbjct: 692 DSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWD 729

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 64/144 (44%), Gaps = 4/144 (2%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
           + A    D T ++W       L V   H + +  + F   G  + +GS D T+ +WD+  
Sbjct: 631 LFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINT 690

Query: 149 ETGLCKLRSHKDAITGIWCEND-DWLISVSKDGLIKLWDMKVHQCVETHMAH---TGECW 204
              +     H   +T +    D  W+ + S DG+I +WD+   + ++    H   +    
Sbjct: 691 GDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSL 750

Query: 205 SLAVKDNMVITANAESEIKLWELD 228
           S   +  ++++  A+  +++W+L+
Sbjct: 751 SYNPEGTLLVSGGADQSVRVWDLN 774

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T+++WD+ T   + +F  H+S +T L     G  + +GS D  
Sbjct: 665 VSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGI 724

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDM 187
           I +WD+ +   L  +R H K +I  + +      L+S   D  +++WD+
Sbjct: 725 ITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYALCCKFL---PGGAL 438
           GH  D+      S+ + + T +S+  +++W+I T   +R L  G+      L   P G  
Sbjct: 657 GHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVR-LFMGHNSTVTSLSVSPDGKW 715

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDF 496
           +  G+  G + ++D+ S   L+N+     ++I SL    +G  LV+  AD++V+ WD 
Sbjct: 716 ISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 70/142 (49%), Gaps = 17/142 (11%)

Query: 465 AHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDL 524
            H   +  +   S+G+ + T S+DKTV+ WD      +          ++ + H++T+  
Sbjct: 657 GHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSV----------RLFMGHNSTVT- 705

Query: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSMDISHDSKLII 583
                 + +SP+ ++++    D  + ++ + S +   ++ GH K  + S+  + +  L++
Sbjct: 706 -----SLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLV 760

Query: 584 TSSADKNIKIWGLDFGDCHKSL 605
           +  AD+++++W L+ G    SL
Sbjct: 761 SGGADQSVRVWDLNKGTFEPSL 782

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/193 (19%), Positives = 70/193 (36%), Gaps = 22/193 (11%)

Query: 56  LKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQ---------- 105
           +  ++  LP  +I T        T L++     + A G+ D  IKIW +           
Sbjct: 499 MDNLQVSLPSVSIYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEM 558

Query: 106 ----TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDA 161
                 +    F  HS  +    F      L+S S D T+ LW +  +  L   + H+  
Sbjct: 559 PNNPISSTCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKP 618

Query: 162 ITGI----WCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTG--ECWSLAVKDNMVIT 215
           +  +     C N     + S D   +LW       +     H    +C S       + T
Sbjct: 619 VWDVEFSPSCNN--LFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFT 676

Query: 216 ANAESEIKLWELD 228
            +++  +++W+++
Sbjct: 677 GSSDKTVRMWDIN 689

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 61/144 (42%), Gaps = 34/144 (23%)

Query: 547 NTVKVFFLDSMKFFL------SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGD 600
           N    F +D+++  L      + +  +  + S++ S++ KL  +   D  IKIW LD   
Sbjct: 492 NATSSFSMDNLQVSLPSVSIYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSLD--- 548

Query: 601 CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS 660
                 +  D + N        N  S +              C +   GH G V++ + S
Sbjct: 549 --GYPLSENDEMPN--------NPISST--------------C-KTFIGHSGTVYSTSFS 583

Query: 661 SDGQAVVSVSHDRSIRVWEETEDQ 684
           +  + ++S S D+++R+W   +D+
Sbjct: 584 AGDEYLLSASEDKTVRLWSVQDDK 607

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 119/269 (44%), Gaps = 42/269 (15%)

Query: 414 KTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSL 473
            T+T   +L   Y     F P G  +  G     ++++D+A   ++  + + H   I+SL
Sbjct: 429 NTRTASSDL---YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVM-VLQGHEQDIYSL 484

Query: 474 DLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKI 533
           D    G +LV+ S D+TV+ WD +  Q  +                 TL + + +  V +
Sbjct: 485 DYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAV 527

Query: 534 SPED-RFLAVSLLDNTVKV------FFLDSMKFFLSL-YGHKLPVLSMDISHDSKLIITS 585
           S  D +++A   LD  V+V      F ++ +     L  GHK  V S+  + D   +++ 
Sbjct: 528 SLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSG 587

Query: 586 SADKNIKIWGLDFGD-------------CHKSLFAHQDSIMNVKFLPESHNFFSCSKDGT 632
           S D+++K+W L  G              C  +   H+D +++V          S SKD  
Sbjct: 588 SLDRSVKLWNLSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRG 647

Query: 633 VKYWDGNSFDCIQKLYGHQGEVWALAVSS 661
           V +WD  S + +  L GH+  V ++AV++
Sbjct: 648 VLFWDTKSGNPLLMLQGHRNSVISVAVAN 676

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 111/246 (45%), Gaps = 31/246 (12%)

Query: 466 HTAAIWSLDLTSDGKRLVTASADKTVKFWDFKV-EQELVA----------------GTLD 508
           HT+ +  +  ++DG+ L T   +KT +   F+V +  LVA                GT D
Sbjct: 361 HTSVVCCVRFSNDGEYLATG-CNKTTQV--FRVSDGALVARLSDDNATQGPQGPSGGTSD 417

Query: 509 KFVPKMKLIHDTTLDLGEDLW--CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH 566
                       T     DL+   V  SP+ +FLA    D  ++++ +   K  + L GH
Sbjct: 418 DDYNNDANSFANTRTASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGH 477

Query: 567 KLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF-LPESHNFF 625
           +  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V   L +     
Sbjct: 478 EQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIA 536

Query: 626 SCSKDGTVKYWDGNSFDCIQKL-------YGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           + S D  V+ WD  +   +++L        GH+  V+++  + DG  VVS S DRS+++W
Sbjct: 537 AGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 596

Query: 679 EETEDQ 684
             +  Q
Sbjct: 597 NLSSGQ 602

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 74/151 (49%), Gaps = 14/151 (9%)

Query: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148
            LA G  D  I+IWD+  + +++V   H   I  L +  +G +L+SGS D T+ +WDL  
Sbjct: 450 FLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 507

Query: 149 ETGLCKLR-SHKDAITGIWCENDD--WLISVSKDGLIKLWDMKVHQCVET-------HMA 198
            TG C L  S +D +T +     D  ++ + S D  +++WD +    VE           
Sbjct: 508 RTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENELGTG 567

Query: 199 HTGECWSLA-VKDNM-VITANAESEIKLWEL 227
           H    +S+   +D   V++ + +  +KLW L
Sbjct: 568 HKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 598

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 96/227 (42%), Gaps = 18/227 (7%)

Query: 383 GHRTDLRAAD-ISSDDKLLATASNGNLKVWNIKTKTCIRNLDC--GYALCCKFLPGGALV 439
           GH  D+ + D   S DKL++ + +  +++W+++T  C   L    G       L  G  +
Sbjct: 476 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYI 535

Query: 440 ILGTRAGQLQLFDLASSTMLENIEE------AHTAAIWSLDLTSDGKRLVTASADKTVKF 493
             G+    ++++D  +  ++E ++        H  +++S+  T DG  +V+ S D++VK 
Sbjct: 536 AAGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKL 595

Query: 494 WDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF 553
           W+    Q     T  +  P       T     + +  V  +  D ++     D  V  + 
Sbjct: 596 WNLSSGQN---NTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWD 652

Query: 554 LDSMKFFLSLYGHKLPVLSMDISHDSKL------IITSSADKNIKIW 594
             S    L L GH+  V+S+ +++   L        T S D   +IW
Sbjct: 653 TKSGNPLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIW 699

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 101/223 (45%), Gaps = 46/223 (20%)

Query: 36  QVITGALEE-VKCWEIKTGE--LLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92
           ++++G+ +  V+ W+++TG+  L  ++ DG     + T A    +  Y+         A 
Sbjct: 492 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-----VTTVAVSLGDGKYI---------AA 537

Query: 93  GYADGTIKIWDMQTQTVLIVFHS-------HSSAITILRFDQTGTRLISGSRDATIILWD 145
           G  D  +++WD +T  ++    S       H  ++  + F + G  ++SGS D ++ LW+
Sbjct: 538 GSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 597

Query: 146 LV-------AET----GLCKLR--SHKDAITGIWC-ENDDWLISVSKDGLIKLWDMKVHQ 191
           L        AET    G C++    HKD +  +    ND++++S SKD  +  WD K   
Sbjct: 598 LSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGN 657

Query: 192 CVETHMAHTGECWSLAVKDNMVI--------TANAESEIKLWE 226
            +     H     S+AV +   +        T + + + ++W+
Sbjct: 658 PLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWK 700

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 70/177 (39%), Gaps = 27/177 (15%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           L Y      L  G  D T++IWD++T    +         T+      G  + +GS D  
Sbjct: 484 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRA 543

Query: 141 IILWDLVAETGLCKLR---------SHKDAI-TGIWCENDDWLISVSKDGLIKLWDMKVH 190
           + +WD  AETG    R          HKD++ + ++  +   ++S S D  +KLW++   
Sbjct: 544 VRVWD--AETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSG 601

Query: 191 Q-------------CVETHMAHTGECWSLAV--KDNMVITANAESEIKLWELDLERP 232
           Q             C  T+  H     S+A    D  +++ + +  +  W+     P
Sbjct: 602 QNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNP 658

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 118/274 (43%), Gaps = 28/274 (10%)

Query: 434 PGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKF 493
           P    V  G+  G +++ D  +  +L + +  H   I  LD +SD   LVT  AD+ VK 
Sbjct: 192 PNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADRIVKV 251

Query: 494 WDFKVEQELVA------GTLDK--FVPKMKLIHDTTLDLGEDLW---------------- 529
           W      +  A      G + K  F P  + +   + D+   LW                
Sbjct: 252 WKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHAK 311

Query: 530 ---CVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSS 586
              C+    +   L  + LD+  +++ + S +  + L GH  P+  +  S +   + T S
Sbjct: 312 EVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGS 371

Query: 587 ADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES-HNFFSCSKDGTVKYWDGNSFDCIQ 645
           AD  +K+W +       S+ AH + + +VKF   S     S S D TV  +  +S+  + 
Sbjct: 372 ADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLA 431

Query: 646 KLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
            L GH  +V ++ +S D   + S   DRS+++W+
Sbjct: 432 SLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWK 465

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 27/238 (11%)

Query: 363 YKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRN 421
           +K   P   TA+        GH   +        D+ +A+AS +   ++W+++ +  ++ 
Sbjct: 252 WKPSSPNDSTAVL------KGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQ- 304

Query: 422 LDCGYA---LCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478
           L  G+A    C  F   G+L+         +++D+ S   L  I E H   I+ +  + +
Sbjct: 305 LQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLM-ILEGHAKPIYGVSWSPN 363

Query: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538
           G  + T SAD TVK WD +       G     +    ++ D   D        K+S   R
Sbjct: 364 GHHVATGSADGTVKVWDIRK-----VGNPFSILAHNNIVSDVKFD--------KVS--GR 408

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596
            L  S  D TV VF  DS     SL GH   V+S+DISHD   + +S  D+++K+W L
Sbjct: 409 TLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL 466

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 531 VKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYG-HKLPVLSMDISHDSKLIITSSADK 589
           V +SP  + +A       VK+   ++++   S    H   +  +D S DS L++T  AD+
Sbjct: 188 VLLSPNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADR 247

Query: 590 NIKIWGLDF-GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLY 648
            +K+W      D    L  H+  ++ VKF P      S S D T + WD      +Q   
Sbjct: 248 IVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQE 307

Query: 649 GHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETEDQ 684
           GH  EV+ L    DG  + S   D   R+W+    Q
Sbjct: 308 GHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQ 343

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 1/109 (0%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           +++H     +A    D T ++WD++ Q  L +   H+  +  L F   G+ L S   D+ 
Sbjct: 274 VKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSI 333

Query: 141 IILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
             +WD+ +   L  L  H   I G+ W  N   + + S DG +K+WD++
Sbjct: 334 GRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIR 382

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/155 (19%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 77  EATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGS 136
           E   L +  +  +L     D   +IWDM++   L++   H+  I  + +   G  + +GS
Sbjct: 312 EVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGS 371

Query: 137 RDATIILWDLVAETGLCKLRSHKDAITGIWCE--NDDWLISVSKDGLIKLWDMKVHQCVE 194
            D T+ +WD+        + +H + ++ +  +  +   L+S S D  + ++       + 
Sbjct: 372 ADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLA 431

Query: 195 THMAHTGECWSLAVKDNM--VITANAESEIKLWEL 227
           +   HT +  S+ +  +   + ++  +  +KLW+L
Sbjct: 432 SLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL 466

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 96/231 (41%), Gaps = 18/231 (7%)

Query: 458 MLENIEEAHTAAIWSLDLT-SDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516
           +L    E H   + SL  + +    L++ S DKT+  W    E +     +  F     +
Sbjct: 24  VLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHI 83

Query: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 576
           + D T           ++ + ++   +  D T++++ L S K      GHK  V+S+ I 
Sbjct: 84  VQDCT-----------VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSID 132

Query: 577 HDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP-----ESHNFFSCSKDG 631
             +  I+++S DK +K+W    GDC  +L  H D + NV+  P     ++    S   D 
Sbjct: 133 PRATQIVSASRDKTVKVWNT-VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDK 191

Query: 632 TVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETE 682
            VK WD  SF       GH   V  +  S DG    S   D  I +W   E
Sbjct: 192 VVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNE 242

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 105/254 (41%), Gaps = 40/254 (15%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQ----------------------E 501
           + H+  +    +T DGK  ++AS DKT++ WD +  +                      +
Sbjct: 78  KGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQ 137

Query: 502 LVAGTLDKFVPKMKLIHDTTLDL-GEDLWC--VKISP----EDRFLAVSL-LDNTVKVFF 553
           +V+ + DK V     + D  + L G + W   V+I+P    +D    +S  +D  VKV+ 
Sbjct: 138 IVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWD 197

Query: 554 LDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 613
           L S        GH   V ++  S D  +  ++  D  I +W L+      +L A +D + 
Sbjct: 198 LQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDA-KDEVF 256

Query: 614 NVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLY--------GHQGEVWALAVSSDGQA 665
            V F P  +   + +  G +K +D      +  L                +LA S+DGQ 
Sbjct: 257 AVAFSPNRYWLTAATASG-IKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQT 315

Query: 666 VVSVSHDRSIRVWE 679
           + +   D  IRVW+
Sbjct: 316 LFAGYTDNIIRVWQ 329

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 77/162 (47%), Gaps = 19/162 (11%)

Query: 84  HEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIIL 143
           H+  + L+  + D T+++WD+Q+   +  F  H S +  +  D   T+++S SRD T+ +
Sbjct: 91  HDGKYALSASW-DKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKV 149

Query: 144 WDLVAETGLCKLRSHKDAITGIWC----ENDDW--LISVSKDGLIKLWDMKVHQCVETHM 197
           W+ V +  +  L  H D ++ +      ++DD   +IS   D ++K+WD++        +
Sbjct: 150 WNTVGDC-VVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFI 208

Query: 198 AHT-----------GECWSLAVKDNMVITANAESEIKLWELD 228
            H            G  ++ A KD  +I  N   +  L+ LD
Sbjct: 209 GHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLD 250

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 562 SLYGHKLPVLSMDIS-HDSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 615
           +L GH   V S+  S     ++++ S DK +  W L      +G   +S   H   + + 
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 616 KFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSI 675
               +     S S D T++ WD  S  CI++  GH+ +V ++++      +VS S D+++
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 676 RVWEETEDQV 685
           +VW    D V
Sbjct: 148 KVWNTVGDCV 157

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D  +K+WD+Q+ T+   F  H++ +T +     G+   S  +D  IILW+L  +T L  L
Sbjct: 190 DKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTL 249

Query: 156 RSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVE 194
            +  +     +  N  WL + +  G IK++D++    V+
Sbjct: 250 DAKDEVFAVAFSPNRYWLTAATASG-IKIFDLEERTIVD 287

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 48/252 (19%), Positives = 104/252 (41%), Gaps = 42/252 (16%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGY---ALCCKFLPGGAL 438
           GH   ++   ++ D K   +AS +  L++W++++  CI+    G+    +     P    
Sbjct: 79  GHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRF-VGHKSDVMSVSIDPRATQ 137

Query: 439 VILGTRAGQLQLFDLASS---TMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWD 495
           ++  +R   +++++       T+L + +      I   + + D   +++A  DK VK WD
Sbjct: 138 IVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWD 197

Query: 496 ---FKVEQELVA-------------GTL------DKFVPKMKLIHDT---TLDLGEDLWC 530
              F +E + +              G++      D  +    L   T   TLD  ++++ 
Sbjct: 198 LQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFA 257

Query: 531 VKISPEDRFLAVSLLDNTVKVF------FLDSMKFFLSLY--GHKLPVLSMDISHDSKLI 582
           V  SP +R+   +   + +K+F       +D +K   + Y        +S+  S D + +
Sbjct: 258 VAFSP-NRYWLTAATASGIKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTL 316

Query: 583 ITSSADKNIKIW 594
                D  I++W
Sbjct: 317 FAGYTDNIIRVW 328

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 98/232 (42%), Gaps = 19/232 (8%)

Query: 458 MLENIEEAHTAAIWSLDLT-SDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516
           +L    E H   + SL  + +    L++AS DKT+  W    + +     +  F     +
Sbjct: 9   VLRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHI 68

Query: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 576
           I D T           ++ +  +   +  D T++++ L + K      GHK  VLS+ I 
Sbjct: 69  IQDCT-----------VTADGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSVAID 117

Query: 577 HDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSKD 630
             +  I+++S DK +K+W    G+C  +L  H D +  V+  P      ++    S   D
Sbjct: 118 RRATQIVSASRDKTVKVWNT-LGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMD 176

Query: 631 GTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETE 682
             VK W+ +SF       GH   V  +  S DG  V S   D  I +W  TE
Sbjct: 177 KVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGSLVASAGKDGQIMLWNLTE 228

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 110/255 (43%), Gaps = 41/255 (16%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQ----------------------E 501
           + H+  I    +T+DG+  ++AS DKT++ W+    +                      +
Sbjct: 63  KGHSHIIQDCTVTADGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQ 122

Query: 502 LVAGTLDKFVPKMKLIHDTTLDL-GEDLWCVKI------SPEDRFLAV--SLLDNTVKVF 552
           +V+ + DK V     + +  + L G + W  ++       PED+ + V  + +D  VKV+
Sbjct: 123 IVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKVW 182

Query: 553 FLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 612
            L S +      GH   V ++  S D  L+ ++  D  I +W L       +L A QD +
Sbjct: 183 NLHSFQIEADFIGHNNYVNTVTASPDGSLVASAGKDGQIMLWNLTEKTALYTLNA-QDEV 241

Query: 613 MNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKL------YGHQGEVWALAVS--SDGQ 664
             + F P  +   + +  G +K ++      + +L      Y    E  A+++S  +DGQ
Sbjct: 242 FALAFSPNRYWLTAATSSG-IKIFNLEERKVVDELRPEFAGYTKAAEPHAISLSWSADGQ 300

Query: 665 AVVSVSHDRSIRVWE 679
            + +   D  IRVW+
Sbjct: 301 TLFAGYTDNVIRVWQ 315

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D TI++W++ T   +  F  H S +  +  D+  T+++S SRD T+ +W+ + E  +  L
Sbjct: 87  DKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQIVSASRDKTVKVWNTLGEC-MVTL 145

Query: 156 RSHKDAITGIW-CENDD------WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +    N+D       +IS   D ++K+W++   Q     + H     ++  
Sbjct: 146 LGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 205

Query: 209 KDN--MVITANAESEIKLWEL 227
             +  +V +A  + +I LW L
Sbjct: 206 SPDGSLVASAGKDGQIMLWNL 226

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCEND-DWLISVSKDGLIKLW 185
           L+S SRD T+I W L  +       +   + H   I       D ++ +S S D  I+LW
Sbjct: 34  LLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHIIQDCTVTADGEYALSASWDKTIRLW 93

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLW 225
           ++   +CV+  + H  +  S+A+  +   +++A+ +  +K+W
Sbjct: 94  ELATGKCVKRFVGHKSDVLSVAIDRRATQIVSASRDKTVKVW 135

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D  +K+W++ +  +   F  H++ +  +     G+ + S  +D  I+LW+L  +T L  L
Sbjct: 176 DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGSLVASAGKDGQIMLWNLTEKTALYTL 235

Query: 156 RSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVE 194
            +  +     +  N  WL + +  G IK+++++  + V+
Sbjct: 236 NAQDEVFALAFSPNRYWLTAATSSG-IKIFNLEERKVVD 273

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 62/148 (41%), Gaps = 19/148 (12%)

Query: 96  DGTIKIW-----DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAET 150
           D T+  W     D Q    +  F  HS  I        G   +S S D TI LW+L   T
Sbjct: 40  DKTLITWKLTGDDQQYGVPVRSFKGHSHIIQDCTVTADGEYALSASWDKTIRLWELA--T 97

Query: 151 GLCKLR--SHKDAITGIWCEND-DWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLA 207
           G C  R   HK  +  +  +     ++S S+D  +K+W+  + +C+ T + H      + 
Sbjct: 98  GKCVKRFVGHKSDVLSVAIDRRATQIVSASRDKTVKVWNT-LGECMVTLLGHNDWVSQVR 156

Query: 208 VKDN--------MVITANAESEIKLWEL 227
           V  N         VI+A  +  +K+W L
Sbjct: 157 VAPNEDPEDKTVTVISAGMDKVVKVWNL 184

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 101/424 (23%), Positives = 169/424 (39%), Gaps = 88/424 (20%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149
           +  G  D   +IWD  TQT +     H++ +  + +   G  + +GS D TI LWD  A+
Sbjct: 186 MVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWD--AQ 243

Query: 150 TGLCK---LRSHKDAITGIWCE--------NDDWLISVSKDGLIKLWDMKVHQCVETHMA 198
           TG  K   LR H   IT +  E        N   + S SKDG IK+WD    QC+ T   
Sbjct: 244 TGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLSG 303

Query: 199 HTGECWSLAVKDNMVI-TANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFT 257
           HT     +      VI T + +  I+ W+++      ++L       K        LS +
Sbjct: 304 HTSSVSCIKWGGQGVIYTGSHDRTIRCWDMNAGGKCINIL-------KSHAHWVNHLSLS 356

Query: 258 TVADGTTFFYSLNSDKTMEIFRIRSETEIA--KALKKREKRFKEKGMSDEEIQESFRNSY 315
           T        Y+L        +   +  E A  +ALK  EK  K  G+  EE+  +  + +
Sbjct: 357 T-------DYALKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRNGVL-EELIATASDDF 408

Query: 316 ANLLLHPFQLVRSLFKL----KASSWTVCTPSKLELVITTANNTIEYYSIPYKKKEPLQP 371
              L +P +  + L ++    K  +    +P    +V  + +N+I+ +          + 
Sbjct: 409 TMYLWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW----------EG 458

Query: 372 TAIKLHSIESPGHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCC 430
           ++ K  S    GH   +     SSD +LL + S +  LKVW+++T+    +         
Sbjct: 459 SSGKFISTFR-GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLAVD--------- 508

Query: 431 KFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKT 490
             LPG                              H   ++++D ++DGK + +   DK 
Sbjct: 509 --LPG------------------------------HNDEVYTVDWSADGKSVCSGGKDKM 536

Query: 491 VKFW 494
           V+ W
Sbjct: 537 VRLW 540

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 120/283 (42%), Gaps = 21/283 (7%)

Query: 398 KLLATASNGNLKVWNIKTKTCIRNLDCGY--ALCCKFLPGGALVILGTRAGQLQLFDLAS 455
           ++ + + +G +KVW+   + CI  L  G+  ++ C    G  ++  G+    ++ +D+ +
Sbjct: 277 RIASASKDGTIKVWDTVRRQCILTLS-GHTSSVSCIKWGGQGVIYTGSHDRTIRCWDMNA 335

Query: 456 STMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
                NI ++H   +  L L++D    V A      +    +  Q+      +K   +  
Sbjct: 336 GGKCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRNG 395

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ +      +D      +P                  L   K    + GH+  V  +  
Sbjct: 396 VLEELIATASDDFTMYLWNP------------------LKGTKPLTRMTGHQKLVNHVAF 437

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKY 635
           S D + I+++S D +IK+W    G    +   H  S+  V +  +     SCSKD T+K 
Sbjct: 438 SPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 497

Query: 636 WDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           WD  +      L GH  EV+ +  S+DG++V S   D+ +R+W
Sbjct: 498 WDVRTRKLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/369 (22%), Positives = 150/369 (40%), Gaps = 53/369 (14%)

Query: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADIS--SDDKLLATASNGNLKVWN 412
           T ++ ++ Y  K   +   +   S    GH + +  +  +  +  +++  + + N ++W+
Sbjct: 140 TEDFITLVYTPKAVFKVRPVTRSSSAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWD 199

Query: 413 IKTKTCIRNLD--CGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAI 470
             T+T I  L     + LC  +   G ++  G+    ++L+D  +     +    H+  I
Sbjct: 200 CDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWI 259

Query: 471 WSLD-----LTSDGK--RLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLI------ 517
            S+      L + G   R+ +AS D T+K WD    Q ++  TL      +  I      
Sbjct: 260 TSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCIL--TLSGHTSSVSCIKWGGQG 317

Query: 518 ------HDTTL---DLGEDLWCVKISPE------------DRFLAVSLLDNTVK--VFFL 554
                 HD T+   D+     C+ I               D  L V   D+T        
Sbjct: 318 VIYTGSHDRTIRCWDMNAGGKCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAE 377

Query: 555 DSMKFFLSLY---GHKLPVLSMDISHDSKLIITSSADKNIKIWG-LDFGDCHKSLFAHQD 610
           ++ K  L  Y     +  VL        +LI T+S D  + +W  L        +  HQ 
Sbjct: 378 EAQKRALKNYEKVAKRNGVLE-------ELIATASDDFTMYLWNPLKGTKPLTRMTGHQK 430

Query: 611 SIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVS 670
            + +V F P+     S S D ++K W+G+S   I    GH   V+ +A SSD + +VS S
Sbjct: 431 LVNHVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHVASVYQVAWSSDCRLLVSCS 490

Query: 671 HDRSIRVWE 679
            D +++VW+
Sbjct: 491 KDTTLKVWD 499

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 93/224 (41%), Gaps = 33/224 (14%)

Query: 35  GQVITGALEE-VKCWEIKTG----ELLKTMRD-----------GLPPGAIDTKAEKPAEA 78
           G + TG+ +  ++CW++  G     +LK+               L  GA D    +PA A
Sbjct: 317 GVIYTGSHDRTIRCWDMNAGGKCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPATA 376

Query: 79  -----TYLQYHEETF--------ILAVGYADGTIKIWD-MQTQTVLIVFHSHSSAITILR 124
                  L+ +E+          ++A    D T+ +W+ ++    L     H   +  + 
Sbjct: 377 EEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVA 436

Query: 125 FDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIK 183
           F   G  ++S S D +I LW+  +   +   R H  ++  + W  +   L+S SKD  +K
Sbjct: 437 FSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLK 496

Query: 184 LWDMKVHQCVETHMAHTGECWSL--AVKDNMVITANAESEIKLW 225
           +WD++  +       H  E +++  +     V +   +  ++LW
Sbjct: 497 VWDVRTRKLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 9/120 (7%)

Query: 89  ILAVGYADGTIKIWDMQT-QTVLIVFHSHSSAITILRFDQ-------TGTRLISGSRDAT 140
           ++A G  D TI++WD QT  +       HS  IT + ++           R+ S S+D T
Sbjct: 227 VIATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGT 286

Query: 141 IILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKV-HQCVETHMAH 199
           I +WD V    +  L  H  +++ I       + + S D  I+ WDM    +C+    +H
Sbjct: 287 IKVWDTVRRQCILTLSGHTSSVSCIKWGGQGVIYTGSHDRTIRCWDMNAGGKCINILKSH 346

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 9/134 (6%)

Query: 562 SLYGHKLPVL-SMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 620
           ++ GH   +L S    H S  ++T S D N +IW  D      +L  H + ++ V +  +
Sbjct: 165 AIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSAD 224

Query: 621 SHNFFSCSKDGTVKYWDGNSFDCI-QKLYGHQG-------EVWALAVSSDGQAVVSVSHD 672
                + S D T++ WD  + D     L GH         E   L    +   + S S D
Sbjct: 225 GEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKD 284

Query: 673 RSIRVWEETEDQVF 686
            +I+VW+    Q  
Sbjct: 285 GTIKVWDTVRRQCI 298

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 5/111 (4%)

Query: 397 DKLLATASNG-NLKVWN-IKTKTCIRNLDCGYALC--CKFLPGGALVILGTRAGQLQLFD 452
           ++L+ATAS+   + +WN +K    +  +     L     F P G  ++  +    ++L++
Sbjct: 398 EELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWE 457

Query: 453 LASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELV 503
            +S   +      H A+++ +  +SD + LV+ S D T+K WD +  +  V
Sbjct: 458 GSSGKFISTFR-GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLAV 507

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 99/231 (42%), Gaps = 22/231 (9%)

Query: 450 LFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDK 509
           + D  S+T++      H+ A++S   + D + L++ S DKTV+ W       LV+     
Sbjct: 537 MNDNTSTTLI-----GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVS----- 586

Query: 510 FVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 569
                             +W V+ SP   + A +  D T +++  D +       GH   
Sbjct: 587 -----------YKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSD 635

Query: 570 VLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSK 629
           V  +    +   + T S+DK  ++W +  GD  +    H   ++     P+     + S+
Sbjct: 636 VDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSE 695

Query: 630 DGTVKYWDGNSFDCIQKLYGH-QGEVWALAVSSDGQAVVSVSHDRSIRVWE 679
           DG +  WD  +   ++ + GH +  + +L+   +G  +VS   D S+RVW+
Sbjct: 696 DGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 80/179 (44%), Gaps = 21/179 (11%)

Query: 528 LWCVKISPEDRFLAVSLLDNTVKVFFLD--SMKFF------------------LSLYGHK 567
           +  ++ S + R +A    D+ +K++ LD  S+K                     +L GH 
Sbjct: 490 MTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHS 549

Query: 568 LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSC 627
             V S   S D++ +++ S DK +++W  D      S   H   + +V+F P  H F + 
Sbjct: 550 GAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATA 609

Query: 628 SKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE-ETEDQV 685
           S D T + W  +    ++   GH  +V  ++   +G  V + S D++ R+W+  T D V
Sbjct: 610 SHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSV 668

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           + +H     +  G +D T ++WD+ T   + +F  H++ +        G  L +GS D  
Sbjct: 639 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGI 698

Query: 141 IILWDLVAETGLCKLRSH-KDAITGI-WCENDDWLISVSKDGLIKLWDMK 188
           I LWD+     L  +R H K+AI  + +C+  + L+S   D  +++WD+K
Sbjct: 699 INLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 65/151 (43%), Gaps = 4/151 (2%)

Query: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDAT 140
           +Q+       A    D T ++W       L +F  H S +  + F   G  + +GS D T
Sbjct: 597 VQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKT 656

Query: 141 IILWDLVAETGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLWDM---KVHQCVETH 196
             +WD+     +     H   +       D  WL + S+DG+I LWD+   K  + +  H
Sbjct: 657 CRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGH 716

Query: 197 MAHTGECWSLAVKDNMVITANAESEIKLWEL 227
             +     S   + N++++  A+  +++W+L
Sbjct: 717 GKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 78/212 (36%), Gaps = 29/212 (13%)

Query: 42  LEEVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKI 101
           LE  K  E +    L  ++  LP   + T        T LQ+ E++ ++A G+ D  IK+
Sbjct: 454 LEIQKVKESRDSIKLDNLQAALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKL 513

Query: 102 WDM-----------------------QTQTVLIVFHSHSSAITILRFDQTGTRLISGSRD 138
           W +                        T T LI    HS A+    F      L+SGS D
Sbjct: 514 WSLDGSSLKQIQEKSADSINTGDMNDNTSTTLI---GHSGAVYSTSFSPDNRYLLSGSED 570

Query: 139 ATIILWDLVAETGLCKLRSHKDAITGI-WCENDDWLISVSKDGLIKLWDMKVHQCVETHM 197
            T+ LW     T L   + H   +  + +     +  + S D   +LW       +    
Sbjct: 571 KTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFA 630

Query: 198 AHTG--ECWSLAVKDNMVITANAESEIKLWEL 227
            H    +C S       V T +++   ++W++
Sbjct: 631 GHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDI 662

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 57/119 (47%), Gaps = 5/119 (4%)

Query: 383 GHRTDLRAADISSDDKLLAT-ASNGNLKVWNIKTKTCIRNLDCGYA---LCCKFLPGGAL 438
           GH +D+       +   + T +S+   ++W+I T   +R L  G+    LC    P G  
Sbjct: 631 GHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVR-LFLGHTAPVLCTAVSPDGRW 689

Query: 439 VILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497
           +  G+  G + L+D+ ++  L+ +      AI SL    +G  LV+  AD +V+ WD K
Sbjct: 690 LATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHS-SAITILRFDQTGTRLISGSRDATIILWDL-- 146
           LA G  DG I +WD+ T   L V   H  +AI  L + + G  L+SG  D ++ +WDL  
Sbjct: 690 LATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKK 749

Query: 147 -VAETG 151
             AE G
Sbjct: 750 STAEPG 755

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 45  VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDM 104
           +  W+I T + LK MR G    AI +          L Y +E  +L  G AD ++++WD+
Sbjct: 699 INLWDIGTAKRLKVMR-GHGKNAIHS----------LSYCKEGNVLVSGGADHSVRVWDL 747

Query: 105 QTQTV 109
           +  T 
Sbjct: 748 KKSTA 752

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 141/300 (47%), Gaps = 26/300 (8%)

Query: 374 IKLHSIESPGHRTD-LRAADISSDDK-LLATASNGNLKVWNIKTKTCIRNLDCG--YALC 429
           +KL   ++ G+R+D ++  D+   +  +L+T  +G +++WN +T+T +R+++        
Sbjct: 1   MKLDIKKAFGNRSDRVKGIDLHPTEPWVLSTLYSGRVEIWNYETQTEVRSIEVTDTPVRA 60

Query: 430 CKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADK 489
            +F+     +++G+   ++++F+  +   + + E  H   I S+ +      +++AS D 
Sbjct: 61  GRFIARKNWIVVGSDDFKIRVFNYNTGEKVTDFE-GHPDYIRSIAVHPTRPYVLSASDDM 119

Query: 490 TVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGED-LWCVKISPED-RFLAVSLLDN 547
           T+K W+++    L                + T +  E  + CV  +P+D    A + LD+
Sbjct: 120 TIKLWNWEKNWAL----------------EQTFEGHEHFVMCVAFNPKDPNTFASACLDH 163

Query: 548 TVKVFFLDSMKFFLSLYGHK---LPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKS 604
           TVK++ L       ++  H+   +  +      D   +ITSS D+++KIW      C  +
Sbjct: 164 TVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVAT 223

Query: 605 LFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQ 664
           L  H  ++    F P      S S+DGTVK W+ N++   + L       W +A    G+
Sbjct: 224 LEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGK 283

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 8/157 (5%)

Query: 86  ETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWD 145
           E ++L+  Y+ G ++IW+ +TQT +       + +   RF      ++ GS D  I +++
Sbjct: 25  EPWVLSTLYS-GRVEIWNYETQTEVRSIEVTDTPVRAGRFIARKNWIVVGSDDFKIRVFN 83

Query: 146 LVAETGLCKLRSHKDAITGIWCE-NDDWLISVSKDGLIKLWDMK----VHQCVETHMAHT 200
                 +     H D I  I       +++S S D  IKLW+ +    + Q  E H  H 
Sbjct: 84  YNTGEKVTDFEGHPDYIRSIAVHPTRPYVLSASDDMTIKLWNWEKNWALEQTFEGH-EHF 142

Query: 201 GECWSLAVKD-NMVITANAESEIKLWELDLERPNGSM 236
             C +   KD N   +A  +  +K+W L  + PN +M
Sbjct: 143 VMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 179

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 55/117 (47%), Gaps = 4/117 (3%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSS-AITILRFD--QTGTRLISGSRDATIILWDLVAETGL 152
           D T+KIW +  Q+      +H +  +  + +   Q    LI+ S D ++ +WD   ++ +
Sbjct: 162 DHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCV 221

Query: 153 CKLRSHKDAIT-GIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             L  H   ++  I+  +   +IS S+DG +K+W+   ++  +T        W +A 
Sbjct: 222 ATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAA 278

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 62/139 (44%), Gaps = 10/139 (7%)

Query: 96  DGTIKIWDMQTQTVL-IVFHSHSSAITILRFD-QTGTRLISGSRDATIILWDLVAETGLC 153
           D TIK+W+ +    L   F  H   +  + F+ +      S   D T+ +W L  ++   
Sbjct: 118 DMTIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNF 177

Query: 154 KLRSHK----DAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV- 208
            + +H+    + +     ++  +LI+ S D  +K+WD +   CV T   H     S A+ 
Sbjct: 178 TMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANV-SYAIF 236

Query: 209 --KDNMVITANAESEIKLW 225
                ++I+ + +  +K+W
Sbjct: 237 HPSLPIIISGSEDGTVKIW 255

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598
           ++ V   D  ++VF  ++ +      GH   + S+ +      ++++S D  IK+W  + 
Sbjct: 69  WIVVGSDDFKIRVFNYNTGEKVTDFEGHPDYIRSIAVHPTRPYVLSASDDMTIKLWNWEK 128

Query: 599 GDCHKSLF-AHQDSIMNVKFLPESHN-FFSCSKDGTVKYWDGNSFDCIQKLYGHQG---- 652
               +  F  H+  +M V F P+  N F S   D TVK W          +  H+     
Sbjct: 129 NWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVN 188

Query: 653 --EVWALAVSSDGQAVVSVSHDRSIRVWE 679
             + + L    D   +++ S DRS+++W+
Sbjct: 189 FVDYYPL---QDKPYLITSSDDRSVKIWD 214

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 98/233 (42%), Gaps = 21/233 (9%)

Query: 458 MLENIEEAHTAAIWSLDLTSDGKR--LVTASADKTVKFWDFKVEQELVAGTLDKFVPKMK 515
           +L    E H   + SL  TS G+   L++AS DKT+  W      +     +  F     
Sbjct: 7   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSH 65

Query: 516 LIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 575
           ++ D  L           + +  +   +  D T++++ + + + +    GHK  V+S+ I
Sbjct: 66  IVQDCAL-----------TADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAI 114

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSCSK 629
              + +II+ S DK IK+W +  GDC  ++  H D +  V+  P      E+    S   
Sbjct: 115 DRKASMIISGSRDKTIKVWTIK-GDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGM 173

Query: 630 DGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETE 682
           D  VK W+ N F       GH   +  +  S DG  + S   D  I +W   E
Sbjct: 174 DKMVKAWNVNQFQIEADFVGHNNYINTITASPDGTLIASAGKDGDIMLWNLKE 226

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 10/146 (6%)

Query: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155
           D T+++W++ T      F  H S +  +  D+  + +ISGSRD TI +W +  +  L  +
Sbjct: 85  DKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGDC-LATM 143

Query: 156 RSHKDAITGIWC---ENDD----WLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAV 208
             H D ++ +     EN+D     LIS   D ++K W++   Q     + H     ++  
Sbjct: 144 LGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVNQFQIEADFVGHNNYINTITA 203

Query: 209 KDN--MVITANAESEIKLWELDLERP 232
             +  ++ +A  + +I LW L  + P
Sbjct: 204 SPDGTLIASAGKDGDIMLWNLKEKSP 229

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 105/256 (41%), Gaps = 43/256 (16%)

Query: 464 EAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE---------------------- 501
           + H+  +    LT+DG   ++AS DKT++ W+    +                       
Sbjct: 61  KGHSHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASM 120

Query: 502 LVAGTLDKFVPKMKLIHDTTLD-LGEDLWC--VKISPED-------RFLAVSLLDNTVKV 551
           +++G+ DK +    +  D     LG + W   V+++P +       R ++  + D  VK 
Sbjct: 121 IISGSRDKTIKVWTIKGDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGM-DKMVKA 179

Query: 552 FFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 611
           + ++  +      GH   + ++  S D  LI ++  D +I +W L       +L A QD 
Sbjct: 180 WNVNQFQIEADFVGHNNYINTITASPDGTLIASAGKDGDIMLWNLKEKSPLYTLNA-QDE 238

Query: 612 IMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLY--------GHQGEVWALAVSSDG 663
           +  + F P  +   + +  G +K +D      I +L                +LA S+DG
Sbjct: 239 VFALAFSPNRYWLTAATSSG-IKVFDLEEKKLIDELKPEFTGFNKAADPHAVSLAWSADG 297

Query: 664 QAVVSVSHDRSIRVWE 679
           Q + +   D  IRVW+
Sbjct: 298 QTLFAGYTDNVIRVWQ 313

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 562 SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 621
           S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  +M+V    ++
Sbjct: 59  SFKGHSHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA 118

Query: 622 HNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVS----SDGQAV--VSVSHDRSI 675
               S S+D T+K W     DC+  + GH   V  + V+     D + V  +S   D+ +
Sbjct: 119 SMIISGSRDKTIKVWTIKG-DCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMV 177

Query: 676 RVWEETEDQV 685
           + W   + Q+
Sbjct: 178 KAWNVNQFQI 187

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 86/195 (44%), Gaps = 23/195 (11%)

Query: 3   KSYQRF--EQADVFGVVTANSNCVWLPSQAKNSPGQVITGALEE-VKCWEIKTGELLKTM 59
           ++YQRF   ++DV  V                    +I+G+ ++ +K W IK G+ L TM
Sbjct: 97  ETYQRFTGHKSDVMSVAI------------DRKASMIISGSRDKTIKVWTIK-GDCLATM 143

Query: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119
                 G  D  ++        +  E   +++ G  D  +K W++    +   F  H++ 
Sbjct: 144 L-----GHNDWVSQVRVAPNENEDDETVRLISAGM-DKMVKAWNVNQFQIEADFVGHNNY 197

Query: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179
           I  +     GT + S  +D  I+LW+L  ++ L  L +  +     +  N  WL + +  
Sbjct: 198 INTITASPDGTLIASAGKDGDIMLWNLKEKSPLYTLNAQDEVFALAFSPNRYWLTAATSS 257

Query: 180 GLIKLWDMKVHQCVE 194
           G IK++D++  + ++
Sbjct: 258 G-IKVFDLEEKKLID 271

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 12/122 (9%)

Query: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDC-GYALCCKFLPGGALVI 440
           GH   +     S D  L+A+A  +G++ +WN+K K+ +  L+         F P    + 
Sbjct: 193 GHNNYINTITASPDGTLIASAGKDGDIMLWNLKEKSPLYTLNAQDEVFALAFSPNRYWLT 252

Query: 441 LGTRAGQLQLFDLASSTMLENIEEAHTA--------AIWSLDLTSDGKRLVTASADKTVK 492
             T +G +++FDL    +++ ++   T         A+ SL  ++DG+ L     D  ++
Sbjct: 253 AATSSG-IKVFDLEEKKLIDELKPEFTGFNKAADPHAV-SLAWSADGQTLFAGYTDNVIR 310

Query: 493 FW 494
            W
Sbjct: 311 VW 312

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 10/135 (7%)

Query: 103 DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAI 162
           D Q    +  F  HS  +        G   +S S D T+ LW++       +   HK  +
Sbjct: 50  DQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDV 109

Query: 163 TGIWCEND-DWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDN--------MV 213
             +  +     +IS S+D  IK+W +K   C+ T + H      + V  N         +
Sbjct: 110 MSVAIDRKASMIISGSRDKTIKVWTIK-GDCLATMLGHNDWVSQVRVAPNENEDDETVRL 168

Query: 214 ITANAESEIKLWELD 228
           I+A  +  +K W ++
Sbjct: 169 ISAGMDKMVKAWNVN 183

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 48/104 (46%), Gaps = 8/104 (7%)

Query: 132 LISGSRDATIILWDLVAE-----TGLCKLRSHKDAITGIWCENDD-WLISVSKDGLIKLW 185
           L+S SRD T+I W L          +   + H   +       D  + +S S D  ++LW
Sbjct: 32  LLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLRLW 91

Query: 186 DMKVHQCVETHMAHTGECWSLAV--KDNMVITANAESEIKLWEL 227
           ++   +  +    H  +  S+A+  K +M+I+ + +  IK+W +
Sbjct: 92  NVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI 135

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 148/343 (43%), Gaps = 40/343 (11%)

Query: 372 TAIKLHSIESPGHRTDLRAADISSDDKLLATASNGN-LKVWNIKTKTCIRNLDCGYA--L 428
           T   +H+++  GH   +     S D +++AT S  N +++WN KT  C+ +   G++  +
Sbjct: 175 TQTPMHTLK--GHFNWVLCVSWSPDGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWI 232

Query: 429 CCKFLPGGALVILGTRA--------GQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGK 480
            C       LV  G++         G ++++D + + + +     HT ++  +     G 
Sbjct: 233 TCLSWEPIHLVKPGSKPRLASSSKDGTIKIWD-SVNRVCQYTLSGHTNSVSCVKWGGQG- 290

Query: 481 RLVTASADKTVKFWDFKVEQELVA--GTLDKFVPKMKLIHDTTLDLGE------------ 526
            L + S D+TV+ WD   +   +    +   +V  + L  D  L +G             
Sbjct: 291 LLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKKPATSE 350

Query: 527 ----------DLWCVKISPEDRFLAVSLLDNTVKVF-FLDSMKFFLSLYGHKLPVLSMDI 575
                     +  C K    +  +  +  D T+ ++  L S K    + GH+  V  +  
Sbjct: 351 EAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAF 410

Query: 576 SHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKY 635
           S D + I+++S D +IK+W    G    +   H  S+  V +  +     SCSKD T+K 
Sbjct: 411 SPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 470

Query: 636 WDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678
           WD  +      L GHQ EV+ +  S DG+ V S   D+ +R+W
Sbjct: 471 WDVRTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Iden