Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGL195C8.323ON55455422490.0
Ecym_42548.323ON52951814670.0
KLTH0G12298g8.323ON50045910881e-143
Kwal_56.239168.323ON49946810561e-138
SAKL0H15554g8.323ON53647010351e-134
TDEL0F044908.323ON5104678361e-105
KAFR0B057208.323ON4844567562e-93
Smik_4.3898.323ON5254827495e-92
KLLA0D16368g8.323ON5111886702e-80
KNAG0I008908.323ON5084626143e-72
YDR145W (TAF12)8.323ON5391886024e-70
TPHA0A015608.323ON5403855962e-69
Kpol_543.638.323ON5851965906e-68
NCAS0B035708.323ON5191665594e-64
CAGL0E01397g8.323ON5751975381e-60
NDAI0J010208.323ON6381865262e-58
TBLA0A039408.323ON7521915121e-55
TBLA0H012808.323ON4051132841e-26
Suva_2.3068.323ON5412072188e-18
Skud_4.4048.323ON5352172124e-17
ZYRO0F10384g8.323ON5582131973e-15
Kwal_47.171404.297ON12350711.5
TBLA0E044904.297ON14347712.0
KLTH0D15554g4.297ON12347683.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL195C
         (554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   870   0.0  
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   569   0.0  
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   423   e-143
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   411   e-138
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   403   e-134
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   326   e-105
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   295   2e-93
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   293   5e-92
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   262   2e-80
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   241   3e-72
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   236   4e-70
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   234   2e-69
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   231   6e-68
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   219   4e-64
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   211   1e-60
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   207   2e-58
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   201   1e-55
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   114   1e-26
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...    89   8e-18
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...    86   4e-17
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...    80   3e-15
Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {O...    32   1.5  
TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4....    32   2.0  
KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} simil...    31   3.7  

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/554 (79%), Positives = 441/554 (79%)

Query: 1   MRSHEAVSTGEKRLSGWQARCFRSEGFSTRFIVLYLLVSLWSGQSRKNSARDIGQTRKEN 60
           MRSHEAVSTGEKRLSGWQARCFRSEGFSTRFIVLYLLVSLWSGQSRKNSARDIGQTRKEN
Sbjct: 1   MRSHEAVSTGEKRLSGWQARCFRSEGFSTRFIVLYLLVSLWSGQSRKNSARDIGQTRKEN 60

Query: 61  MXXXXXXXXXXVPQLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYET 120
           M          VPQLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYET
Sbjct: 61  MSSNNQQGNGQVPQLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYET 120

Query: 121 YHRQQAQQAFQVRNXXXXXXXXXXXXXXXXXXRPTSSVASNIKMLLTPQQREAYEKLTQT 180
           YHRQQAQQAFQVRN                  RPTSSVASNIKMLLTPQQREAYEKLTQT
Sbjct: 121 YHRQQAQQAFQVRNPAPAGQLAAAGTGQATAPRPTSSVASNIKMLLTPQQREAYEKLTQT 180

Query: 181 FNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQAL 240
           FNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTV                   QFQAL
Sbjct: 181 FNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQFQAL 240

Query: 241 PKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTGTTNSPANTQLXXXXXXXXX 300
           PKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTGTTNSPANTQL         
Sbjct: 241 PKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTGTTNSPANTQLGANIGAASA 300

Query: 301 XXXXXXXXXXXXXXXXXXQSQRQQMQRPNSGANRYPAQVTPVNAAANQNNSGTARPVIFK 360
                             QSQRQQMQRPNSGANRYPAQVTPVNAAANQNNSGTARPVIFK
Sbjct: 301 ATPAAANAAPTGSSAATPQSQRQQMQRPNSGANRYPAQVTPVNAAANQNNSGTARPVIFK 360

Query: 361 QPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSERVMS 420
           QPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSERVMS
Sbjct: 361 QPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSERVMS 420

Query: 421 KRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVR 480
           KRKLRELVK                           FITNVTSFACRLAKHRKSDNLDVR
Sbjct: 421 KRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNLDVR 480

Query: 481 DIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSXXXXXXXXXXXXNVTTG 540
           DIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISS            NVTTG
Sbjct: 481 DIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSARAAKLAPATTANVTTG 540

Query: 541 SANAAAVATESNKK 554
           SANAAAVATESNKK
Sbjct: 541 SANAAAVATESNKK 554

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 345/518 (66%), Gaps = 35/518 (6%)

Query: 72  VPQLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQAQQA-- 129
           VPQLTP S++QLAYKF TLV EAQ+VGV+TPEGLELLKKAS +KAIYETY+RQ+ Q    
Sbjct: 12  VPQLTPPSLQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETYNRQRQQAQQA 71

Query: 130 FQVRNXXXXXXXXXXXXXXXXXX-----------------------------RPTSSVAS 160
           F+VRN                                               RP SSVAS
Sbjct: 72  FRVRNTAQTGAQPQQQLPAGQPQPQQQQQQQPPPQPQPQQPQQPQQQQLKQQRPASSVAS 131

Query: 161 NIKMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXX 220
           NIKMLL PQQREAYE+LTQTFNES KNI GEYEFLKKNIEVLDTEIKNRQ EP+TV    
Sbjct: 132 NIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVRQLE 191

Query: 221 XXXXXXXXXXXXXXXQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNT 280
                          QFQ LPKKFQEDKKKFYIECAATN+NLKKFLQATSQQQRA+ GNT
Sbjct: 192 SKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATSQQQRANTGNT 251

Query: 281 GTTNSPANTQLXXXXXXXXXXXXXXXXXXXXXXXXXXXQSQRQQMQRPNSGANRYPAQVT 340
           GTT+SPA TQ                            QS++Q  QR NSG +R P QVT
Sbjct: 252 GTTSSPAPTQPSGSVGTPNSAVPVSTNSVNTGNTATPQQSKQQPQQRSNSGISRSPTQVT 311

Query: 341 PVNAAANQNNSGTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASAL 400
           PVNAAANQN++G ARPVIFKQPNPSIPIPE+++P++TTSVSYRSNRPTIT GSAMNA+AL
Sbjct: 312 PVNAAANQNSNGAARPVIFKQPNPSIPIPESVSPISTTSVSYRSNRPTITGGSAMNAAAL 371

Query: 401 TMPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITN 460
           T PVMTKLPPYEVDSERVMSKRKLRELVK                           FITN
Sbjct: 372 TTPVMTKLPPYEVDSERVMSKRKLRELVKSVGIDDGDGETTIDGDVEELLLDLADDFITN 431

Query: 461 VTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQG 520
           VTSFACRLAKHRKSDNLDVRDIQLHLERNWNIR PGY+ADEIRSTKKWN TPAY QK+Q 
Sbjct: 432 VTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRTPGYSADEIRSTKKWNSTPAYGQKMQV 491

Query: 521 ISSXXXXXXX-XXXXXNVTTGSANAA---AVATESNKK 554
           I+S             NV + +A++     +  E+NKK
Sbjct: 492 ITSAKAAKLSPTAASTNVNSNAASSTTSNTIIAEANKK 529

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  423 bits (1088), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 242/459 (52%), Positives = 291/459 (63%), Gaps = 23/459 (5%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY-HRQQAQQAFQ-- 131
           LTP S++Q+AYKF    +EA++VG++TP+G ELLK+AS IKA+Y+ Y  RQQ+ Q F+  
Sbjct: 25  LTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAYRQRQQSAQGFEQG 84

Query: 132 -VRNXXXXXXXXXXXXXXXXXXRPTSSVASNIKMLLTPQQREAYEKLTQTFNESVKNITG 190
              +                   P ++++SNI+ LLTPQQ EAY +L QT NE+ + I G
Sbjct: 85  GATSNTGDNTAGTPTNARSPNGTPNNNMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKG 144

Query: 191 EYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALPKKFQEDKKK 250
           EY +LKK IE+LD EIK RQG+P TV                    + AL +K +EDKKK
Sbjct: 145 EYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLREDKKK 204

Query: 251 FYIECAATNVNLKKFLQATSQQQRASAGNTGTTNS---PANTQLXXXXXXXXXXXXXXXX 307
           FYIECAATN NLK+FLQA++QQQRA++  T + N+   PA T                  
Sbjct: 205 FYIECAATNPNLKRFLQASTQQQRANS--TASQNASPLPAAT-----------GANQASS 251

Query: 308 XXXXXXXXXXXQSQRQQMQRPNSGAN-RYPAQVTPVNAAANQNNSGT--ARPVIFKQPNP 364
                      Q Q     +P SG N R P QVT VNAAA+  N+ T  AR  IFKQPNP
Sbjct: 252 PIQQTGAPSQVQQQTATPSQPRSGVNSRSPTQVTSVNAAAHLANNATSAARQAIFKQPNP 311

Query: 365 SIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSERVMSKRKL 424
           S+P+ E IT    T V +RSNRPTIT GSAMNA+ALT PVMTKLPPYEVD+ERVMSKRKL
Sbjct: 312 SVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKL 371

Query: 425 RELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQL 484
           RELVK                           FITNVTSFACRLAKHRKSDNLDVRDIQL
Sbjct: 372 RELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQL 431

Query: 485 HLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISS 523
           HLERNWNIRIPGYAADE+RST+KWNPT +Y+QKLQGI+S
Sbjct: 432 HLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGINS 470

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  411 bits (1056), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 289/468 (61%), Gaps = 41/468 (8%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY-HRQQAQQAFQVR 133
            TP SM+Q+AYKF    +EA+++G++TP+G ELLK+AS+IKA+Y+ Y  RQQA Q F  +
Sbjct: 25  FTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYRQRQQAAQGFD-Q 83

Query: 134 NXXXXXXXXXXXXXXXXXXRP----TSSVASNIKMLLTPQQREAYEKLTQTFNESVKNIT 189
           N                   P    T++++SNI+ LLTPQQ EAY +L Q+ NE+ + I 
Sbjct: 84  NAPGASSAGSTSGSPATARAPNGTATNTISSNIQNLLTPQQNEAYGRLIQSSNENGEKIK 143

Query: 190 GEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALPKKFQEDKK 249
           GEY +LK+ IE+LD EIK R+G+P TV                    + AL +K +EDKK
Sbjct: 144 GEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQKLREDKK 203

Query: 250 KFYIECAATNVNLKKFLQATSQQQRASAG------------NTGTTNSPANTQLXXXXXX 297
           KFYIECAATN NLK+FLQA++QQQRA++             N   T+SPA  Q       
Sbjct: 204 KFYIECAATNPNLKRFLQASTQQQRANSATSQNASPLPTNSNGNQTSSPAQQQAAVQVPP 263

Query: 298 XXXXXXXXXXXXXXXXXXXXXQSQRQQMQRPNSGANRYPAQVTPVNAAANQNNSGT--AR 355
                                       Q  ++ ++R P QVT VNAAA+  N+ T  AR
Sbjct: 264 PQNGTPG---------------------QTRSAASSRSPTQVTSVNAAAHLANNATSAAR 302

Query: 356 PVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDS 415
             IFKQPNPS+P+ E IT    T +  RSNRPTIT GSAMNA+ALT PVMTKLPPYEVD+
Sbjct: 303 RAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDN 362

Query: 416 ERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSD 475
           ERVMSKRKLRELVK                           FITNVTSFACRLAKHRKSD
Sbjct: 363 ERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSD 422

Query: 476 NLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISS 523
           NLDVRDIQLHLERNWNIRIPGYAADE+RST+KWNPT +Y+QKLQGI+S
Sbjct: 423 NLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINS 470

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  403 bits (1035), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/470 (50%), Positives = 287/470 (61%), Gaps = 20/470 (4%)

Query: 74  QLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQ--QAQQAFQ 131
           Q+T +S++QLA +F  L  EA ++GV T EG ELLK+A+ IKAIY+ Y++Q  QA QAF 
Sbjct: 24  QVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQAFG 83

Query: 132 VRNXXXXXXXXXXXXXXXXXXR------PTSSVASNIKMLLTPQQREAYEKLTQTFNESV 185
             N                  +        ++ +SNI+ LLTP+Q EAY KLT+TF +S 
Sbjct: 84  QTNNRPPAPAAGNPPQVAQNTQQRQNSNSANNPSSNIRTLLTPEQSEAYNKLTKTFGDSA 143

Query: 186 KNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALPKKFQ 245
           KNI GE E+L+KNIEVLDTEIKNR+ EP+ V                    FQALP+KF 
Sbjct: 144 KNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALPQKFH 203

Query: 246 EDKKKFYIECAATNVNLKKFLQATSQQQRASAG----------NTGTTNSPANTQLXXXX 295
           E KKKFYIECAA+N NLK+FLQA++QQQ+              NT       +  +    
Sbjct: 204 EAKKKFYIECAASNPNLKRFLQASTQQQQQQQQQQQQQQQQKVNTNQGQISVSPVVQQTS 263

Query: 296 XXXXXXXXXXXXXXXXXXXXXXXQSQRQQMQRPNSGANRYPAQVTPVNAAANQNNSGTA- 354
                                  Q Q++  Q  ++  +R P QVT VNAAA   N+ TA 
Sbjct: 264 SQPAAAASASMAATTPGASTPSQQQQKKPTQGNSTSTSRSPTQVTSVNAAALLANNNTAA 323

Query: 355 -RPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEV 413
            R  IFKQPNPS+P+ EN+TP   T+V+YRSNRPTIT GSAMNA+AL  PVMTKLPPYEV
Sbjct: 324 ARQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEV 383

Query: 414 DSERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRK 473
           DSERVMSKRKLRELVK                           FI+NVT FACRLAKHRK
Sbjct: 384 DSERVMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACRLAKHRK 443

Query: 474 SDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISS 523
           SDNLDVRDIQLHLERNWNIRIPGY+ADEIRST+KWN T  Y+QKLQGI++
Sbjct: 444 SDNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGINA 493

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  326 bits (836), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/467 (42%), Positives = 258/467 (55%), Gaps = 25/467 (5%)

Query: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQ--QAQQAF-QVRNXX 136
           + +L  KFR LV+EA+ VG  TP G ELL KAS IKAIY+ Y+RQ  QA QAF Q RN  
Sbjct: 27  LLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQRQQAAQAFVQGRNGG 86

Query: 137 XXXXXXXXXXXXXXXXRPTSS-----------------VASNIKMLLTPQQREAYEKLTQ 179
                              ++                 +A+ IK +LTP+Q + +E L+Q
Sbjct: 87  TPGANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQVLTPEQNQQFEALSQ 146

Query: 180 TFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQA 239
            F     +I  ++ FLK++IE L+ E+ ++Q +                       ++ A
Sbjct: 147 NFQARANSIRDKHTFLKQHIERLNQEV-SKQTDASAKKQLEEKKTELANNLKMLNMEYGA 205

Query: 240 LPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTG--TTNSPANTQLXXXXXX 297
           L ++FQ  KKKFY+ECA  N  L++ LQ ++QQQR +       +  SPA          
Sbjct: 206 LQQEFQNGKKKFYVECARHNPALQRLLQRSTQQQRMAQQQQVQPSEGSPAGEAGSPGAAG 265

Query: 298 XXXXXXXXXXXXXXXXXXXXXQSQRQQMQRPNSGANRYPAQVTPVNAAANQN-NSGTARP 356
                                   R Q    N+G+ R  +QVT VNAAA+   N+G  + 
Sbjct: 266 NSAKAQQGTPANITTQKLPQQNQVRSQSTSSNTGS-RAQSQVTNVNAAASMAYNNGANKS 324

Query: 357 VIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSE 416
            IFKQ +P +PI E +T  T + V+Y++NRPT+T G+AMNA+AL  P MTKLPPYEVD+E
Sbjct: 325 AIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTE 384

Query: 417 RVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDN 476
           RVMSKRKLRELVK                           F++NVT FACRLAKHRKSDN
Sbjct: 385 RVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDN 444

Query: 477 LDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISS 523
           LD RDIQLHLERNWNIRIPGY+ADEIRST+KWNP P+Y+QK+Q I+S
Sbjct: 445 LDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINS 491

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  295 bits (756), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 185/456 (40%), Positives = 255/456 (55%), Gaps = 36/456 (7%)

Query: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQAQQAFQVRNXXXXX 139
           + +L+ +F++LV EA++VG  TPEG EL+ +AS +KA+Y+ Y++Q+ Q+A          
Sbjct: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQK-QEAMAQAQARNNN 86

Query: 140 XXXXXX--------XXXXXXXRPTSSV--ASNIKMLLTPQQREAYEKLTQTFNESVKNIT 189
                                R  SS   A+ I+  LTP+Q + Y+KL Q F     NI 
Sbjct: 87  ANTANVNSSSSANSTEANTSGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRANNIK 146

Query: 190 GEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALPKKFQEDKK 249
            ++ FLK+NI+ L  EI+ +Q +                       ++  L +++   KK
Sbjct: 147 DKHTFLKQNIDRLVQEIE-KQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKK 205

Query: 250 KFYIECAATNVNLKKFLQATSQ--QQRASAGNTGTTNSPANTQLXXXXXXXXXXXXXXXX 307
            FYIECA  N +L++ LQ ++Q  QQ+A++ N      P  T+                 
Sbjct: 206 AFYIECAKKNPDLQRLLQKSTQRVQQQAASPN-AQQQPPVKTEAQPQPQPQQQA------ 258

Query: 308 XXXXXXXXXXXQSQRQQMQRPNSGAN--RYPAQVTPVNAAANQNNSGTARPVIFKQPNPS 365
                       +  Q     N  A+  R  +Q+T VNAAA+ ++S + + VIFKQ +P+
Sbjct: 259 ------------TPSQSSSNANLAASKPRSQSQITNVNAAASNSSS-SNKSVIFKQSDPA 305

Query: 366 IPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSERVMSKRKLR 425
           +PI E+I+  T   V YR NRPTI+ GSAMNA+AL  P+MTKLPPYE+D+ERVMSKRKLR
Sbjct: 306 VPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMSKRKLR 365

Query: 426 ELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLH 485
           ELVK                           F+TNVTSFAC+LAKHRKSDNL+ +DIQLH
Sbjct: 366 ELVKTIGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNLETKDIQLH 425

Query: 486 LERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGI 521
           LERNWNIRIPGY+ADEIRST+KWNPT +Y+QKLQ I
Sbjct: 426 LERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSI 461

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  293 bits (749), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 187/482 (38%), Positives = 243/482 (50%), Gaps = 42/482 (8%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY----HRQQAQQAF 130
           L P  ++++  KF  L++EA+ VG  TP G EL+ +A+ IK +Y+       RQQA QA+
Sbjct: 33  LQPRQLQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAY 92

Query: 131 QVRNXXXXXXXXXXXXXXXXXXRPTSS--------------------VASNIKMLLTPQQ 170
             RN                    TS+                     +S IK +LTP++
Sbjct: 93  --RNASMGNTNSNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNKFSSMIKQVLTPEE 150

Query: 171 REAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXX 230
            + YEKL Q F     +I  +  FLK+NI+ L+ EI N+Q E                  
Sbjct: 151 NQEYEKLWQNFQARHTSIKEKETFLKQNIDRLEQEI-NKQTEEGAKQQLQEKKNELLNDW 209

Query: 231 XXXXXQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRASAGNTGTTNSPANTQ 290
                ++  L   +Q  KK FY+ECA  N  L KFL      Q ++             Q
Sbjct: 210 KVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFL------QESTQQQRVQQQRVQQQQ 263

Query: 291 LXXXXXXXXXXXXXXXXXXXXXXXXXXXQSQRQQMQRPNS--GANRYP------AQVTPV 342
                                       Q Q+  +   N+  G    P      A+VT V
Sbjct: 264 HQGQTPTNTSTNSTEISSTTALDASKPQQQQQNTLPGTNTPRGNGNAPQTEQSKAKVTNV 323

Query: 343 NAAANQ-NNSGTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALT 401
           NA A+  NN  +++  IFKQ  P+IPI ENI+      V+YRSNRPTIT GSAMNASAL 
Sbjct: 324 NATASMMNNVSSSKSAIFKQTEPAIPISENISAKAPAPVAYRSNRPTITGGSAMNASALN 383

Query: 402 MPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNV 461
            P  TKLPPYE+D++RVMSKRKLRELVK                           F+TNV
Sbjct: 384 TPAATKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNV 443

Query: 462 TSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGI 521
           T+F+CRLAKHR+SDNL+ RDIQLHLERNWNIRIPGY+ADEIRST+KWNP+ +Y+QKLQ I
Sbjct: 444 TAFSCRLAKHRRSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQSI 503

Query: 522 SS 523
           +S
Sbjct: 504 TS 505

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  262 bits (670), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 127/188 (67%), Positives = 139/188 (73%)

Query: 336 PAQVTPVNAAANQNNSGTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAM 395
           P QVT VNAAANQ      RP IFKQPNPSIPI EN+T   T SVSYRSNRPTIT GS M
Sbjct: 313 PMQVTTVNAAANQTAQSNTRPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGM 372

Query: 396 NASALTMPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXX 455
           NA ALT PVMTKLPPYEVD+ERVMSKRKLRELVK                          
Sbjct: 373 NAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETTIDGDVEELLLDLAD 432

Query: 456 XFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYS 515
            FITNVT+FAC+LAKHRKSD+LDVRDIQ+HLERNWNIRIPG+A DEIRSTKKWNPTP+Y+
Sbjct: 433 DFITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYN 492

Query: 516 QKLQGISS 523
           Q +  I++
Sbjct: 493 QMVNAINN 500

 Score =  154 bits (389), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 122/205 (59%), Gaps = 13/205 (6%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQAQQAFQ--- 131
           LTP+SM+QLA + ++LV+EA+++GV T EG ELL++A+ IKA+YE Y +Q+ QQA     
Sbjct: 13  LTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQAQAG 72

Query: 132 ----VRNXXXXXXXXXXXXXXXXXXRPTSSVAS------NIKMLLTPQQREAYEKLTQTF 181
               V N                  +   + AS      NIK+LLTPQQREAY +L Q +
Sbjct: 73  AQGAVNNNATNVKSMDQQQQQQQQQQQQQATASSNNVTNNIKVLLTPQQREAYNRLVQKY 132

Query: 182 NESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALP 241
            +  +NI GE+ FLK+NI VLD EI+NR+G  ++V                   Q+  L 
Sbjct: 133 EDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQ 192

Query: 242 KKFQEDKKKFYIECAATNVNLKKFL 266
           +K+QED++KFYIEC+ TN +L+++L
Sbjct: 193 QKYQEDRRKFYIECSQTNADLRRYL 217

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  241 bits (614), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 162/462 (35%), Positives = 224/462 (48%), Gaps = 27/462 (5%)

Query: 82  QLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQAQQAFQVRNXXXXXXX 141
           +LA +F+  V EA++VG  T  G +LL +A+ IKA+Y++     A  A Q +        
Sbjct: 32  ELAQRFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYDSVRGASAGAAAQSQQRTADGAT 91

Query: 142 XXXXXXXXXXXRPTSS-------VASNIKMLLTPQQREAYEKLTQTFNESVKNITGEYEF 194
                          +       +A  ++  LTP+Q + Y+K+   F    K+I  ++ +
Sbjct: 92  GNVATAPAAAGGGGGAGNTAATQLAMAMRQALTPEQVQQYDKIATNFQNKAKSIRDKHNY 151

Query: 195 LKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALPKKFQEDKKKFYIE 254
           LK+NI+ L  EI N+Q +                       +  +L   FQ  +K FY+E
Sbjct: 152 LKQNIDKLTAEI-NKQQDRSAKQQLAEKRNELLRSVRQLTVEHNSLKVNFQLSRKNFYVE 210

Query: 255 CAATNVNLKKFLQATSQQQRASAGNTGTTNSPANTQLXXXXXXXXXXXXXXXXXXXXXXX 314
           CA  N  L++ LQ T+QQ ++S        + A  Q                        
Sbjct: 211 CAKLNPKLQQILQRTAQQAQSSQQAQVQAQAQAQAQSQSPAAQSQSQSQPPVVPQQAQTP 270

Query: 315 XXXXQSQRQ--QMQRPN------------SGANRYPAQVTPVNAAANQNNSGTARPVIFK 360
               QSQ Q  Q Q P             S    +P   TP   A +      A+  IFK
Sbjct: 271 VPQSQSQTQLPQSQPPQRTQSNSNSSGNNSNVTGHPPSATPTVPANH-----PAKHKIFK 325

Query: 361 QPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSERVMS 420
           +  PS+PIPE+I  +    V+Y+ NRPTIT GS MNA AL  PV  K+P YE D++RV+S
Sbjct: 326 ESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEADTDRVLS 385

Query: 421 KRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVR 480
           KRKLRELV+                           F+++VT+FACRLAKHR SD+L+ R
Sbjct: 386 KRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGSDSLEAR 445

Query: 481 DIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGIS 522
           D+QLHLERNWNIR+PGYA DEIRST+KWN T AY QKL  I+
Sbjct: 446 DVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIA 487

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  236 bits (602), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 116/188 (61%), Positives = 136/188 (72%), Gaps = 1/188 (0%)

Query: 337 AQVTPVNAAANQ-NNSGTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAM 395
           A+VT VNA A+  NN  +++  IFKQ  P+IPI ENI+  T   V+YRSNRPTIT GSAM
Sbjct: 332 AKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAM 391

Query: 396 NASALTMPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXX 455
           NASAL  P  TKLPPYE+D++RVMSKRKLRELVK                          
Sbjct: 392 NASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLAD 451

Query: 456 XFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYS 515
            F+TNVT+F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADEIRST+KWNP+  Y+
Sbjct: 452 DFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYN 511

Query: 516 QKLQGISS 523
           QKLQ I+S
Sbjct: 512 QKLQSITS 519

 Score = 89.4 bits (220), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 100/212 (47%), Gaps = 17/212 (8%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY----HRQQAQQAF 130
           L P  ++++A KFRTL++EA+ VG  TP G EL+ +A+ IK +Y+       RQQA QA+
Sbjct: 33  LQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQQAAQAY 92

Query: 131 QVRNXXXXX-----------XXXXXXXXXXXXXRPTSSVASN-IKMLLTPQQREAYEKLT 178
              +                             R  S+  SN IK +LTP++ + YEKL 
Sbjct: 93  NNTSNSNSSNPASIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVLTPEENQEYEKLW 152

Query: 179 QTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQ 238
           Q F     +I  +  +LK+NI+ L+ EI N+Q +                       ++ 
Sbjct: 153 QNFQVRHTSIKEKETYLKQNIDRLEQEI-NKQTDEGPKQQLQEKKIELLNDWKVLKIEYT 211

Query: 239 ALPKKFQEDKKKFYIECAATNVNLKKFLQATS 270
            L   +Q  KK FY+ECA  N  L KFLQ ++
Sbjct: 212 KLFNNYQNSKKTFYVECARHNPALHKFLQEST 243

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  234 bits (596), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 146/385 (37%), Positives = 202/385 (52%), Gaps = 32/385 (8%)

Query: 158 VASNIKMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVX 217
           +A+ IK +LT +Q + Y+ L + F     +I  ++ FLK+NI+ L  EI N         
Sbjct: 148 IANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVNV 207

Query: 218 XXXXXXXXXX--XXXXXXXXQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATSQQQRA 275
                               +F  + ++F+ DKK FY+ECA  N  L+K LQ ++QQ + 
Sbjct: 208 KKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLLQKSTQQAQQ 267

Query: 276 SAGNTGTTNSPANTQLXXXXXXXXXXXXXXXXXXXXXXXXXXXQSQRQQMQRPNSGANRY 335
           +  + G                                     + Q Q  Q  N+ +N  
Sbjct: 268 AQQSQGQP-------------SQQTTPQQIPQQAQQSQNAQTQEPQVQTPQSKNANSNNQ 314

Query: 336 PAQVTPVNAA----------ANQNNSGTA-------RPVIFKQPNPSIPIPENITPLTTT 378
           P  V   N A           N N + +A       + VIFKQ +P++PI +N+T   T 
Sbjct: 315 PNLVPGANPADTTNPDRLPITNVNAAASANVKNNQAKSVIFKQSDPTVPISDNVTLEPTE 374

Query: 379 SVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXX 438
            + Y+SNRP++T G+AM+A+AL +P +T LPPYE+D+ERVM+KRKLREL+K         
Sbjct: 375 LIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEIDTERVMAKRKLRELIKNVGIDEGDG 434

Query: 439 XXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYA 498
                             F+TNVTSFACRLAKHRKS+NL+ RDIQLHLERNWNIRIPGY+
Sbjct: 435 ETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSENLESRDIQLHLERNWNIRIPGYS 494

Query: 499 ADEIRSTKKWNPTPAYSQKLQGISS 523
            DEIRST+KW PT A+SQKLQ I++
Sbjct: 495 GDEIRSTRKWLPTQAFSQKLQSINN 519

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%)

Query: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHR 123
           + +L  KF+ LV+EA+ VG  TP G ELL +AS +KAIYE + +
Sbjct: 30  LIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENFTK 73

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  231 bits (590), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 136/196 (69%), Gaps = 1/196 (0%)

Query: 327 RPNSGANRYPAQVTPVNAAANQNNSGT-ARPVIFKQPNPSIPIPENITPLTTTSVSYRSN 385
           +PNS  +   +QVT VNA A+  N    ++  IFKQ +PS+PI E+IT     +VSY SN
Sbjct: 365 QPNSATSANRSQVTNVNATASSANKNIQSKSAIFKQSDPSVPISESITVKAPEAVSYISN 424

Query: 386 RPTITSGSAMNASALTMPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXXX 445
           RP++T G+AMNAS L  P +TKLPPYE+D+ERVMSKRKLREL+K                
Sbjct: 425 RPSLTGGTAMNASVLNTPTITKLPPYEIDTERVMSKRKLRELIKSVGIDEGDGETVIDGD 484

Query: 446 XXXXXXXXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRST 505
                      F+TNVTSFACRLAKHRKSD+L+ RDIQLHLERNWNIRIPGY+ DEIRST
Sbjct: 485 VEELLLDLADDFVTNVTSFACRLAKHRKSDSLEARDIQLHLERNWNIRIPGYSGDEIRST 544

Query: 506 KKWNPTPAYSQKLQGI 521
           +KW PT +YSQK+Q I
Sbjct: 545 RKWIPTQSYSQKMQSI 560

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 90/208 (43%), Gaps = 27/208 (12%)

Query: 86  KFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQ------------------AQ 127
           KF+ LV+EA++VG  T  G ELL +ASN+KA+Y+ Y++Q+                  A 
Sbjct: 33  KFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALINQQQQQQAGSSQTPAG 92

Query: 128 QAFQVRNXXXXXXXXXXXXXXXXXXRPT--------SSVASNIKMLLTPQQREAYEKLTQ 179
                                    R T        S +A  IK +LTP++ + Y+KL Q
Sbjct: 93  TTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKLLQ 152

Query: 180 TFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQA 239
            F     +I  ++ FLK++I+ L  EI N+Q +                       ++  
Sbjct: 153 NFQSRASSIKDQHTFLKQHIDRLSQEI-NQQTDEAAKKQLEVNRAELLTNLRTLNTEYSN 211

Query: 240 LPKKFQEDKKKFYIECAATNVNLKKFLQ 267
           L +  +  KK FY+ECA  N  L++ LQ
Sbjct: 212 LYEDIKNKKKAFYVECARQNPELQRLLQ 239

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  219 bits (559), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 120/166 (72%)

Query: 358 IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSER 417
           IFKQ +P +P+ + I+     +V YRSNRPT+T GSAM+ASAL  PVMTKLPPYE+D+ER
Sbjct: 335 IFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSAMSASALNTPVMTKLPPYELDTER 394

Query: 418 VMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNL 477
           VMSKRKLRELVK                           FITNVTSFACRLAKHRKSDNL
Sbjct: 395 VMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMADDFITNVTSFACRLAKHRKSDNL 454

Query: 478 DVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISS 523
           + RDIQLHLERNW+IRIPGY+ADEIRS +KWNP   Y+QKLQ I++
Sbjct: 455 EARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTYNQKLQQINN 500

 Score = 85.5 bits (210), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 103/214 (48%), Gaps = 19/214 (8%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQAQQAFQ--- 131
           L P+ +R+L  KF+ LV+EA++VG  T  G ELL +AS +KA+Y+ Y+RQ+ QQ  Q   
Sbjct: 21  LQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQRQQQLQQQQA 80

Query: 132 --------------VRNXXXXXXXXXXXXXXXXXXRPTSSVASNIKMLLTPQQREAYEKL 177
                           N                    ++ +A+ ++ +LT +Q   ++KL
Sbjct: 81  VNNKVQNPSNNDNVTTNNSFASPSSPPTSGSTISNSSSTQLANIMRQVLTDEQNANFDKL 140

Query: 178 TQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXX-XXXXXXXXXXXQ 236
            QTF      +  ++ FLK+NIE L  EI N+Q + +                      +
Sbjct: 141 DQTFRSRASALKDKHTFLKQNIERLTQEI-NKQADNVNARKQLEEKRGELLRNLKAITME 199

Query: 237 FQALPKKFQEDKKKFYIECAATNVNLKKFLQATS 270
              L +K+Q  KK FYIECA TN +L+K LQ ++
Sbjct: 200 HNTLYQKYQNGKKAFYIECAKTNPDLQKLLQKST 233

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  211 bits (538), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 128/197 (64%), Gaps = 14/197 (7%)

Query: 358 IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSER 417
           IFK  +P++PI + ++      +++RSNRPTI+ GSAMNA+AL  PVMT LPPYE+D++R
Sbjct: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445

Query: 418 VMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTSFACRLAKHRKSDNL 477
           VMSKRKLRELVK                           F+TNVT FACRLAKHRKSDNL
Sbjct: 446 VMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNL 505

Query: 478 DVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSXXXXXXXXXXXXNV 537
           +  DIQLHLERNWNIRIPGY+ADEIRS  KWN +PAY+QKL  I++             +
Sbjct: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQA---------I 556

Query: 538 TTGSANAAAVATESNKK 554
           +T SANA      SNKK
Sbjct: 557 STASANAV-----SNKK 568

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 158 VASNIKMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVX 217
           +A+ IK +LTP+Q + YE+L Q F      I  ++ F+K+NI+ L  EI N+Q +     
Sbjct: 133 LANIIKQVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEI-NKQTDEEAKK 191

Query: 218 XXXXXXXXXXXXXXXXXXQFQALPKKFQEDKKKFYIECAATNVNLKKFLQ 267
                             + QAL ++ Q  KK FY+ECA  N  L++ LQ
Sbjct: 192 QLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPALQRLLQ 241

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  207 bits (526), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 129/186 (69%), Gaps = 1/186 (0%)

Query: 339 VTPVNAAANQNN-SGTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNA 397
           VT VNAAA+ ++   + + ++FK   P + I + I+     SV YRSNRP++T GSAMNA
Sbjct: 419 VTNVNAAASASSVHPSNKSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNA 478

Query: 398 SALTMPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXXXXXXXF 457
           SALT PV TKLPPYE+D+ERVMSKRKLRELVK                           F
Sbjct: 479 SALTTPVATKLPPYEIDTERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDF 538

Query: 458 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQK 517
           +TNVTSFACRLAKHR SD+L+ RDIQLHLE+NWNIRIPGY+ADEIRS +KW+P   Y+QK
Sbjct: 539 VTNVTSFACRLAKHRNSDSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQK 598

Query: 518 LQGISS 523
           LQ I++
Sbjct: 599 LQHINN 604

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 95/239 (39%), Gaps = 48/239 (20%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPE-GLELLKKASNIKAIYETYHRQQAQQAFQVR 133
           L P+ + +L+ KF+ LV+EA+Q+G    + G ELL +AS IKAIY+TY+RQ+   A    
Sbjct: 36  LQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYNRQRQAAAAAAA 95

Query: 134 NXXXXXXXXXXXXXXXXXXRPTSSVASN-------------------------------- 161
                               PTS+  +N                                
Sbjct: 96  AQARVQAQVQVQSSDVNKELPTSTANNNNIGATPSANTPTPNSIPISNSNTPSSLNANNG 155

Query: 162 -----------IKMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQ 210
                      +K +LTP+Q + Y+KL  TF      I  ++ F+K+NIE L  E+    
Sbjct: 156 NRLSSNQLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPN 215

Query: 211 GEPMTVXXXXXXXXXXXXXXXXXXXQFQALPKKFQEDKKKFYIECAATNVNL----KKF 265
            +P                      +   L ++FQ  +K FY+ECA  N  L    KKF
Sbjct: 216 LDPNLKTQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQNCYKKF 274

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  201 bits (512), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 130/191 (68%), Gaps = 1/191 (0%)

Query: 333 NRYPAQVTPVNAAANQNNSGTARPV-IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITS 391
           NR  + +T VNAAA+ ++    + + IFKQ  P +PI E++T     ++ YR+NRPT+T 
Sbjct: 540 NRQQSAITNVNAAASTSSKSLTKTMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTG 599

Query: 392 GSAMNASALTMPVMTKLPPYEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXXXXXXXXX 451
           G+AMN S L  PV+TKLPPYE+D++RVM KRKL+E+V+                      
Sbjct: 600 GTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEVVRSVGVDDGDGETVIGGDVEEALL 659

Query: 452 XXXXXFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPT 511
                F+T+VT+FAC++AKHRKSD+LDV DIQLHLE+NWNIRIP Y+ D IRS++KWNPT
Sbjct: 660 DLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPT 719

Query: 512 PAYSQKLQGIS 522
            +Y+QKL  ++
Sbjct: 720 ASYNQKLNSLN 730

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 54/114 (47%)

Query: 158 VASNIKMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVX 217
           +A+ IK LLTP+Q + Y++L   F     NI  +++FLK++I     E+       +   
Sbjct: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289

Query: 218 XXXXXXXXXXXXXXXXXXQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATSQ 271
                             Q+  L ++FQ  KK FYI CA  N NL++ LQ TS 
Sbjct: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 10/68 (14%)

Query: 74  QLTP--SSMRQ------LAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYH--R 123
           QLTP  S+M Q      L  KF+ LV+EA++VG  T  G ELL +A  IK IY+ ++  R
Sbjct: 47  QLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQR 106

Query: 124 QQAQQAFQ 131
           QQA QA++
Sbjct: 107 QQAIQAYK 114

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  114 bits (284), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (62%), Gaps = 1/113 (0%)

Query: 411 YEVDSERVMSKRKLRELVKXXXXXXXXXXXXXXX-XXXXXXXXXXXXFITNVTSFACRLA 469
           YE++SERV+SKRKLRELV+                            F++N+TSF+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 470 KHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGIS 522
           +HR S+ ++ RDIQLH+ERNWNIR+PG+ ADEI+S KKW  +  Y   L  ++
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVN 386

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 25/208 (12%)

Query: 80  MRQLAYKFRTLVSEAQQVGVRTPE-GLELLKKASNIKAIYETYHRQQAQQA--------- 129
           + +LA  F+ L+ +A+  G  T E G ELL KA+ +K ++     +    +         
Sbjct: 15  LNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLSNKYKNDSSSNDSTLSR 74

Query: 130 ----FQVRNXXXXXXXXXXXXXXXXXXRPTSSVASNIKMLLTPQQREAYEKLTQTFNESV 185
                 ++N                  R  S+++  IK  LTP+Q E+YE L + F    
Sbjct: 75  SNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSNLSMMIKNALTPEQNESYETLLKDFQIRA 134

Query: 186 KNITGEYEFLKKNIE----VLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALP 241
             I  E+  +K+ I+    +L+++  N+  E +T                     +  L 
Sbjct: 135 AKIKREHSDVKEKIDNISKLLNSKTNNQ--EALTA-----KRNEYLFQLKKLSKDYTELH 187

Query: 242 KKFQEDKKKFYIECAATNVNLKKFLQAT 269
           ++FQ +KK FY++ A  N  L+K LQ +
Sbjct: 188 QQFQNEKKNFYLKSAKQNSELQKVLQES 215

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score = 88.6 bits (218), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 101/207 (48%), Gaps = 17/207 (8%)

Query: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYH--RQQAQQAFQ---VRN 134
           + ++  KF+ LVSEA+ VG  TP G EL+ +A+ IK++Y+ ++  RQQA QA++   V N
Sbjct: 38  LLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRRQQAAQAYKNASVGN 97

Query: 135 XX----------XXXXXXXXXXXXXXXXRPTSSVASN-IKMLLTPQQREAYEKLTQTFNE 183
                                       R  S+  SN IK +LT ++ + YEKL Q F  
Sbjct: 98  TTPNAGNPVSLPTEKPPSLSQQQQQQQARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQV 157

Query: 184 SVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQFQALPKK 243
              ++  +  FLK+NI+ L  E+ N+Q +  T                    ++  L K 
Sbjct: 158 RATSMKEKDTFLKQNIDRLVQEV-NKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKG 216

Query: 244 FQEDKKKFYIECAATNVNLKKFLQATS 270
           FQ  KK FY+ECA  N  L+KFLQ ++
Sbjct: 217 FQNSKKTFYVECARHNPALQKFLQEST 243

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score = 86.3 bits (212), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 97/217 (44%), Gaps = 22/217 (10%)

Query: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY----HRQQAQQAF 130
           L P  ++++  KFR L+ EA+ VG  TP G EL+ +A+ IK +Y+       RQQA QA+
Sbjct: 33  LQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAY 92

Query: 131 QVRNXXXXXXXXXXXXXXXXXXRPTSS-----------------VASNIKMLLTPQQREA 173
           +  +                   P  S                  ++ IK +LTP++ + 
Sbjct: 93  KNASMGNANPNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSNKFSNMIKQVLTPEENQE 152

Query: 174 YEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXX 233
           YEKL Q F     +I     FLK+N++ L+ EI N+Q +  T                  
Sbjct: 153 YEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEI-NKQTDEGTKQQLEEKKNELLNDWKVL 211

Query: 234 XXQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATS 270
             ++  L   +Q  KK FY+ECA  N  L KFLQ ++
Sbjct: 212 KIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQEST 248

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 98/213 (46%), Gaps = 23/213 (10%)

Query: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY---HRQQAQQAFQVRNXX 136
           + +L  KF+ LV+E++ VG  T  G ELL +AS IKA+Y  Y    +Q AQ   Q RN  
Sbjct: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQAYEQARNGA 98

Query: 137 XXXXXXXXXXXXXXXXRPTSS-------------------VASNIKMLLTPQQREAYEKL 177
                            P  S                   +A+ IK +LTP+Q + Y+ L
Sbjct: 99  AAGGSTPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTPEQNQQYDNL 158

Query: 178 TQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVXXXXXXXXXXXXXXXXXXXQF 237
            QTF     NI  ++ FL++++E L+ EI N++ EP                      ++
Sbjct: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEI-NKKTEPAAKKQLEDKKMELLTNLKSLNMEY 217

Query: 238 QALPKKFQEDKKKFYIECAATNVNLKKFLQATS 270
             L ++F   KKKFY+ECA  N  L++ LQ ++
Sbjct: 218 SVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250

>Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {ON}
           YKL192C (ACP1) - mitochondrial acyl carrier protein
           [contig 212] FULL
          Length = 123

 Score = 32.0 bits (71), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 458 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKK 507
           ITN T FA    K    D+LD  ++ + +E  ++I IP   ADEI+S K+
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKSVKE 111

>TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4.297
           YKL192C
          Length = 143

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 458 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRS 504
           +TN T FA    K    D+LD  ++ + +E  ++I IP   AD+++S
Sbjct: 86  VTNETQFA----KDLSLDSLDTVELLVAIEEEFDIEIPDNVADDLKS 128

>KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} similar
           to uniprot|P32463 Saccharomyces cerevisiae YKL192C ACP1
           Mitochondrial matrix acyl carrier protein involved in
           biosynthesis of octanoate which is a precursor to lipoic
           acid activated by phosphopantetheinylation catalyzed by
           Ppt2p
          Length = 123

 Score = 30.8 bits (68), Expect = 3.7,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 458 ITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRS 504
           ITN T FA    K    D+LD  ++ + +E  ++I IP   ADEI+S
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKS 108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.124    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,242,123
Number of extensions: 1499741
Number of successful extensions: 5085
Number of sequences better than 10.0: 37
Number of HSP's gapped: 5206
Number of HSP's successfully gapped: 60
Length of query: 554
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 439
Effective length of database: 40,294,809
Effective search space: 17689421151
Effective search space used: 17689421151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)