Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGL194C8.322ON25625612771e-180
Ecym_42538.322ON2582577237e-96
SAKL0H15576g8.322ON2822545591e-70
KLLA0D16346g8.322ON3012545452e-68
Kwal_56.239148.322ON2652485171e-64
YLR128W (DCN1)8.322ON2692584798e-59
TDEL0F044808.322ON2602554735e-58
KLTH0G12320g8.322ON2542374641e-56
ZYRO0F10362g8.322ON2512334595e-56
TPHA0C008208.322ON2662634484e-54
Kpol_1036.688.322ON2562554405e-53
NDAI0G025908.322ON2862794271e-50
KNAG0G024408.322ON2652384136e-49
TBLA0A039308.322ON2662614041e-47
KAFR0H022708.322ON2682654042e-47
Skud_12.1978.322ON1791793875e-46
Suva_10.2218.322ON1781773701e-43
NCAS0C032708.322ON1841843623e-42
CAGL0M04257g8.322ON2732483642e-41
Smik_12.1918.322ON1251262321e-23
CAGL0B02189g5.111ON108793711.7
CAGL0H01287g5.307ON132482675.9
Kwal_56.234108.223ON82533658.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL194C
         (256 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   496   e-180
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   283   7e-96
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   219   1e-70
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   214   2e-68
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   203   1e-64
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   189   8e-59
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   186   5e-58
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   183   1e-56
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   181   5e-56
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   177   4e-54
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   174   5e-53
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   169   1e-50
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   163   6e-49
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   160   1e-47
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   160   2e-47
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   153   5e-46
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   147   1e-43
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   144   3e-42
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   144   2e-41
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...    94   1e-23
CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa] ...    32   1.7  
CAGL0H01287g Chr8 complement(123328..127302) [3975 bp, 1324 aa] ...    30   5.9  
Kwal_56.23410 s56 (524742..527219) [2478 bp, 825 aa] {ON} YDR089...    30   8.9  

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  496 bits (1277), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 246/256 (96%), Positives = 246/256 (96%)

Query: 1   MQSNARQRELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGGGRAEQYSAEL 60
           MQSNARQRELIREFL          ETYLERNHWSLDHALDDFYTQSGGGGRAEQYSAEL
Sbjct: 1   MQSNARQRELIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGGGRAEQYSAEL 60

Query: 61  VATFERYAAGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWH 120
           VATFERYAAGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWH
Sbjct: 61  VATFERYAAGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWH 120

Query: 121 GLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFF 180
           GLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFF
Sbjct: 121 GLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFF 180

Query: 181 LDHTYAVTVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWP 240
           LDHTYAVTVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWP
Sbjct: 181 LDHTYAVTVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWP 240

Query: 241 LVIDEYYEWVKGRNQL 256
           LVIDEYYEWVKGRNQL
Sbjct: 241 LVIDEYYEWVKGRNQL 256

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  283 bits (723), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 133/257 (51%), Positives = 179/257 (69%), Gaps = 4/257 (1%)

Query: 1   MQSNARQRELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGGGRAEQ-YSAE 59
           MQSNARQR+ I++F+          E +L  N WSLD+ALDD YT+       E+ Y AE
Sbjct: 1   MQSNARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAE 60

Query: 60  LVATFERYAA-GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLST 118
           L +TF+ YA+  G MDT+ L++YV DLG+QLED  T+CLA+LLKVE LTADI   QFLST
Sbjct: 61  LYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLST 120

Query: 119 WHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSL 178
           W  LGCS+L DM   ++ L+ +L  D  YF+ +Y+YTF + +D   R+LS++TAI+YW+L
Sbjct: 121 WADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTL 180

Query: 179 FFLDHTYAVTVPAPRLRSWFEFLRAGDHS--VSRDTWDMFPRFAQRFPDDTELLEHYNEL 236
            FLDH++A  +P  RL SWF FLR  + +  V+RDTWDM  +FA +FPDD  LL  Y+E+
Sbjct: 181 LFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240

Query: 237 ASWPLVIDEYYEWVKGR 253
            +WPL++DEYY W+K R
Sbjct: 241 GAWPLIMDEYYGWIKER 257

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  219 bits (559), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 160/254 (62%), Gaps = 6/254 (2%)

Query: 3   SNARQRELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGG---GRAEQYSAE 59
           S A+ +E I EF+            YL RN W+L +AL+++Y +  GG    +  +YS E
Sbjct: 22  SMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHE 81

Query: 60  LVATFERYA-AGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLST 118
           LV TF++YA +   +  E L++Y+ DLG+ LED+AT+CLA LLK E++  DI+  QFLS+
Sbjct: 82  LVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSS 141

Query: 119 WHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSL 178
           W   GC ++  M+  +  LE +L  D  YF  +Y YT+ L ++   R L+++TA  YW L
Sbjct: 142 WTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDTAAEYWEL 201

Query: 179 FFLDHTYAVTVPAPRLRSWFEFL--RAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNEL 236
           FF +  YAVT+   RL++W EF   ++G  +V++DTW MF +F  +FPDD  L+  Y+E+
Sbjct: 202 FFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEM 261

Query: 237 ASWPLVIDEYYEWV 250
            +WPLV DEYYE++
Sbjct: 262 DAWPLVFDEYYEYM 275

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  214 bits (545), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 160/254 (62%), Gaps = 9/254 (3%)

Query: 12  REFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGG-GGRAEQYSAELVATFERYAAG 70
           +EF+          + YL +N   +++AL+D+Y      GG  + Y+  LVA FE+Y+ G
Sbjct: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNG 107

Query: 71  GAM---DTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSL 127
            +    D+  L+R++ DLG  +ED  TLCL+++L +++LT  +SR QFL+ W  L C +L
Sbjct: 108 VSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTL 167

Query: 128 PDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDHTYAV 187
             M+A +  LE RL TD  YF+++Y+YTF L  D G R L  + AI YW++FF D+ YA+
Sbjct: 168 RKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYAL 227

Query: 188 TVPAPRLRSWFEFLRAGD-----HSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLV 242
            +   RL SW EF+ + D      ++S D W MF +F +++P+D  L ++Y+E+A+WPL+
Sbjct: 228 KISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLL 287

Query: 243 IDEYYEWVKGRNQL 256
           IDEYYE+++  ++L
Sbjct: 288 IDEYYEFLEENDKL 301

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  203 bits (517), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 146/248 (58%), Gaps = 5/248 (2%)

Query: 11  IREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGGGRAEQ--YSAELVATFERYA 68
           + EF+          + +L  N+W+LD+AL+D+Y    GG   +   YS EL+  F++Y 
Sbjct: 15  VEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQKYK 74

Query: 69  A--GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSS 126
           +    ++    L R++ DLG +LED  TLCLA L++   L  DIS   F+ +WH   C +
Sbjct: 75  SEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLCEN 134

Query: 127 LPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLD-HTY 185
             DM+  V  LE +LRTD +YF ++Y YTF L L+   ++L +ET+IAYW L F     Y
Sbjct: 135 FNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAKPY 194

Query: 186 AVTVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDE 245
           A+ VP  RL+SW ++L      V RD W MF +FA  FPD+  L + Y+E  +WPLVIDE
Sbjct: 195 AIKVPQERLQSWIQYLSGEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDE 254

Query: 246 YYEWVKGR 253
           YYE++  R
Sbjct: 255 YYEYLVAR 262

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  189 bits (479), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 142/258 (55%), Gaps = 10/258 (3%)

Query: 5   ARQRELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGG--------GRAEQY 56
           + ++E I  F             YL+RNHW++++AL+D+Y +  G              Y
Sbjct: 12  SPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVY 71

Query: 57  SAELVATFERYAAGGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFL 116
             EL   FE Y      D ++LV+++ +LG+ LED+ATLCLA LL  ++L   + R  FL
Sbjct: 72  PKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFL 131

Query: 117 STWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYW 176
           STW   GCS++ DM+  +  L+++L  D  YF  +Y Y F L LD   + +  +  I YW
Sbjct: 132 STWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYW 191

Query: 177 SLFFLDHTYAVTVPAPRLRSWFEFLR-AGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNE 235
            LFF    Y V +    L +WF FLR  G  ++S+DTW M   F +R+P   +++  Y+E
Sbjct: 192 KLFF-QPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDE 250

Query: 236 LASWPLVIDEYYEWVKGR 253
            A+WP +IDE+YE ++ +
Sbjct: 251 TAAWPFIIDEFYECLQDQ 268

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  186 bits (473), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 144/255 (56%), Gaps = 9/255 (3%)

Query: 5   ARQRELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGGGRAEQ-----YSAE 59
            ++ +L+ EF+          + +L RN W L++AL+D+Y Q  GG   E      Y  E
Sbjct: 2   PQKDDLVSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFIEEPHTPVTYPEE 61

Query: 60  LVATFERYAA--GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLS 117
           L+A +++Y       +D + +++ + DL ++LED+ T+CLA+LL    L   IS+ QFL 
Sbjct: 62  LLALYDKYVLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFLH 121

Query: 118 TWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWS 177
            W+  GCS+LP MR  +D L+ +L TD  Y   +Y YTF L LD   R L  +TA  YW 
Sbjct: 122 NWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTDTAAEYWR 181

Query: 178 LFFLDHTYAVTVPAPRLRSWFEFLRAGDHS-VSRDTWDMFPRFAQRFPDDTELLEHYNEL 236
           LFF   T AV V    L SW  FL +   + V+RDTW M   F ++FP  + +   YNE 
Sbjct: 182 LFFQPGT-AVHVNPALLNSWLAFLDSEQKTVVTRDTWKMLLEFFKQFPSLSAVKTSYNEA 240

Query: 237 ASWPLVIDEYYEWVK 251
            +WP +IDEYYE+++
Sbjct: 241 DAWPYIIDEYYEYLE 255

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  183 bits (464), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 89/237 (37%), Positives = 133/237 (56%), Gaps = 3/237 (1%)

Query: 11  IREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGGGRAEQYSAELVATFERYAAG 70
           I EF+            YL  N+W+L++AL+DFY    GG  +     +L+  F  Y  G
Sbjct: 6   IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQLLTLFNEYKKG 65

Query: 71  --GAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLP 128
               + T+ L+R++GDLG  LED  TLC+A  +    L+  +S+  F+  WH   C +L 
Sbjct: 66  EEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENLQ 125

Query: 129 DMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFF-LDHTYAV 187
            ++  V  L+ +LR D+AYF  +Y++T+ L L+   ++L +ETAIAYW L F  D  YA+
Sbjct: 126 QIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYAI 185

Query: 188 TVPAPRLRSWFEFLRAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVID 244
            +P  RL SW  FL      +  D W MF +FA+ FPD+  L + YNE  +WP++ID
Sbjct: 186 QIPQKRLCSWTAFLTRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  181 bits (459), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 137/233 (58%), Gaps = 7/233 (3%)

Query: 28  YLERNHWSLDHALDDFYTQSGGGGRAEQYSAELVATFERYAA----GGAMDTEALVRYVG 83
           YL  ++W ++ AL+D+Y       + + YS EL   F +YA     G  MDT+ L+RY+G
Sbjct: 22  YLNTHNWDVNQALNDYY--DSEHDQDQSYSPELPQLFRKYAVVTPHGFIMDTDGLIRYIG 79

Query: 84  DLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLPDMRAAVDALELRLRT 143
           DLG++++++AT+CLA+LL  + LT  I+  QF   W   GC+SL  M   V  L+ +LRT
Sbjct: 80  DLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNGCTSLHQMGKLVQRLDHKLRT 139

Query: 144 DAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDHTYAVTVPAPRLRSWFEFLRA 203
           D  Y   +Y YTF L LD G + L   TA+ YW+LFF    Y V V     + W  F++ 
Sbjct: 140 DQDYTAQIYNYTFELALDPGAKTLETHTAVQYWTLFFATGQYPVIVEQQFFQLWISFVQQ 199

Query: 204 GDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVKGRNQL 256
            + S+SRDTW M   F  RF +   + ++YNE  +WP +IDE+YE++  + ++
Sbjct: 200 -EQSISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYIIDEFYEYLADKGEI 251

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  177 bits (448), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 149/263 (56%), Gaps = 17/263 (6%)

Query: 10  LIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGG---GRAEQYSAELVATFER 66
           ++REF             YL  N W+L++AL++FY Q  GG       +Y AEL+  FER
Sbjct: 4   IVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFER 63

Query: 67  Y--------AAGG----AMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQ 114
           Y        ++G      +D + L++++ DLG++LED+ TLCLA ++    LT  I+R Q
Sbjct: 64  YNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ 123

Query: 115 FLSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIA 174
           FL  W+   CS++ D++  ++ +   LR+D  YF  +Y Y+FGL  +   + + ++TA  
Sbjct: 124 FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKE 183

Query: 175 YWSLFFLDHTYAVTVPAPRLRSWFEFLR-AGDHSVSRDTWDMFPRFAQRFPDDTELLEHY 233
           YW LFF D T  + +   +L +W +FL  +G  ++++D W M   F ++FP  TE  + Y
Sbjct: 184 YWKLFFGDGT-PLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEY 242

Query: 234 NELASWPLVIDEYYEWVKGRNQL 256
           + +  WP ++DEY+E+++   +L
Sbjct: 243 DPMDPWPYIMDEYHEYLEENGKL 265

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  174 bits (440), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 84/255 (32%), Positives = 149/255 (58%), Gaps = 8/255 (3%)

Query: 9   ELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGG----GRAEQYSAELVATF 64
           ++  EF+            YL+RN+W+L++AL+++Y +  G         +Y  EL+  F
Sbjct: 3   DITEEFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVIEYPEELIQIF 62

Query: 65  ERYAA--GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGL 122
           ++Y+   G ++DT+  ++ + DL +QLED+ T+CLA L+  + L+  I++ QFLSTW+  
Sbjct: 63  KKYSNDNGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQ 122

Query: 123 GCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLD 182
           GCS L  M+  +D L+ +L+ D  Y+  +Y Y+F L  D+  + +  + AI YW LFF  
Sbjct: 123 GCSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKLFFSS 182

Query: 183 HTYAVTVPAPRLRSWFEFLRAGD-HSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPL 241
               +T+   +L SW EF+   +  S++RD W+    + +++P    L ++YNEL  WP 
Sbjct: 183 KC-PITINELQLNSWIEFINVNEIESITRDVWERLLEYFKKYPTLEILSKNYNELDPWPY 241

Query: 242 VIDEYYEWVKGRNQL 256
           ++DEYYE+++   ++
Sbjct: 242 IMDEYYEFLEDTKRI 256

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  169 bits (427), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 146/279 (52%), Gaps = 53/279 (18%)

Query: 26  ETYLERNHWSLDHALDDFYTQSGG----------GGRA-----EQYSAELVATFERYAAG 70
           + YL RN+W L++AL+++Y +  G          G +       +Y  EL+A F++Y++ 
Sbjct: 3   KKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYSSK 62

Query: 71  GA------MDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGC 124
                   +D + L+ Y+ DL + LED+ T+CLA+LL  E L   I++ QFLS W+  GC
Sbjct: 63  NNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQGC 122

Query: 125 SSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDA---------------------- 162
           S+L  M+  ++ L+++L  DA+YF  +Y YTF L +D                       
Sbjct: 123 STLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDT 182

Query: 163 --------GGRRLSVETAIAYWSLFF-LDHTYAVTVPAPRLRSWFEFLRAG-DHSVSRDT 212
                       L VETAIAYW +FF ++  Y V V    L  WF+FL       +++D 
Sbjct: 183 SIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKDQ 242

Query: 213 WDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVK 251
           W M   F ++F +   + ++Y+E A+WP +IDE+YE+++
Sbjct: 243 WQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQ 281

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  163 bits (413), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 137/238 (57%), Gaps = 12/238 (5%)

Query: 26  ETYLERNHWSLDHALDDFYTQSGGGGRAEQ---------YSAELVATFERYAAGGAMDTE 76
           E YL  +HW++++AL+DFY +  G   +           Y  EL+  F++Y+  G +  E
Sbjct: 22  ERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVVYPPELIHVFDQYSEAGVITFE 81

Query: 77  ALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLPDMRAAVDA 136
            ++ Y+GDL   ++D+ T+CLA+LL  E L A I+R QFL+ W   GCS++ +M+  +  
Sbjct: 82  GMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQFLAQWFLQGCSTINEMKTVLAD 141

Query: 137 LELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFF-LDHTYAVTVPAPRLR 195
           L  +L  D  YF+ +Y YTF L ++    +L   + I YW LFF  +  Y + +    L 
Sbjct: 142 LNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAASTIEYWKLFFDQEKKYPMIIDQELLD 201

Query: 196 SWFEFL--RAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVK 251
            WF +L  ++ + SV+ D W M  +F  RF    ++ + Y+E+A+WP++IDE+ E+++
Sbjct: 202 PWFVYLGEQSENMSVTEDIWKMVYQFFNRFRSLGDVKQGYDEMAAWPILIDEFIEYLQ 259

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  160 bits (404), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 137/261 (52%), Gaps = 13/261 (4%)

Query: 9   ELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGGGRAE-----------QYS 57
           + ++EF+          + YL+RN W L++AL+DFY    G    +           +Y 
Sbjct: 6   QTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEYV 65

Query: 58  AELVATFERYAA-GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFL 116
             L   +  YA   G + TE LV+ V DLG+ ++ + TLCLA+L+     T  I    F+
Sbjct: 66  RPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFI 125

Query: 117 STWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYW 176
            +     C SL D++  ++  + +L+T+  Y+  +Y   F L L+ G + +  ETA  YW
Sbjct: 126 DSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYW 185

Query: 177 SLFFLDHTYAVTVPAPRLRSWFEFL-RAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNE 235
            LFF    Y + V + + + WF++L  A    +++D W M  RF ++FP  +EL   Y+E
Sbjct: 186 DLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSE 245

Query: 236 LASWPLVIDEYYEWVKGRNQL 256
            ++WP + DEYYE+++  N++
Sbjct: 246 DSAWPYIFDEYYEYLEDNNKI 266

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  160 bits (404), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 135/265 (50%), Gaps = 13/265 (4%)

Query: 5   ARQRELIREFLXXXXXXXXXXETYLERNHWSLDHALDDFYTQSGGGGRAEQ--------Y 56
           + + E I  F+            YL +N W++++AL+DFY    GG   E         Y
Sbjct: 4   SMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVY 63

Query: 57  SAELVATFERYAAGGA-MDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQF 115
             ELV  F  Y +    +D + +++ + D G  +ED+AT+CLA +L  E L   I R  F
Sbjct: 64  PKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123

Query: 116 LSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSV--ETAI 173
           L      GC ++ D++  +  L  +L TD  YF  +Y ++FGL LD   R  S+  + AI
Sbjct: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183

Query: 174 AYWSLFFLDHTY-AVTVPAPRLRSWFEFL-RAGDHSVSRDTWDMFPRFAQRFPDDTELLE 231
            YW LFFL+ +  +V +    L  WF+FL       VS+D W M   F ++F D   L E
Sbjct: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243

Query: 232 HYNELASWPLVIDEYYEWVKGRNQL 256
            Y+E   WP VIDE+YE+++   +L
Sbjct: 244 SYDENDPWPFVIDEFYEYLQDTGKL 268

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  153 bits (387), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 112/179 (62%), Gaps = 2/179 (1%)

Query: 76  EALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLPDMRAAVD 135
           ++LV+++ DLG+ LED+ATLCL  LL  + L   + R  FLSTW   GCS+LPDM+  + 
Sbjct: 2   DSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCIK 61

Query: 136 ALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDHTYAVTVPAPRLR 195
            L+++L  D  Y+  +Y Y F L LD+  + + ++ AI YW+LFF    Y V + +  L 
Sbjct: 62  RLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFF-QPVYPVHIESNLLE 120

Query: 196 SWFEFLR-AGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVKGR 253
           SWF FLR  G   +S+DTW M   F Q++     +++ Y+E A+WP +IDE+YE+++  
Sbjct: 121 SWFHFLRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQDH 179

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  147 bits (370), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 109/177 (61%), Gaps = 2/177 (1%)

Query: 76  EALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLPDMRAAVD 135
           ++L++++ DLG+ LED+ATLCL  LL  ++L   + R  FLS W   GCS+LP+M+  V 
Sbjct: 2   DSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCVK 61

Query: 136 ALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDHTYAVTVPAPRLR 195
            L+ +L  D  YF  +Y YTF L LD   + +  E AI YW+L F    Y + +    L 
Sbjct: 62  GLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLF-QPEYPIHMEPGLLE 120

Query: 196 SWFEFLR-AGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVK 251
           +WF FL   G  ++++D W M  +F +++P    +++ Y+E A+WP +IDE+YE+++
Sbjct: 121 AWFRFLHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLR 177

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  144 bits (362), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 106/184 (57%), Gaps = 4/184 (2%)

Query: 76  EALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLPDMRAAVD 135
           + L+ Y+ DLG  LED+ T+CL  LL  + +  DI+R QFL  W   GCS +  M+  + 
Sbjct: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61

Query: 136 ALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFL--DHTYAVTVPAPR 193
            L  +L +D  YF  +Y YTFGL  D   + L VETA+AYW LF    +  + V V    
Sbjct: 62  DLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120

Query: 194 LRSWFEFLRAGDHS-VSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVKG 252
           L  WF+FL   +   +++D W M   F Q+FP+   + E Y+E A+WP +IDEYYE+++ 
Sbjct: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180

Query: 253 RNQL 256
            N +
Sbjct: 181 TNHI 184

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  144 bits (364), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 132/248 (53%), Gaps = 21/248 (8%)

Query: 28  YLERNHWSLDHALDDFYTQSGGGGRAE-------QYSAELVATFERYAA------GGAMD 74
           YL  N+W++++AL+++Y +  GG   +       +Y  ELV+ F  YAA        ++ 
Sbjct: 28  YLSANNWNINYALNEYYDKEVGGFTEDHMIRHQFKYPDELVSLFGHYAALIEEDGTQSIT 87

Query: 75  TEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLPDMRAAV 134
            + L+ Y+ DLG+ LED+ T+ LA  L+ + L   I+  QFL  W+  GC +L  MR  +
Sbjct: 88  PDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQFLYFWYNEGCYTLEQMRHYL 147

Query: 135 DALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDH----TYAVTVP 190
           +  E +L  D  YF  +Y Y+F L     G  +  + AI YW LFF ++    +  + V 
Sbjct: 148 EDCERKLCNDWKYFTTIYNYSFDLNASKQG-VVETDIAIEYWKLFFEENRTKLSGIIKVD 206

Query: 191 APRLRSWFEFLRAGDHS--VSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYE 248
              L  W +FL+  +H   + +DTW M   F ++FP    +   YNE  +WP  IDE+YE
Sbjct: 207 QAHLDLWCKFLQ-DEHKKLIHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYE 265

Query: 249 WVKGRNQL 256
           +++ RN L
Sbjct: 266 YLEERNVL 273

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score = 94.0 bits (232), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 74/126 (58%), Gaps = 2/126 (1%)

Query: 130 MRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDHTYAVTV 189
           M+  +  L+++LR +  YF  +Y YTF L LD+  + + +   I YW LFF    Y V++
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFRPE-YPVSI 59

Query: 190 PAPRLRSWFEFLR-AGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYE 248
               L +WF FL   G   +++DTW M   F +++    E+++ Y+E A+WP +IDE+YE
Sbjct: 60  EQNLLEAWFRFLHDEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFYE 119

Query: 249 WVKGRN 254
           +++ + 
Sbjct: 120 YLQDQQ 125

>CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218w CRM1
          Length = 1087

 Score = 32.0 bits (71), Expect = 1.7,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 2/93 (2%)

Query: 151 LYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDHTYAVT-VPAPRLRSWFEFLRAGDHSVS 209
           L A+ + + L     R   +T + YW     D  Y V  +PA  L    + L  G  +VS
Sbjct: 341 LNAHQYLIQLSKIDERELFKTTLDYWHNLVSDLFYEVQHLPANELNPLMQ-LSVGSQAVS 399

Query: 210 RDTWDMFPRFAQRFPDDTELLEHYNELASWPLV 242
             +  + P F +RFP    + E       W ++
Sbjct: 400 TGSGAISPEFMKRFPLKKHIYEEICSQLRWVII 432

>CAGL0H01287g Chr8 complement(123328..127302) [3975 bp, 1324 aa] {ON}
            similar to uniprot|P24276 Saccharomyces cerevisiae
            YDR293c SSD1
          Length = 1324

 Score = 30.4 bits (67), Expect = 5.9,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 72   AMDTEALVRYVGDLGF---QLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLP 128
            A   E L   +GDL F   Q   VAT   + + KVE    +I  F   +    +     P
Sbjct: 964  ATVAEKLYTKLGDLAFLRRQTAPVATKIASFIKKVEHFGYEIDTFSADTILKSILKIDDP 1023

Query: 129  DMRAAVDALELRLRTDAAYFRA 150
            D+R  V+ L  +  + A YF A
Sbjct: 1024 DVRTGVEILLFKTMSRARYFVA 1045

>Kwal_56.23410 s56 (524742..527219) [2478 bp, 825 aa] {ON} YDR089W -
           Hypothetical ORF [contig 180] FULL
          Length = 825

 Score = 29.6 bits (65), Expect = 8.9,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 92  VATLCLARLLKVEELTADISRFQFLSTWHGLGC 124
           +ATL  + +L    L    SRF+F   WH +GC
Sbjct: 773 IATLLTSLILSCASLLLLFSRFKFAPWWHYVGC 805

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,601,240
Number of extensions: 928934
Number of successful extensions: 1789
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1773
Number of HSP's successfully gapped: 24
Length of query: 256
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 149
Effective length of database: 41,212,137
Effective search space: 6140608413
Effective search space used: 6140608413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)