Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGL192W8.318ON49949923830.0
Ecym_42518.318ON50244212081e-162
YDR144C (MKC7)8.318ON5965109201e-117
Smik_4.3888.318ON5974769141e-116
Skud_4.4038.318ON5904958981e-114
Kpol_543.618.318ON5884328931e-113
YLR120C (YPS1)8.318ON5695078731e-110
TPHA0A015808.318ON6004548641e-109
Skud_12.1928.318ON5695048571e-108
Skud_12.1938.319ON4974608411e-106
TDEL0F044508.318ON5244658321e-105
Smik_12.1868.318ON5724898301e-104
Suva_10.2118.318ON5664878261e-103
YLR121C (YPS3)8.319ON5084338201e-103
KAFR0B06530singletonON5384378161e-102
Smik_12.1878.319ON5074328051e-101
NCAS0C033008.318ON5594518011e-100
SAKL0H15664g8.318ON5563247954e-99
CAGL0M04191g8.318ON6013297985e-99
Suva_10.2128.319ON7454358061e-98
KNAG0G024108.318ON5304457873e-98
ZYRO0G02904gsingletonON5314767701e-95
KLLA0E04049g8.318ON5893637714e-95
NDAI0G026208.318ON5904527671e-94
KAFR0H023008.318ON5214457561e-93
KNAG0I009108.318ON5693787363e-90
Kwal_33.14239singletonON6514837363e-89
ZYRO0F10252gsingletonON5514427092e-86
ZYRO0F10318g8.319ON4864647042e-86
NCAS0B035608.318ON5863387113e-86
Kwal_26.7254singletonON5705227093e-86
KAFR0E03940singletonON6384437143e-86
KNAG0E03220singletonON5404907065e-86
Suva_2.3058.318ON5973417089e-86
KAFR0B057108.318ON5753356938e-84
NDAI0J010308.318ON6523456981e-83
CAGL0E01793gsingletonON5164526741e-81
SAKL0C02970gsingletonON5925056773e-81
KLTH0F06754gsingletonON7674836883e-81
SAKL0F07172g7.182ON5423936701e-80
TBLA0E02630singletonON6893426791e-80
KNAG0I01200singletonON6774166772e-80
KAFR0I01700singletonON5525026692e-80
TBLA0A039108.318ON5964916703e-80
TBLA0H012908.318ON6673456736e-80
CAGL0E01749gsingletonON4824246562e-79
Kwal_56.239028.318ON6293436663e-79
CAGL0E01771gsingletonON5194556532e-78
CAGL0E01881gsingletonON5084276443e-77
ZYRO0F10230g8.318ON5803236468e-77
ZYRO0F10274gsingletonON5723376362e-75
KLTH0G12386g8.318ON5803396214e-73
ZYRO0F10296gsingletonON5285146174e-73
CAGL0E01859gsingletonON5054736154e-73
NCAS0A124607.182ON5404246175e-73
TBLA0D00140singletonON6073416154e-72
KAFR0B06700singletonON5314435992e-70
CAGL0E01815gsingletonON5194485921e-69
CAGL0E01727gsingletonON5394755923e-69
TPHA0C008408.318ON10004596072e-68
Suva_16.14singletonON5404285801e-67
CAGL0E01837gsingletonON5214635755e-67
CAGL0E01419g8.318ON5913495788e-67
NDAI0B017207.182ON5474345662e-65
YIR039C (YPS6)singletonON5374265643e-65
Suva_9.13singletonON4644255453e-63
KNAG0I009008.319ON5314685477e-63
Skud_9.1547.182ON5164095468e-63
Smik_65.1singletonON3423135302e-62
YIL015W (BAR1)7.182ON5874095368e-61
SAKL0E15356gsingletonON5573995217e-59
Suva_34.1singletonON3873285072e-58
Smik_9.1757.182ON5934095193e-58
KNAG0H027607.182ON5634194921e-54
Ecym_43947.182ON5184124846e-54
ZYRO0D15554g7.182ON5214064846e-54
KLLA0D15917g7.182ON5114114821e-53
ZYRO0E02266gsingletonON5063274635e-51
TDEL0H026507.182ON5524164552e-49
AGR240W7.182ON4523824193e-45
Smik_5.7singletonON3042364085e-45
CAGL0J02288g7.182ON5414274131e-43
SAKL0H00330gsingletonON5783904141e-43
Suva_79.1singletonON2272333552e-38
Kpol_1063.227.182ON3362633474e-36
TBLA0D045807.182ON3953763074e-30
NDAI0E021058.677ON4083562732e-25
KNAG0J017108.677ON4153532643e-24
Kwal_26.88028.677ON4123572601e-23
KLTH0D11264g8.677ON4173572582e-23
SAKL0H06512g8.677ON4043552511e-22
Skud_16.1288.677ON4053582502e-22
YPL154C (PEP4)8.677ON4053582502e-22
NCAS0C013608.677ON4063522484e-22
Smik_6.3518.677ON4053582468e-22
CAGL0M02211g8.677ON4153652451e-21
ACR144W8.677ON4083732413e-21
Suva_9.1877.182ON3331682383e-21
Suva_16.1568.677ON4063582413e-21
Kpol_1072.158.677ON3993672403e-21
Suva_9.186singletonOFF5431932434e-21
Kpol_1013.68.677ON4023532371e-20
KLLA0D05929g8.677ON4093552361e-20
TBLA0B038308.677ON4133542352e-20
Ecym_23968.677ON4153712343e-20
ZYRO0F07392g8.677ON4183582263e-19
TDEL0A062308.677ON4083562237e-19
TPHA0D012608.677ON4193562202e-18
KAFR0H024208.677ON4163452183e-18
ACR143WsingletonON3933511773e-13
Ecym_13245.401ON5764231785e-13
Smik_5.6singletonON123941486e-11
Suva_62.1singletonON2521891522e-10
KLTH0E02596g5.401ON5964321431e-08
NDAI0C046105.401ON6094371411e-08
AGR407CsingletonON2682001354e-08
KLLA0F22088g5.401ON5584151313e-07
KNAG0C051405.401ON5984271303e-07
KAFR0E040805.401ON5964321279e-07
CAGL0A02431g5.401ON5872401261e-06
TPHA0E019205.401ON6244081251e-06
TDEL0E022305.401ON5733821242e-06
Kwal_55.200345.401ON5934411215e-06
YGL258W-AsingletonON77511042e-05
SAKL0G07524g5.401ON6323941152e-05
Kpol_1059.335.401ON6623971152e-05
YGL259W (YPS5)singletonON165571058e-05
Suva_2.5205.401ON5981991091e-04
Smik_67.1singletonON11052991e-04
ACR150W5.401ON5533911072e-04
YDR349C (YPS7)5.401ON5962351029e-04
Skud_4.6185.401ON586244990.002
ZYRO0A06578g5.401ON720410970.003
ABL123Cna 1ON494348920.011
SAKL0D01408gna 1ON506383900.024
Smik_4.6135.401ON596232880.043
TBLA0H016805.401ON609200870.055
NCAS0F031505.401ON645442860.060
KLLA0D01507gna 1ON515432820.22
Ecym_4614na 1ON481222714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL192W
         (499 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   922   0.0  
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   469   e-162
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   358   e-117
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   356   e-116
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   350   e-114
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   348   e-113
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   340   e-110
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   337   e-109
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   334   e-108
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   328   e-106
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   325   e-105
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   324   e-104
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   322   e-103
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   320   e-103
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            318   e-102
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   314   e-101
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              313   e-100
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   310   4e-99
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   311   5e-99
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   315   1e-98
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   307   3e-98
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   301   1e-95
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   301   4e-95
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   300   1e-94
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   295   1e-93
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              288   3e-90
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   288   3e-89
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   277   2e-86
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   275   2e-86
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   278   3e-86
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   277   3e-86
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              279   3e-86
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   276   5e-86
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   277   9e-86
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   271   8e-84
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             273   1e-83
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   264   1e-81
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   265   3e-81
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   269   3e-81
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   262   1e-80
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   266   1e-80
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              265   2e-80
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   262   2e-80
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   262   3e-80
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   263   6e-80
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   257   2e-79
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   261   3e-79
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   256   2e-78
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   252   3e-77
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   253   8e-77
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   249   2e-75
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   243   4e-73
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   242   4e-73
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   241   4e-73
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   242   5e-73
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                241   4e-72
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   235   2e-70
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   232   1e-69
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   232   3e-69
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   238   2e-68
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   228   1e-67
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   226   5e-67
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   227   8e-67
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   222   2e-65
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   221   3e-65
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   214   3e-63
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              215   7e-63
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   214   8e-63
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       208   2e-62
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   211   8e-61
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   205   7e-59
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   199   2e-58
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   204   3e-58
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   194   1e-54
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   191   6e-54
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   191   6e-54
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   190   1e-53
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   182   5e-51
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   179   2e-49
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   166   3e-45
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       161   5e-45
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   163   1e-43
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   164   1e-43
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   141   2e-38
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   138   4e-36
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   122   4e-30
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}    109   2e-25
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....   106   3e-24
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...   104   1e-23
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...   103   2e-23
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...   101   1e-22
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...   100   2e-22
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...   100   2e-22
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...   100   4e-22
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    99   8e-22
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    99   1e-21
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    97   3e-21
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    96   3e-21
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    97   3e-21
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    97   3e-21
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    98   4e-21
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    96   1e-20
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    96   1e-20
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    95   2e-20
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    95   3e-20
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    92   3e-19
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    91   7e-19
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    89   2e-18
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    89   3e-18
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    73   3e-13
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    73   5e-13
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        62   6e-11
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    63   2e-10
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    60   1e-08
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    59   1e-08
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    57   4e-08
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    55   3e-07
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    55   3e-07
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    54   9e-07
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    53   1e-06
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    53   1e-06
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    52   2e-06
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    51   5e-06
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    45   2e-05
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    49   2e-05
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    49   2e-05
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    45   8e-05
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    47   1e-04
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        43   1e-04
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    46   2e-04
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    44   9e-04
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    43   0.002
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    42   0.003
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...    40   0.011
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    39   0.024
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    39   0.043
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    38   0.055
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    38   0.060
KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly...    36   0.22 
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    32   4.2  

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/499 (89%), Positives = 448/499 (89%)

Query: 1   MIAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN 60
           MIAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN
Sbjct: 1   MIAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN 60

Query: 61  DWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNC 120
           DWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNC
Sbjct: 61  DWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNC 120

Query: 121 YEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXX 180
           YEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTF        
Sbjct: 121 YEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFAVAHASNS 180

Query: 181 XXXXLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFG 240
               LGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFG
Sbjct: 181 SVAVLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFG 240

Query: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
           AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL
Sbjct: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300

Query: 301 LDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL 360
           LDSGTTLTYFPMQ            WHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL
Sbjct: 301 LDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL 360

Query: 361 SDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQI 420
           SDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQI
Sbjct: 361 SDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQI 420

Query: 421 EVIAGAVPRAVRAPGYNDPWKAYTPLVFNGELGNLTATAXXXXXXXXXXXXXXXXXXXXX 480
           EVIAGAVPRAVRAPGYNDPWKAYTPLVFNGELGNLTATA                     
Sbjct: 421 EVIAGAVPRAVRAPGYNDPWKAYTPLVFNGELGNLTATASDSSSGSVGSRSNSALTLTPP 480

Query: 481 XXXXXXFAASLLGAATRII 499
                 FAASLLGAATRII
Sbjct: 481 SLSETLFAASLLGAATRII 499

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  469 bits (1208), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 229/442 (51%), Positives = 297/442 (67%), Gaps = 6/442 (1%)

Query: 19  ASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDNQQMFYSVN 77
           A L +R E+A +VR D DK RG  F  +  G      L KR+D +VD++I N+Q FYSVN
Sbjct: 20  ALLAQRAESAAYVRFDLDKTRGNDFRSSEKGVMPFGELKKRDDEYVDVKIHNEQTFYSVN 79

Query: 78  LSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDN 137
           LSIGTP QEV VL+DTGSSDLW++GA V CGP+N  +   L+C+E+G+FD S+SS+WK+N
Sbjct: 80  LSIGTPAQEVTVLVDTGSSDLWIIGADVDCGPDNSDSTEPLDCFEYGAFDKSKSSSWKNN 139

Query: 138 NTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMS 197
           +T+F+I YGD+++A G WGTD+LDLG  N DGLTF            LGIGL  +E T +
Sbjct: 140 HTEFYISYGDTSFASGEWGTDKLDLGDLNADGLTFAVATASNSSVAVLGIGLTGIEVTRA 199

Query: 198 SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLV 257
           S   GY+YDNLP+VLKRN VI KT YS+++N+L+A +GSVLFGAVDHSKY GTL TVPLV
Sbjct: 200 SGDNGYEYDNLPIVLKRNGVIDKTAYSLYLNDLDATSGSVLFGAVDHSKYTGTLATVPLV 259

Query: 258 NANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
           N N R    KP+ELH+TL  +G  +G+   K  T+  +KVPALLDSGTTL+YFP +    
Sbjct: 260 NVNARYGFPKPIELHITLNGLGFSSGK---KRGTISATKVPALLDSGTTLSYFPTELAAA 316

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGI 377
                   W++    +++ C+  + +    IY+FGG +I SPL +Y   TNV   C  GI
Sbjct: 317 IASNVGAVWNARLRKFLIPCSQAKRNNIDLIYNFGGVEITSPLVNYLSETNVEDVCLLGI 376

Query: 378 MPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANY--EGGKEQIEVIAGAVPRAVRAPG 435
           +P SS+ +ILGDVFLT  Y V+DLEALEVS+AQA Y     KE IEVI   VP A +APG
Sbjct: 377 VPTSSNDIILGDVFLTSVYTVYDLEALEVSIAQAAYGASAEKENIEVIKSTVPGATKAPG 436

Query: 436 YNDPWKAYTPLVFNGELGNLTA 457
           Y++ W  Y P+   G + N  A
Sbjct: 437 YSNTWSTYAPISTGGNMFNAAA 458

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  358 bits (920), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/510 (38%), Positives = 277/510 (54%), Gaps = 61/510 (11%)

Query: 4   QIAALGAVLATNVACASLVER--------EEAAQFVRMDFDKKRGPSFSEAWSGRAAVPR 55
           +++ L  V+   + C+S+V+              +V+M+F KK G SF  A        R
Sbjct: 2   KLSVLTFVVDALLVCSSIVDAGVTDFPSLPSNEVYVKMNFQKKYGSSFENALDDTKGRTR 61

Query: 56  LAKRND-WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLW--------------- 99
           L  R+D +  +E+ NQ  FYSV L IGTPPQ+V VL+DTGSSDLW               
Sbjct: 62  LMTRDDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCSTKKKD 121

Query: 100 ------------------------------VVGAGVRCGPNNYPNPNQL-NCYEHGSFDT 128
                                         +V +      ++  + +QL +C  +G+F+T
Sbjct: 122 TTGSSFKQVNKDALASVVESVFTEISYDTTIVTSEATATFDSTASTSQLIDCATYGTFNT 181

Query: 129 SRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIG 188
           S+SST+  NNT+F I YGD+T+A GTWG D+L L   N+ GL+F            LGIG
Sbjct: 182 SKSSTFNSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIG 241

Query: 189 LPAMETT-----MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVD 243
           LP +E+T     +SS Q  Y Y+N PMVLK + VIK T YS+F N+ ++K G++LFGAVD
Sbjct: 242 LPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVD 301

Query: 244 HSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDS 303
           H KY G L T+P++N    R    P++  VTL  +G   G  ED + TL  +K+P LLDS
Sbjct: 302 HGKYAGDLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDS 361

Query: 304 GTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDY 363
           GTT++Y P +            + S    YI+DC      +++ I+DFGGF + + LSD+
Sbjct: 362 GTTISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDF 421

Query: 364 SMMTNVRGT-CRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEV 422
            ++T+ R   C  GI P S   +ILGD FL   YVV+DL+ +E+SMAQAN+    E IE+
Sbjct: 422 QLVTDSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIEI 481

Query: 423 IAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           I  AVP A++APGY+  W  Y  +V  G +
Sbjct: 482 IESAVPSALKAPGYSSTWSTYESIVSGGNM 511

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  356 bits (914), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 188/476 (39%), Positives = 266/476 (55%), Gaps = 53/476 (11%)

Query: 30  FVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVDIEIDNQQMFYSVNLSIGTPPQEVR 88
           +V+M+F +K G SF  A +   A  RL  R +D+  +E+ NQ  FYSV L IGTPPQ+V 
Sbjct: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query: 89  VLMDTGSSDLWVVGA--------GVRCGPNNYPNPNQ----------------------- 117
           VL+DTGSSDLWV G+        G     +++ + N+                       
Sbjct: 96  VLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTS 155

Query: 118 ---------------LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDL 162
                          +NC  +G+FDTS+SST++ N T+F I YGDST+A GTWG DRL L
Sbjct: 156 VATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSL 215

Query: 163 GQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT-----MSSQQFGYQYDNLPMVLKRNNV 217
              NV GL+F            LGIGLP +E+T     +SS Q  Y Y+N PM+LK +  
Sbjct: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGA 275

Query: 218 IKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAA 277
           IK T YS+F N  ++K G++LFGAVDH KY G L T+P++N    R    P++  VTL  
Sbjct: 276 IKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQG 335

Query: 278 IGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDC 337
           IG+  G  ++ + TL  +K+P LLDSGTT++Y P              +  +   YI+DC
Sbjct: 336 IGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDC 395

Query: 338 NSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRG-TCRFGIMPHSSDYVILGDVFLTRAY 396
            +    +++ I+DFGGF I + LS++ ++T+ R   C  GI P S   +ILGD FL   Y
Sbjct: 396 INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTY 455

Query: 397 VVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           VV+DL+ +E+SMA A++  G E I+ I  +VP A++APGY+  W  Y  +V  G +
Sbjct: 456 VVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNM 511

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  350 bits (898), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/495 (38%), Positives = 271/495 (54%), Gaps = 56/495 (11%)

Query: 11  VLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVDIEIDN 69
           V A ++A AS+   E    +V M+F+KK G SF  A + R A   L +R +D+  +++ N
Sbjct: 20  VSADSIASASIATSE---SYVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTN 76

Query: 70  QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG------------------------- 104
           +  FYSV L IGTPPQ++ VL+DTGSSDLWV G+                          
Sbjct: 77  ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPA 136

Query: 105 --------------------VRCGPNNYPNPNQ-LNCYEHGSFDTSRSSTWKDNNTQFHI 143
                                    +N P  +Q +NC  +G+FD+S+SST++ N T+F I
Sbjct: 137 SVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSI 196

Query: 144 RYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT-----MSS 198
            YGDST+A GTWG D+L+L   NV GL+F            LGIGLP +E+T     +SS
Sbjct: 197 TYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSS 256

Query: 199 QQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVN 258
            Q  Y Y+N PMVLK +  IK + YS+F N+ N++ G++LFGAVDH KY G L T+P++N
Sbjct: 257 VQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIIN 316

Query: 259 ANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXX 318
                    P++ HVTL  I + TG   D   TL  +K+PALLDSGTT++Y P++     
Sbjct: 317 ILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELL 376

Query: 319 XXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRG-TCRFGI 377
                  + SE   Y+++C          ++DFGGF I S LS++ + T+     C  G 
Sbjct: 377 ADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGF 436

Query: 378 MPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYN 437
            P S   VILGD FL   Y+V+DL+ +E+SMA A++    E I+VI  AVP A++AP Y+
Sbjct: 437 APQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYS 496

Query: 438 DPWKAYTPLVFNGEL 452
           + W  Y  +V  G +
Sbjct: 497 NTWSTYESIVPGGNI 511

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  348 bits (893), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/432 (42%), Positives = 254/432 (58%), Gaps = 9/432 (2%)

Query: 26  EAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVD-IEIDNQQMFYSVNLSIGTPP 84
           E+  FVR  FDK  G SF  A +       + KR++ V+ +EI NQ  FYSV+LSIG+  
Sbjct: 60  ESQGFVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGSNA 119

Query: 85  QEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIR 144
           Q V VL+DTGSSDLWV G+          N + ++C + G+F+ S S TW  N T F I 
Sbjct: 120 QNVTVLLDTGSSDLWVTGSNNPLCSRGDSNSDAVDCAKFGTFNPSTSDTWSSNETSFSIS 179

Query: 145 YGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQ---- 200
           Y DS+YA GTWG D L L   +V GL+F            LGIGLP++E T S       
Sbjct: 180 YADSSYASGTWGQDTLKLQDLDVTGLSFAVANYTNSTVGVLGIGLPSLEVTYSGSNNVAG 239

Query: 201 FGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNAN 260
             YQY+N P++LK +   K   YS+++N+L+++TGSVLFG VDH+KY GTL T+PLVN  
Sbjct: 240 TRYQYENFPLLLKNSGATKANAYSLYLNDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTL 299

Query: 261 YRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXX 320
                ++PVE  VTL  +G+    DE    TL  +K+PALLDSGTTL Y P         
Sbjct: 300 RAAGFSQPVEFDVTLQGMGI--SDDEHGNVTLTTTKIPALLDSGTTLVYLPSALVSLIAD 357

Query: 321 XXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPH 380
                ++S    Y+++C       +  ++DFGGF I + L+ Y ++  V G C  GI+P 
Sbjct: 358 EYDAVYNSRTGYYVMNCPDSD-EDSQIVFDFGGFHISTNLTTY-IIQAVGGICVLGILPQ 415

Query: 381 SSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPW 440
           SS   ILGD FL  AYVV+DL+ LE+SMAQA++E   E +EVI+ ++P AV+APGY+  W
Sbjct: 416 SSGTAILGDSFLQHAYVVYDLDNLEISMAQASFETDDENVEVISSSIPSAVKAPGYSSTW 475

Query: 441 KAYTPLVFNGEL 452
             ++ +   G +
Sbjct: 476 STFSSISSGGNI 487

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  340 bits (873), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/507 (39%), Positives = 268/507 (52%), Gaps = 72/507 (14%)

Query: 11  VLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDN 69
           VL   +  A+  + +  ++FV++ F K  G S     S +    RL KR D + +I I N
Sbjct: 19  VLGKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITN 78

Query: 70  QQMFYSVNLSIGTPPQEVRVLMDTGSSDLW------------------------------ 99
           QQ FYSV+L +GTPPQ V VL+DTGSSDLW                              
Sbjct: 79  QQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSS 138

Query: 100 -------------VVGAGVRCGPN-------------NYP-NPNQLNCYEHGSFDTSRSS 132
                        + G G   GP              + P +   ++C ++G+F TS SS
Sbjct: 139 GGSLINDINPFGWLTGTGSAIGPTATGLGGGSGTATQSVPASEATMDCQQYGTFSTSGSS 198

Query: 133 TWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAM 192
           T++ NNT F I YGD T+A GT+GTD LDL   NV GL+F            LGIGLP +
Sbjct: 199 TFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPEL 258

Query: 193 ETTMSSQQF-----GYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKY 247
           E T S          Y+YDN P+VLK +  IK   YS+++N+ +A  G++LFGAVDHSKY
Sbjct: 259 EVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKY 318

Query: 248 KGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTL 307
            GTL T+P+VN       + P++  VT+  IG+      +K  TL  +K+PALLDSGTTL
Sbjct: 319 TGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNK--TLTTTKIPALLDSGTTL 376

Query: 308 TYFPMQXXXXXXXXXXXXWHSEEVG-YIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMM 366
           TY P Q             +S  +G Y++DC S    +   ++DFGGF I +PLS + + 
Sbjct: 377 TYLP-QTVVSMIATELGAQYSSRIGYYVLDCPSDDSME--IVFDFGGFHINAPLSSFILS 433

Query: 367 TNVRGTCRFGIMPHSSDY-VILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAG 425
           T    TC  GI+P S D   ILGD FLT AYVV+DLE LE+SMAQA Y    E IE+I  
Sbjct: 434 TGT--TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITS 491

Query: 426 AVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           +VP AV+APGY + W     +V  G +
Sbjct: 492 SVPSAVKAPGYTNTWSTSASIVTGGNI 518

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  337 bits (864), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/454 (40%), Positives = 257/454 (56%), Gaps = 22/454 (4%)

Query: 21  LVERE--EAAQFVRMDFDKKRGPSFSEAWSGRAAVPRL--AKRNDWVDIEIDNQQMFYSV 76
           L +R+  E   F++  FDK  G S+    S +   P+L   KR+ + +IE+ N+  FYS+
Sbjct: 33  LTKRDGSEIDNFIKFKFDKSYGDSYKN--SSKRNKPKLDIVKRDGYEEIELKNESSFYSI 90

Query: 77  NLSIGTPPQEVRVLMDTGSSDLWVVGA-GVRCGPNNY-------PNPNQLNCYEHGSFDT 128
            LSIGTP Q V VL+DTGSSDLWV G+    C  ++         + + ++C  +G+FD 
Sbjct: 91  KLSIGTPAQNVTVLIDTGSSDLWVTGSDNPLCSSDDATFTGSDGSSQSSIDCSLYGTFDI 150

Query: 129 SRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIG 188
             SS++  N+T F I YGD +YA G WG D L L   +V GL+F            LGIG
Sbjct: 151 DDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQDIDVTGLSFAVANYTNSTVGVLGIG 210

Query: 189 LPAMETTMSSQQFG---YQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHS 245
           LP++E T S    G   YQYDNLP+VL+ +  +K   YS+F+N+ ++  GS+LFG VDHS
Sbjct: 211 LPSLEATYSGSLAGSNPYQYDNLPLVLRNSGAVKSYAYSLFLNDEDSSEGSILFGGVDHS 270

Query: 246 KYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGT 305
           KY+GTLNT+PLVN         P E  +TL  +G+ T     K  T+  +++ ALLDSGT
Sbjct: 271 KYEGTLNTLPLVNYQKSSGFQSPYEFDITLQGLGISTSS---KNTTVSDTQIVALLDSGT 327

Query: 306 TLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSM 365
           TLTY P+             + +    Y + C S     T  ++DFGGF I  PL+ + +
Sbjct: 328 TLTYLPVTLTSLLAAELNASYSARLGYYTMSCPSSS-DSTEIVFDFGGFHINVPLTSF-I 385

Query: 366 MTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAG 425
           +T+    C  GI+P S D  ILGD FL  AYVV+DLE LE+S+AQA Y    E IE I  
Sbjct: 386 VTSSMNVCILGIIPRSGDQAILGDSFLQHAYVVYDLENLEISLAQAKYGSSSEDIEAIVS 445

Query: 426 AVPRAVRAPGYNDPWKAYTPLVFNGELGNLTATA 459
           +VP AVRA  Y++ W     +   G++  ++ TA
Sbjct: 446 SVPSAVRAASYSNTWSTAATINSGGDIFTVSTTA 479

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  334 bits (857), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/504 (39%), Positives = 265/504 (52%), Gaps = 69/504 (13%)

Query: 12  LATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDNQ 70
           LA  +  AS  + +  ++FV++ F K  G +  +  + +    RL KR D + +I I NQ
Sbjct: 20  LAKIIPAASKRDDDSNSKFVKLPFHKLYGDTRDDVGTDKKPEVRLLKRADGYEEIIITNQ 79

Query: 71  QMFYSVNLSIGTPPQEVRVLMDTGSSDLW------------------------------- 99
           Q FYSV+L +GTPPQ V VL+DTGSSDLW                               
Sbjct: 80  QSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYCSSGSMSSSRRRVINKRDDSSSS 139

Query: 100 ------------VVGAGVRCGP-------------NNYP-NPNQLNCYEHGSFDTSRSST 133
                       + G G   GP              + P +   +NC E G+F TS SST
Sbjct: 140 GALVNDINPFGWLTGTGSAIGPTATGSGGGSGTATQSVPASEATMNCQEFGTFTTSDSST 199

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           ++ NNT F I YGD T+A GT+GTD LDL   NV GL+F            LGIGLP +E
Sbjct: 200 FRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSFAVANETNSTMGVLGIGLPELE 259

Query: 194 -----TTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYK 248
                +T SS +  Y YDN PMVLK +  IK   YS+++N+ +AK G++LFGAVDHSKY 
Sbjct: 260 VTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLNDSDAKHGTILFGAVDHSKYA 319

Query: 249 GTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLT 308
           GTL TVP+VN       + P++  VT+  IG+    +  K  TL  +++PALLDSGTTLT
Sbjct: 320 GTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQK--TLTTTQIPALLDSGTTLT 377

Query: 309 YFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTN 368
           Y P              + S    Y++DC S   + T  ++DFGGF I + LS  S + N
Sbjct: 378 YLPQAVVAMIADELDAQYSSRLGYYVLDCPSNS-NSTQIVFDFGGFHINASLS--SFILN 434

Query: 369 VRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVP 428
               C  GI+  + D  ILGD FLT AYVV+DL+ LE+SMAQA Y    E IEVI  ++P
Sbjct: 435 AGNICLLGII-ATDDTTILGDSFLTNAYVVYDLDNLEISMAQAQYNITNENIEVITSSIP 493

Query: 429 RAVRAPGYNDPWKAYTPLVFNGEL 452
            A++APGY   W     +V  G +
Sbjct: 494 SAIKAPGYTSTWSTSASIVTGGNI 517

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  328 bits (841), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/460 (41%), Positives = 257/460 (55%), Gaps = 33/460 (7%)

Query: 2   IAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-N 60
           +   AA+   +   +A  S++ RE   ++V++ F K +            A   L KR N
Sbjct: 3   VISAAAVSLAVLNTLALGSILPRE---KYVKIPFVKNQ----------DGAGNVLGKRSN 49

Query: 61  DWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG-VRCGPNNYPNPNQLN 119
                 + N+Q FYSV L+IGTP Q + VL+DTGS+DLWV   G   CG       + ++
Sbjct: 50  GHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCG-------SVMD 102

Query: 120 CYEHGSFDTSRSSTWKDNNTQ-FHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXX 178
           C ++G FD ++SST+K N +  F+  YGD T+A G +G DRL     ++ GL+F      
Sbjct: 103 CDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGLSFAVANES 162

Query: 179 XXXXXXLGIGLPAMETTMSSQ-----QFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAK 233
                 LGIGLPA+E T S +     +  Y+YDN P+ LKR+  I  T YS+F+N+ +  
Sbjct: 163 NSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLNDESQS 222

Query: 234 TGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLL 293
           +GS+LFGAVDHSKY+G L TVPLVN    +    PV   VTL  IGL T R      TL 
Sbjct: 223 SGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRHN---TTLT 279

Query: 294 GSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGG 353
            +K+PALLDSGTTLTY P Q            + S+ +GY         + T+  +DFGG
Sbjct: 280 ATKIPALLDSGTTLTYLPSQAVALLAKSLNATY-SKALGYYEYACPSSDNDTSVAFDFGG 338

Query: 354 FQIRSPLSDYSMMTNVRGTCRFGIMPHSSD-YVILGDVFLTRAYVVFDLEALEVSMAQAN 412
           F I +P+SD++M T+V GTC   ++P + +   ILGD FL  AYVV+DL+  EVS+AQA 
Sbjct: 339 FHINAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLAQAK 398

Query: 413 YEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           Y  G E IE I   VP A RAPGYN  W  Y  +   G +
Sbjct: 399 YGTGAEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGNI 438

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/465 (39%), Positives = 252/465 (54%), Gaps = 38/465 (8%)

Query: 9   GAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEI 67
           G +L +     S V+ E+  ++V + FDK RG S+ EA  G      L KR+D + +IEI
Sbjct: 11  GFLLGSQAVALSDVD-EKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEI 69

Query: 68  DNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWV--------------------------V 101
            N+Q FYS+ L IGTP Q V VL+DTGSSDLWV                           
Sbjct: 70  YNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVTQLSTSTLAT 129

Query: 102 GAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLD 161
            +G      N      ++C E+G+FD S+S++++ NNT F I YGD+T+A GTWGTD  D
Sbjct: 130 SSGTATSSGN-SGIATVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFD 188

Query: 162 LGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTM----SSQQFGYQYDNLPMVLKRNNV 217
           LG  NV  L+F            +GIGL  +++T     S+    YQY+N PM LK   +
Sbjct: 189 LGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGI 248

Query: 218 IKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAA 277
           I +  YS+F+NE +A  GSVLFGAVDHSKY G L TVP++N    R +  P+E  VT+  
Sbjct: 249 IDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDVTVQG 308

Query: 278 IGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDC 337
           + + +G     ++ L  ++ PALLDSGTTL+Y P              +      Y + C
Sbjct: 309 VSVTSGS---TIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRC 365

Query: 338 NSRRLHQTAYIYDFGGFQI-RSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAY 396
            S   + T   +DFGGFQI  +  S      +   TC  G++P +S+  I GD FL  AY
Sbjct: 366 PSEN-NDTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFLVHAY 424

Query: 397 VVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWK 441
           VV+DLE  E+SMAQA +     QIEVI+ ++P AVRA GY+  W 
Sbjct: 425 VVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWS 469

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  324 bits (830), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/489 (39%), Positives = 260/489 (53%), Gaps = 72/489 (14%)

Query: 29  QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDNQQMFYSVNLSIGTPPQEV 87
           +FV++ F K  G S       +     L KR D + +I I NQQ FYSV L +G+PPQ V
Sbjct: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99

Query: 88  RVLMDTGSSDL-------------------------------------------WVVGAG 104
            VL+DTGSSDL                                           W+ G G
Sbjct: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159

Query: 105 VRCGPN-------------NYP-NPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTY 150
              GP              + P +   ++C E+G+F TS SST++ NNT F I YGD T+
Sbjct: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGTFTTSDSSTFRSNNTYFSISYGDGTF 219

Query: 151 AHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFG-----YQY 205
           A GT+GTD LDL   NV GL+F            LGIGLP +E T S          ++Y
Sbjct: 220 ASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKY 279

Query: 206 DNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRV 265
           DN P+VLK +  IK   YS+++N+ +A+ G++LFGAVDHSKY GTL T+P+VN       
Sbjct: 280 DNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGF 339

Query: 266 NKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXX 325
           + P++  VT+  IG+   ++ +K  TL  +K+PALLDSGTTLTY P +            
Sbjct: 340 SSPIQFDVTINGIGVSDSKNGEK--TLTTTKIPALLDSGTTLTYLP-ETVVALIADEIGA 396

Query: 326 WHSEEVG-YIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDY 384
            +S  +G Y++DC S     T  ++DFGGF I + LS + + T    TC  GI+P S + 
Sbjct: 397 QYSYRLGYYVLDCPSD--DSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSDNT 452

Query: 385 -VILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAY 443
             ILGD FLT AYVV+DL+ LE+SMAQA Y    E IEVI+ ++P AV+APGY + W   
Sbjct: 453 GTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTS 512

Query: 444 TPLVFNGEL 452
             +V  G +
Sbjct: 513 ATIVTGGNI 521

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  322 bits (826), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/487 (38%), Positives = 260/487 (53%), Gaps = 65/487 (13%)

Query: 25  EEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDNQQMFYSVNLSIGTP 83
           +  ++FV++ FDK  G S   A   +    RL+KR D + +I I NQQ FYSV+L +GTP
Sbjct: 34  DTGSKFVKLSFDKLYGDSLDTAGRDKKPEVRLSKRADGYEEIIITNQQSFYSVDLEVGTP 93

Query: 84  PQEVRVLMDTGSSDL----------------------------------------WVVGA 103
            Q + VL+DTGSSDL                                        W+   
Sbjct: 94  AQNITVLVDTGSSDLWIMGSSNPYCSSDDSSKYVLRKRDTSSSSGDLVNDINPFGWLTET 153

Query: 104 GVRCGPN-----------NYP-NPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYA 151
           G   G             + P +   ++C E+G+F +S SST+K NNT F I YGD T+A
Sbjct: 154 GSVTGATATATGSGTATQSVPASEATMDCEEYGTFTSSDSSTFKSNNTAFEISYGDGTFA 213

Query: 152 HGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQF-----GYQYD 206
            GT+GTD L+L   NV GL+F            LGIGLP++E T S          Y+YD
Sbjct: 214 AGTFGTDVLNLSDLNVTGLSFAVANETNSTMGVLGIGLPSLEVTYSGSSASNGGKSYKYD 273

Query: 207 NLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVN 266
           N P+VLK +  IK   YS+++N+ +AK G++LFG VDH+KY GTL TV LVN        
Sbjct: 274 NFPIVLKNSGAIKSNAYSLYLNDSDAKHGTILFGGVDHNKYSGTLYTVALVNT--LSGFT 331

Query: 267 KPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXW 326
            P++  +TL  +G+     ++K  TL  +K+P LLDSGTTLTY P++            +
Sbjct: 332 SPIQFDITLNGLGIIDDNGDEK--TLTTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQY 389

Query: 327 HSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHS-SDYV 385
            S    Y+++C S   + T  ++DFGGF I + LS + +++    TC  GI+P S S   
Sbjct: 390 SSRIGYYVMECPSSD-NSTEIVFDFGGFHINASLSSF-ILSTSGNTCLLGIIPTSDSTGS 447

Query: 386 ILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTP 445
           ILGD FLT AYVV+DLE LE+SMAQA Y    E IEVI+ +VP AV+APGY + W     
Sbjct: 448 ILGDSFLTNAYVVYDLENLEISMAQAKYNVTSEDIEVISTSVPNAVKAPGYTNTWSTTAS 507

Query: 446 LVFNGEL 452
           +   G +
Sbjct: 508 IATGGNI 514

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  320 bits (820), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/433 (41%), Positives = 251/433 (57%), Gaps = 31/433 (7%)

Query: 29  QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVDIEIDNQQMFYSVNLSIGTPPQEV 87
           ++V++ F KK+     E          L+KR N      + N+Q FYSV L+IGTP Q +
Sbjct: 27  KYVKIPFTKKKNGDNGE----------LSKRSNGHEKFVLANEQSFYSVELAIGTPSQNL 76

Query: 88  RVLMDTGSSDLWVVGAG-VRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQ-FHIRY 145
            VL+DTGS+DLWV G G   CG       + ++C ++G FD ++SST+K N +  F+  Y
Sbjct: 77  TVLLDTGSADLWVPGKGNPYCG-------SVMDCDQYGVFDKTKSSTFKANKSSPFYAAY 129

Query: 146 GDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQ-----Q 200
           GD TYA G +G D+L   + ++ GL+F            LGIGL  +E T S +     +
Sbjct: 130 GDGTYAEGAFGQDKLKYNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDK 189

Query: 201 FGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNAN 260
             Y+YDN P+ LK +  I  T YS+F+N+ +  +GS+LFGAVDHSKY+G L T+PLVN  
Sbjct: 190 RSYEYDNFPLFLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLY 249

Query: 261 YRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXX 320
             +    PV   VTL  +GL T   + +  TL  +K+PALLDSGTTLTY P Q       
Sbjct: 250 KSQGYQHPVAFDVTLQGLGLQT---DKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAK 306

Query: 321 XXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPH 380
                + S+ +GY         ++T+  +DFGGF+I +PLSD++M T+V GTC   I+P 
Sbjct: 307 SLNASY-SKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTMQTSV-GTCVLAIIPQ 364

Query: 381 SSD-YVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDP 439
           + +   ILGD FL  AYVV+DL+  E+S+AQA Y  GKE +EVI   VP A+RAP YN+ 
Sbjct: 365 AGNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGTGKENVEVIKSTVPSAIRAPSYNNT 424

Query: 440 WKAYTPLVFNGEL 452
           W  Y      G +
Sbjct: 425 WSNYASATSGGNI 437

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/437 (41%), Positives = 254/437 (58%), Gaps = 26/437 (5%)

Query: 30  FVRMDFDKKRGPSF--SEAWS----GRAAV----PRLAKR--NDWVDIEIDNQQMFYSVN 77
           F+ + F+K  G SF  ++ W     G+  +      L KR  +D+ ++EI NQQ FYS++
Sbjct: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLD 95

Query: 78  LSIGTPPQEVRVLMDTGSSDLWVVGAG-VRCGPNNY----PNPNQLNCYEHGSFDTSRSS 132
           L IGTP Q V V +DTGSSDLWV G+    C  + +    P+    NC ++G+F+T++SS
Sbjct: 96  LFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGTFNTNKSS 155

Query: 133 TWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAM 192
           TW  NN++F I+YGD+T+A GTWG D + +   NV GLTF            LGIGL  +
Sbjct: 156 TWSSNNSRFFIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQL 215

Query: 193 ETTM--SSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGT 250
           ETT   S+    Y Y N P+VLK   + +   YS+F+NEL+A++GS+LFGAVDHSKY G 
Sbjct: 216 ETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGN 275

Query: 251 LNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYF 310
           L T+PLVN    R    P+E  VTL  IG+ +G    K  T+  +K+ A+LDSGT+LT  
Sbjct: 276 LYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGS---KKTTITQTKLAAILDSGTSLTVL 332

Query: 311 PMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVR 370
           P              +      Y+V C+ R    T  ++DFGGF I+  LS++ ++    
Sbjct: 333 PGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNF-ILEIED 391

Query: 371 GTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAG--AVP 428
             C  G+     + VILGD FL  AYVV+DLE L++SMAQA ++     I+VI G   VP
Sbjct: 392 DICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVP 451

Query: 429 RAVRAPGYNDPWKAYTP 445
            A++APGY+  W A TP
Sbjct: 452 SAIKAPGYSSTWTA-TP 467

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  314 bits (805), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/432 (41%), Positives = 249/432 (57%), Gaps = 29/432 (6%)

Query: 29  QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVR 88
           ++V+M F KK G S S   S R++        ++V   + N+Q FYSV L+IGTP Q + 
Sbjct: 27  KYVKMPFVKK-GNSESSVLSKRSS-----GHENFV---LANEQSFYSVELAIGTPSQNLT 77

Query: 89  VLMDTGSSDLWVVGAG-VRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQ-FHIRYG 146
           VL+DTGS+DLWV G G   CG       + ++C ++G FD S+SST+K N +  F+  YG
Sbjct: 78  VLLDTGSADLWVPGKGNPYCG-------SVMDCDQYGVFDKSKSSTFKANKSSPFYAAYG 130

Query: 147 DSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQ-----QF 201
           D T+A G +G D+L     ++ GL F            LGIGL  +E T S +     + 
Sbjct: 131 DGTFAEGAFGQDKLKYNNLDLSGLPFAVANESNSTFGVLGIGLSTLEVTYSGKVAVMDKR 190

Query: 202 GYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANY 261
            Y+YDN P+ LK +  I  T YS+F+N+ +  +GS+LFGAVDHSKY+G L T+PLVN   
Sbjct: 191 SYEYDNFPLFLKHSGAIDATAYSLFLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYK 250

Query: 262 RRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXX 321
            +    PV   VTL  +GL T   + +  TL  +K PALLDSGTTLTY P Q        
Sbjct: 251 SQGYQHPVAFDVTLQGLGLQT---DKRNTTLTTTKFPALLDSGTTLTYLPSQAVALLAKS 307

Query: 322 XXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHS 381
               + S+ +GY         ++T+  +DFGGF+I +PLSD++M T+V GTC   ++P +
Sbjct: 308 LNASY-SKTLGYYEYTCPSSDNKTSIAFDFGGFRINAPLSDFTMQTSV-GTCALALIPQA 365

Query: 382 SD-YVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPW 440
            +   ILGD FL  AYVV+DL+  E+S+AQA Y   KE IE I   VP A RAP YN+ W
Sbjct: 366 GNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGKAKENIEAIKSTVPGATRAPSYNNTW 425

Query: 441 KAYTPLVFNGEL 452
             Y  +   G +
Sbjct: 426 STYASVTSGGNI 437

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/451 (38%), Positives = 251/451 (55%), Gaps = 15/451 (3%)

Query: 19  ASLVEREEAAQFVRMDFDKKRGPSFSEAWS-GRAAVPRLAKRN--DWVDIEIDNQQMFYS 75
           A  ++ E   +FV + F+KK G  +  A +  R     L KR+  D+ ++E+ NQQ FYS
Sbjct: 22  AQALDNELPNKFVNLRFNKKYGDHYDTASTDSRKPKLELVKRDGSDYEEVELTNQQSFYS 81

Query: 76  VNLSIGTPPQEVRVLMDTGSSDLWVVGA-GVRCGPNNYPNPNQLNCYEHGSFDTSRSSTW 134
           V + +GTP Q V VL+DTGSSD WV+G+    C  +   +   ++C E G+FD+S SST+
Sbjct: 82  VEVDVGTPSQRVTVLLDTGSSDFWVMGSDNPYCSDDT--STTGIDCSEFGTFDSSSSSTF 139

Query: 135 KDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMET 194
            +N T F+I YGD ++A GTWGTD + +    +D L+             +G+GL  +ET
Sbjct: 140 HNNGTAFNIHYGDGSFALGTWGTDTVSIDDITLDALSLAVANSSNSSMGVIGLGLAGLET 199

Query: 195 TMSSQQF-----GYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKG 249
           T SS         YQY N P+ LK   ++    YS+++N+    TG++LFGAVDHS Y G
Sbjct: 200 TYSSSHAVKSGQTYQYANFPLALKNAGIVAANAYSLYLNDPEETTGNILFGAVDHSLYSG 259

Query: 250 TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTY 309
            L T+PLVN          VE  VTL  IG+          T+  + + ALLDSGTTLTY
Sbjct: 260 QLYTIPLVNIYSGSGFKNAVEFDVTLNGIGIV--DSSGSATTVSTTPIIALLDSGTTLTY 317

Query: 310 FPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNV 369
           FP Q            + S    Y + C++ +   T  ++DFGGF I + L+D+ + +  
Sbjct: 318 FPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFGGFHINATLADFVVQSGT 377

Query: 370 RGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANY-EGGKEQIEVIAGAVP 428
             TC   I+P +S   ILGD FL  AYVV+DL+ LE+SMAQA + +   E IEVI+ +VP
Sbjct: 378 S-TCFLSIIPQNSSSAILGDTFLNNAYVVYDLDNLEISMAQAKWDQSSDEDIEVISSSVP 436

Query: 429 RAVRAPGYNDPWKAYTPLVFNGELGNLTATA 459
            AV+APGY++ W     +   G +  + A A
Sbjct: 437 SAVKAPGYSNTWSTTMSITSGGNIFTVNADA 467

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  310 bits (795), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 205/324 (63%), Gaps = 8/324 (2%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           ++C ++G+F+TS SST+  N+T F I YGDS+YA+GTWG D L L   ++ GL+F     
Sbjct: 179 IDCSQYGTFNTSASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHDIDIGGLSFAVANQ 238

Query: 178 XXXXXXXLGIGLPAMETT----MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAK 233
                  LGIGLP +E T     SS +  YQYDN P++LKRNNVIK   YS+F+N  N+ 
Sbjct: 239 TNSTVGVLGIGLPGLEVTYSGYASSARNRYQYDNFPLILKRNNVIKANAYSLFLNSTNSS 298

Query: 234 TGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLL 293
           +GS+LFGAVDHSKY G L TVPL+N         P++  V +  IG+ T        TL 
Sbjct: 299 SGSLLFGAVDHSKYSGQLYTVPLLNTLESSGYTDPIQFEVAVQGIGVRTSGSN---TTLT 355

Query: 294 GSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGG 353
            + +PALLDSG TL+YFP+Q            + S    YIVDC S     T  IYDFGG
Sbjct: 356 TTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSSD-DDTEIIYDFGG 414

Query: 354 FQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANY 413
           F I S L+DY + TN    C  GI+P +S+  ILGDVFLT AYVV+DL+  E+S+AQANY
Sbjct: 415 FHIASKLTDYILTTNRPSICVLGIVPQNSNRFILGDVFLTSAYVVYDLDNFEISLAQANY 474

Query: 414 EGGKEQIEVIAGAVPRAVRAPGYN 437
           EGG EQIEVI+ +VP A++AP Y+
Sbjct: 475 EGGDEQIEVISESVPSAIKAPSYS 498

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 1   MIAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN 60
           M   I A+  +L+  V  + L +R  + ++V + FDK RG ++ E+         L+KR+
Sbjct: 1   MRFDIIAISLLLSQLVTASVLKKR--SPKYVSLPFDKSRGSTYEESSKHNKPYAVLSKRD 58

Query: 61  D-WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
           D + +IE+ NQ  F+SV L IGTP Q V VL+DTGSSDLWV G+
Sbjct: 59  DGFQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGS 102

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  311 bits (798), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 206/329 (62%), Gaps = 10/329 (3%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           +NC ++G+FDTS+SSTW  N+T F I+YGDST+A GTWG D L L   NV GL+F     
Sbjct: 192 INCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFAVANR 251

Query: 178 XXXXXXXLGIGLPAMETTMS-----SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNA 232
                  LGIGLPA+E T S     S Q  YQYDN P+VL RN  IK   YS+F+N  +A
Sbjct: 252 TNSTVGVLGIGLPALEVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLNNASA 311

Query: 233 KTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
           +TGSVLFGAVDHSKY G L T+P+VN    +    P++  VTL  +G+ +  D   + T 
Sbjct: 312 ETGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDNTTITT- 370

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFG 352
             +K+PALLDSGTTLTY P Q             +S   GY V     +   T  ++DFG
Sbjct: 371 --TKIPALLDSGTTLTYLP-QALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFG 427

Query: 353 GFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412
           GF I +P++++ ++ +   +C  GIMP S   +ILGD FL  AYVV+DLE  E+SMAQAN
Sbjct: 428 GFHINAPITNF-IIGSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQAN 486

Query: 413 YEGGKEQIEVIAGAVPRAVRAPGYNDPWK 441
           Y GG+E IEVI+ +VP AVRAPG++  W 
Sbjct: 487 YAGGQEDIEVISSSVPGAVRAPGFSSTWS 515

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 61/93 (65%), Gaps = 8/93 (8%)

Query: 19  ASLVEREEAAQ------FVRMDFDKKRGPSFSEAWSGRA-AVPRLAKR-NDWVDIEIDNQ 70
           AS+    +AA+      +V++DFDK  G +F  A  GR+ A  R+ KR N + +++I NQ
Sbjct: 10  ASVAAHSKAAKNVADLSYVKLDFDKYYGETFETAKRGRSQADIRVNKRANGYEEVQITNQ 69

Query: 71  QMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
             FYSV L +GTPPQ V VL+DTGSSDLW+ G+
Sbjct: 70  NSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGS 102

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  315 bits (806), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 186/435 (42%), Positives = 251/435 (57%), Gaps = 33/435 (7%)

Query: 29  QFVRMDFDKKR-GPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEV 87
           ++VR+ F K++ GP       G     R     ++V   + N+Q FYSV L++GTP Q V
Sbjct: 28  KYVRIPFAKRQNGP-------GSELGKRAGGDENFV---LSNEQSFYSVELALGTPSQNV 77

Query: 88  RVLMDTGSSDLWV-VGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQ-FHIRY 145
            VL+DTGS+DLWV   A   CG       + +NC ++G FD + SST+  N++  F+  Y
Sbjct: 78  TVLLDTGSADLWVPSNANPYCG-------SAMNCDQYGVFDKANSSTFTANHSAPFYASY 130

Query: 146 GDSTYAHGTWGTDRLDL-GQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQ----- 199
           GD T+A G +G D+L   G  ++ GL+F            LGIGLP +E T S +     
Sbjct: 131 GDGTFAEGVFGQDKLHYSGGLDLSGLSFAVANKSNSTVGVLGIGLPMLEVTYSGKVAVAD 190

Query: 200 QFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNA 259
           +  YQYDN P+ LKR+  I  T YS+F+N+    +GSVLFGAVDHSKY G L T+PLVN 
Sbjct: 191 KRSYQYDNFPLFLKRSGAIDATAYSLFLNDETQTSGSVLFGAVDHSKYLGQLYTIPLVNL 250

Query: 260 NYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXX 319
              +   +PV   VTL  +GL T R  +   TL  +++PALLDSGTTLTY P        
Sbjct: 251 YKAQGYQRPVAFDVTLQGLGLQT-RAHNT--TLTTTRIPALLDSGTTLTYLPADAVALMA 307

Query: 320 XXXXXXWHSEEVGYI-VDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIM 378
                 + S+E+GY    C +   + T+ ++D GGF I +PLSD++M TNV GTC   I+
Sbjct: 308 KSLNATF-SKELGYYEYACPTSGDNATSVVFDLGGFHINAPLSDFTMQTNV-GTCVLAIV 365

Query: 379 PHSSD-YVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYN 437
           P + +   ILGD FL  AYVV+DL+  EVS+AQA Y  GKE IE I  +VP A RAPGYN
Sbjct: 366 PQAGNATAILGDSFLRSAYVVYDLDNYEVSLAQAKYGSGKEDIEAIRSSVPGATRAPGYN 425

Query: 438 DPWKAYTPLVFNGEL 452
             W  Y  +   G +
Sbjct: 426 STWVNYASVTSGGNI 440

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  307 bits (787), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 172/445 (38%), Positives = 252/445 (56%), Gaps = 23/445 (5%)

Query: 27  AAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDNQQMFYSVNLSIGTPPQ 85
           A  +V M F+KK G +++ A   +    RLAKRN  + +I + NQQ F+SV L +GTP Q
Sbjct: 18  AKDYVGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEEITLTNQQSFFSVELDVGTPAQ 77

Query: 86  EVRVLMDTGSSDLWVVGA-GVRC------GPNNYPNPNQLNCYEHGSFDTSRSSTWKDNN 138
            V VL+DTGSSDLW+ GA    C      G ++ P  ++++C E+G+F    SSTW  N+
Sbjct: 78  NVTVLVDTGSSDLWITGADNPYCLTYSGSGADSIPRRDRVDCSEYGTFSLEDSSTWSQNS 137

Query: 139 TQ--FHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTM 196
           +   F+I YGD+T+A G WG D L L   NV G++F            +GIGLP +ETT 
Sbjct: 138 SAPPFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVANRTNSTVGVMGIGLPGLETTN 197

Query: 197 SSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPL 256
           S  +  Y Y N P VLK +   +  +YS+++N+L  + GS+LFGAVDHSKY G++ T+P+
Sbjct: 198 SGSR-PYTYANFPQVLKNSGATQSALYSLYLNDLEEERGSILFGAVDHSKYTGSMYTLPI 256

Query: 257 VNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXX 316
           +N         P++  +TL  IGL +        T+  +K+PALLDSGTT+TY P     
Sbjct: 257 INRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTITSTKMPALLDSGTTMTYLPSNIVS 316

Query: 317 XXXXXXXXXWHSEEVGYIVDCNS--RRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCR 374
                      +    Y++ C++    +H    +YDFGGF I S L++Y ++   +  C 
Sbjct: 317 QIAQQLGASMSARFGQYVLPCSNVPENMH---LVYDFGGFHINSNLTNY-IVQASQTLCI 372

Query: 375 FGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANY--EGGKEQIEVIAGA--VPRA 430
            G+ P  S+  ILGD FLT AYVV+DLE L++ +AQA +       +I+++ G+  +P A
Sbjct: 373 LGLFPRDSNTAILGDTFLTDAYVVYDLENLQIGLAQAKFGVSDSDAKIDIVTGSAGIPSA 432

Query: 431 VRAPGYNDPWKAYTPLVFNGELGNL 455
            RAP Y+  W      V  G  GN+
Sbjct: 433 QRAPDYSSTWSTSVGTVTTG--GNI 455

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  301 bits (770), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 174/476 (36%), Positives = 255/476 (53%), Gaps = 55/476 (11%)

Query: 5   IAALGAVLATNVACASL---VEREEAA--QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR 59
            AA   +L+  V C S+   +E EEA+  + V+  F+K +G +F+       A   L+KR
Sbjct: 7   FAACCVLLSETVQCISVRHYLEEEEASSPKLVKFSFNKHQGRTFT-------ASEELSKR 59

Query: 60  NDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA-------------GVR 106
           +  V  ++ N+Q FYS+ LS+GTP QEV VL+DTGSSDLW+ G+               +
Sbjct: 60  DKDVTFDLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYCKESSSFSISNQ 119

Query: 107 CGPNNYPNPNQ--------------------LNCYEHGSFDTSRSSTWKDNNTQFHIRYG 146
              N    P Q                    L+C E G+F+   S T+  N+T+F + YG
Sbjct: 120 GKENGAEGPFQTLPGGVTATNMSGGSTASATLDCKEFGTFNREDSKTFHSNDTEFSVSYG 179

Query: 147 DSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMS-----SQQF 201
           D++YA GTWG D +++   N+  ++             +GIGL  +E T +       + 
Sbjct: 180 DTSYAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGLSNLENTYTGVENVKNRN 239

Query: 202 GYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANY 261
            ++Y N PM+LK    I+K VYS+F+N   A  GS+LFGAVDHSKY G L TVP++N   
Sbjct: 240 THKYLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVDHSKYSGQLYTVPMLNLYQ 299

Query: 262 RRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXX 321
           ++ +  P++L VTL  +G+      +   T   + VPALLDSGTTL Y P +        
Sbjct: 300 QQGLKDPLQLQVTLQGVGIEANNMTNTTST---TPVPALLDSGTTLVYLPDKMLAMLAEQ 356

Query: 322 XXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHS 381
               W      Y+ DC+  R+  T   ++FGGF I S +S Y +  +   +C  G+ P  
Sbjct: 357 LNAHWDRGIGYYVTDCS--RVDNTNLYFNFGGFNIVSNMSTYVVSRSNENSCVLGLQPGG 414

Query: 382 SDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYN 437
            +  ILGD+F+  AY+VFDL+  E+SMAQANY GGK Q+E +   VP A++APGY+
Sbjct: 415 PEAAILGDMFMQHAYIVFDLDDFEISMAQANYAGGKNQLEAVTQQVPSAMKAPGYS 470

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  301 bits (771), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 161/363 (44%), Positives = 214/363 (58%), Gaps = 11/363 (3%)

Query: 100 VVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDR 159
           V    +R  P++      L+C E G+FDTS+SS+W+ N+T+F+I Y D T+A G WG D 
Sbjct: 174 VAATSIRSVPSSLAT---LDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDE 230

Query: 160 LDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFGY---QYDNLPMVLKRNN 216
           + L   NV GL+F            LGIGL   E+T S Q   Y   QYDN P+VL+RN 
Sbjct: 231 IHLDDVNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTYNRYQYDNFPIVLQRNG 290

Query: 217 VIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLA 276
           VI+K  YS+F+N+L+A +GS+LFGAVDHSKY GTL TVP+VNA       + + L +TL 
Sbjct: 291 VIEKNAYSVFLNDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQ 350

Query: 277 AIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVD 336
            IG+ +       +T+  +K PALLD+G T  YFP              + S    Y VD
Sbjct: 351 GIGVTSSYGN---ETVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVD 407

Query: 337 CNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAY 396
           C+S   +    ++DFGGF I SPLSDY + T+    C  GI+P S + + LGD FLT AY
Sbjct: 408 CDSGSDYD--LVFDFGGFHIISPLSDYIVTTSSSSQCVLGILPQSDNEITLGDAFLTSAY 465

Query: 397 VVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGELGNLT 456
           VV+DLE LE+S+AQA+Y  G E+IEVI  +VP AV APGY+  W     L   G +  +T
Sbjct: 466 VVYDLEELEISLAQASYTSGDEKIEVIRDSVPSAVAAPGYSSTWSTAASLSTGGNIFTVT 525

Query: 457 ATA 459
             A
Sbjct: 526 NNA 528

 Score = 92.4 bits (228), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 66/105 (62%), Gaps = 7/105 (6%)

Query: 7   ALGAVLATNVACASLVER------EEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN 60
            LGA+LA+  +   + +R      E   + V M FDK RG   SEA   +  V  L KR 
Sbjct: 7   CLGALLASLGSAGYITKRDVSQVGEANKKHVFMSFDKLRGNDASEASLSKRRVGHLKKRA 66

Query: 61  D-WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG 104
           D +VD+EIDNQ  FYSV+L IGTP Q+V VL+DTGSSDLWV G+G
Sbjct: 67  DGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSG 111

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  300 bits (767), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 165/452 (36%), Positives = 258/452 (57%), Gaps = 22/452 (4%)

Query: 17  ACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDNQQMFYS 75
           A AS  +     +++ ++F+K+ G SF  + S      +L KR+D +  + + NQQ FYS
Sbjct: 20  ASASSKDNTSPPKYLALNFEKRYGDSFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYS 79

Query: 76  VNLSIGTPPQEVRVLMDTGSSDLWVVGA-GVRCGPNN-----YPNPNQ--LNCYEHGSFD 127
           V + +GTP Q++ VL+DTGSSD WV  +    CG  +     Y    Q  ++C  +G+FD
Sbjct: 80  VEVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGTTSTEGSLYGGETQDTIDCSTYGTFD 139

Query: 128 TSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQA-NVDGLTFXXXXXXXXXXXXLG 186
           +S+SST++ N+T F I YGD ++A GTWGTD + L  + +++ ++             LG
Sbjct: 140 SSKSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLG 199

Query: 187 IGLPAMETTMSS-----QQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGA 241
           IGL  +ETT SS     ++  Y YDN P+ LK++ +I+ T YS+++N+ ++K+G++LFG 
Sbjct: 200 IGLRPLETTYSSTKSVNEKTSYMYDNFPISLKKSGLIESTAYSLYLNDPSSKSGNILFGG 259

Query: 242 VDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALL 301
           VDHSKY G L TVP++++    +   PVE  VTL  IG+       K  TL  ++   LL
Sbjct: 260 VDHSKYTGQLYTVPMLSSTTSYKT--PVEFDVTLNGIGIIDSSGNKK--TLTATQFYGLL 315

Query: 302 DSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLS 361
           DSGTT +Y P              + S    Y +DC++     T  ++D GGF I + LS
Sbjct: 316 DSGTTFSYLPSALVAMIGEELGASYDSNIGYYTIDCSAEDSDDTKIVFDMGGFHINTTLS 375

Query: 362 DYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKE-QI 420
           D+ +  +   TC   I+P     V+LGD FL  AY+V+DL+  E++MAQA ++  +E  I
Sbjct: 376 DFVIQISTS-TCILSIVPQDGK-VVLGDSFLNNAYIVYDLDNYEIAMAQAAWDSTREANI 433

Query: 421 EVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           +VI+  +P A+RAPGY+  W     +   G++
Sbjct: 434 DVISTTIPSAIRAPGYSSTWSTSRSISSGGDI 465

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  295 bits (756), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 178/445 (40%), Positives = 246/445 (55%), Gaps = 24/445 (5%)

Query: 29  QFVRMDFDKKRGPSF--SEAWSGRAAVPRLAKRNDWVD-IEIDNQQMFYSVNLSIGTPPQ 85
            +V + F K  G SF  S  WS       LAKR    + +++ N+Q FYSV+L IGTP Q
Sbjct: 33  DYVNLKFKKTYGDSFEGSTTWSA------LAKRTRGYELVDLVNRQNFYSVDLDIGTPSQ 86

Query: 86  EVRVLMDTGSSDLWVVGAG----VRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQF 141
            + VL+DTGSSDLWV G+     V    N   + N+ +C  +G+FD ++SSTW  N+T F
Sbjct: 87  TITVLVDTGSSDLWVTGSDNPYCVSVKSNLVSSTNKFDCNTYGTFDKNQSSTWSSNDTLF 146

Query: 142 HIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT-MSSQQ 200
            I YGD+++A GTWG D+L L   +V GL+F            LGIGLP +E T +++ +
Sbjct: 147 SITYGDTSFARGTWGQDKLHLDDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVTYINAPR 206

Query: 201 FGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNAN 260
             YQYDN PM+LK +      +YS+ ++   A+ G+VLFGAVDHSKY G+L T+PLVN  
Sbjct: 207 NRYQYDNFPMILKNSGATHSNLYSLHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTL 266

Query: 261 YRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXX 320
                + P +  VTL  +G+     +  +     +K+ ALLDSGTTLTY P         
Sbjct: 267 KTHGFSDPAKFEVTLQGVGIVANNTQTTLTN---TKIAALLDSGTTLTYLPQALVQVIAD 323

Query: 321 XXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPH 380
                W S    YIV C +     T  ++DFGGF I   L+D+ ++      C   I+  
Sbjct: 324 SIGARWSSRYGYYIVSCRAVENSDTTLVFDFGGFHINGKLTDF-IVETFGNVCLLTIIEE 382

Query: 381 S-SDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQ-IEVIA--GAVPRAVRAPGY 436
           + S+  ILGD FL  AYVVFDLE  E+SMAQA +    +Q IE++     V  AV A GY
Sbjct: 383 TGSNSAILGDNFLINAYVVFDLENNEISMAQALHNVDDDQDIEIVTSNAGVASAVTALGY 442

Query: 437 NDPWKA--YTPLVFNGELGNLTATA 459
           +  W A   T   F G++  ++A A
Sbjct: 443 SSTWTAEPSTIETFAGDIFTVSAGA 467

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  288 bits (736), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 157/378 (41%), Positives = 218/378 (57%), Gaps = 21/378 (5%)

Query: 90  LMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDST 149
           +M TG+     V  GV     +      + C  +G+FD S+SST+K NNT F I YGD++
Sbjct: 129 MMMTGTGTETAVATGVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTS 188

Query: 150 YAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT--MSSQQFG----- 202
           YA G+WG D + + + NV G++F            LGIGLP +E T  +S+   G     
Sbjct: 189 YASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIA 248

Query: 203 ------YQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPL 256
                 YQY N PMVLK + +I K  YS+F+N+   + GSVLFGAVDHSKY GTL TVPL
Sbjct: 249 AASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPL 308

Query: 257 VNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQ-TLLGSKVPALLDSGTTLTYFPMQXX 315
           V+  +    +KPVE  +TL  +G+    D+D  Q T+  + +PALLDSGTT++YFP Q  
Sbjct: 309 VDIYHDSASSKPVEFDITLYGLGV----DKDGSQSTIATTTIPALLDSGTTISYFPAQLA 364

Query: 316 XXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRF 375
                     + S    Y + C S     T  ++DFGGF I +PL D+ +  + + TC  
Sbjct: 365 NEIARKFNATYDSRSGFYTMSC-SYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQ-TCVL 422

Query: 376 GIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGG-KEQIEVIAGAVPRAVRAP 434
            I P   ++V+LGDVFL+ AYVV+DLE LEVSMAQAN++    E +EVI+  VP AV+A 
Sbjct: 423 AIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAA 482

Query: 435 GYNDPWKAYTPLVFNGEL 452
            Y++PW +   +   G +
Sbjct: 483 SYSNPWSSAVMMSTGGNI 500

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 3/50 (6%)

Query: 56  LAKRND---WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG 102
           LAKR++   +  +++ NQ  FYSV+L IGTPPQ+V VL+DTGSSDLWV+G
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMG 54

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  288 bits (736), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 181/483 (37%), Positives = 259/483 (53%), Gaps = 43/483 (8%)

Query: 2   IAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN- 60
           +  I+A  A L + VA +          +V  +F K  G SF  A  G +   +L +R+ 
Sbjct: 4   LTSISAFAAGLVSVVAAS----ESSNGDYVSFNFGKSLGSSFHGA-RGGSRPGKLHRRDS 58

Query: 61  ---DWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG--------------A 103
              D     + N+++FYSV L+IGTPPQ++ VL DTGSSDLWV                A
Sbjct: 59  GSSDSALSVLKNEEVFYSVKLNIGTPPQDITVLFDTGSSDLWVSSNSNPFCEADGVNRRA 118

Query: 104 GVRCGPNNYPNPNQ----------LNCYEHGSFDTSRSSTWK-DNNTQFHIRYGDSTYAH 152
            ++        P+           ++C E G+F+ ++SST++   N  F I YGD T+A+
Sbjct: 119 DLKSSSTYSVAPSTTIDGFEVAPTVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGDGTFAN 178

Query: 153 GTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFG---YQYDNLP 209
           G W  D L L   ++  L F            LG+GL  +E+  S+  F     QY N P
Sbjct: 179 GLWAKDTLSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLES--SADPFDDEPSQYPNFP 236

Query: 210 MVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPV 269
           +VLK+NNVI K  YS++IN L+A+ GSVLFGAVDHSKY G L T+PLVNA  +  V++ +
Sbjct: 237 VVLKQNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEIL 296

Query: 270 ELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSE 329
           E  VT+  +G+ + ++  + +TL  ++ PAL+DSGTTL Y                   +
Sbjct: 297 EFDVTVQGLGIESKKNCFQ-KTLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDD 355

Query: 330 EVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGD 389
              Y  +C ++    T  ++DFGGFQI +PLS+Y + T+    C  G++P  S+  ILGD
Sbjct: 356 YELYTFECPAKD-DDTQLVFDFGGFQITNPLSNYVLETDDEKVCGLGVVPSYSN--ILGD 412

Query: 390 VFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFN 449
            FL  AYVVFDLE LE+S+ QAN   G E IE I   VP A +APGY+  W    P  ++
Sbjct: 413 EFLASAYVVFDLENLELSIGQANLNPGPEDIEPIISTVPGAQKAPGYSSTWTFNFPSGYS 472

Query: 450 GEL 452
            +L
Sbjct: 473 DDL 475

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  277 bits (709), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 164/442 (37%), Positives = 232/442 (52%), Gaps = 42/442 (9%)

Query: 32  RMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLM 91
           ++ F+K RG +F +A         +   N   + +I NQQ FYSV L +GTP Q V VL+
Sbjct: 27  KLSFNKLRGETFEKA---------VGNSNGHANFDIKNQQNFYSVELKVGTPAQNVLVLL 77

Query: 92  DTGSSDLWVVGAG-VRCGPN-----------------------NYPNPN-QLNCYEHGSF 126
           DTGSSDLW+ G+G   C P+                       N+P+ +  ++C ++G+F
Sbjct: 78  DTGSSDLWITGSGNPYCSPSTRNSHLGSAGSNSSTNNGPSSTANFPSSSATIDCSQYGTF 137

Query: 127 DTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG 186
           +   S T+K N++ F++ YGD ++A G WG D + L   NV  ++F             G
Sbjct: 138 NLDGSETFKSNDSTFYLTYGDGSFAKGLWGMDHVYLDGLNVSDVSFAVANESNSTVGVFG 197

Query: 187 IGLPAMETTMSSQQFG--YQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDH 244
           +GLP  E T++    G  YQY N P VLK N V++K  YS+++N  ++ +G++LFGAVDH
Sbjct: 198 VGLPGEEATVTPGVNGNHYQYKNFPQVLKDNGVVQKNAYSLYLNSPDSNSGNILFGAVDH 257

Query: 245 SKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSG 304
           SKY G L T+P+VN  Y  +   P E  VT+  I   T  +     T+   K  ALLDSG
Sbjct: 258 SKYSGNLYTLPIVNT-YADQGVAPREFDVTVQGI---TVGNSSSNSTVSSDKTLALLDSG 313

Query: 305 TTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYS 364
           TTL Y P              + S   GY +         T   +DFGGF I + LS+Y 
Sbjct: 314 TTLMYLPTALADELAKSLGGKF-SPSTGYYLIPKPSENDDTKITFDFGGFHIETKLSNYI 372

Query: 365 MM-TNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVI 423
           +  +  +     GI+    D  I GDVFL  AYVV+DLE  E+S+AQAN+  G   IE I
Sbjct: 373 LQGSGPQDVAILGILRTEGDRAIFGDVFLVDAYVVYDLEDYEISLAQANFNSGSSDIEAI 432

Query: 424 AGAVPRAVRAPGYNDPWKAYTP 445
           +G+VP A RAPGY+  +    P
Sbjct: 433 SGSVPGASRAPGYSQTYTGNQP 454

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  275 bits (704), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/464 (34%), Positives = 245/464 (52%), Gaps = 44/464 (9%)

Query: 10  AVLATNVACASLVE--REEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEI 67
            +LA+ V+ A++    RE + + +++ F+K  G     A + +  +   ++  D + +  
Sbjct: 10  GILASTVSGAAIENHRREVSPKIIQLSFNKHGG-----AANNKDILTPTSQNTD-ISVNA 63

Query: 68  DNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNN---------------- 111
            N+ +FYSV LS+GTP Q++ VL+DTGSSDLWV GA      N+                
Sbjct: 64  TNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHAVSDSNSTDKPLKSPT 123

Query: 112 YPNPN-QLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGL 170
            P+P   ++C ++G+FD S+SS++K N++   IRYGD +YA G +G D +++   ++  +
Sbjct: 124 LPSPQPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNV 183

Query: 171 TFXXXXXXXXXXXXLGIGLPAMETTMSS-----QQFGYQYDNLPMVLKRNNVIKKTVYSM 225
           +             LGIGL  +ETT +          Y Y+N P VLK   +I    YS+
Sbjct: 184 SLGVAHQANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSL 243

Query: 226 FINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGR- 284
           F+N   A  G +LFG VDHSKY G L TVP++N         P++  VTL  +G+   + 
Sbjct: 244 FLNSPGASQGGILFGGVDHSKYTGPLYTVPIINTG---APGNPIQFQVTLQGVGISLDKS 300

Query: 285 --------DEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVD 336
                   D     TL  SK P LLDSGTTL   P              ++SE   Y + 
Sbjct: 301 NGTNTNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLK 360

Query: 337 CNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAY 396
           C S+    T  I DFGGFQ+ + ++++ +  +  G C  GI P  +D   LGDVFL  AY
Sbjct: 361 CPSQN-DNTRLILDFGGFQVNAKITNH-ITRSQNGECLLGITPSDTDSGTLGDVFLVDAY 418

Query: 397 VVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPW 440
           VV+DL+  E+S+AQA++    + IE I+ +VP A +APGY++ W
Sbjct: 419 VVYDLDNYEISLAQADFSDSAQSIEPISSSVPSATKAPGYSNTW 462

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  278 bits (711), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 209/338 (61%), Gaps = 8/338 (2%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           ++C ++G+FD ++SST++ N T F   YGDST+A GTW  D L+LG  N+ GL+F     
Sbjct: 195 IDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHDVLNLGGLNITGLSFAVANM 254

Query: 178 XXXXXXXLGIGLPAMETTMS-SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGS 236
                  LGIGLP +ETT S S    YQY+N PM+LK++  I  T YS+F+++L+AK GS
Sbjct: 255 SNSTVGVLGIGLPGLETTYSGSTSKLYQYNNFPMLLKQSGAIDSTSYSLFLDDLDAKQGS 314

Query: 237 VLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSK 296
           VLFGAVDH+KY G L TVP+VN    +    P++  VTLA IG+   +++ K  T+  +K
Sbjct: 315 VLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQFDVTLAGIGI---QNDSKNYTVTTNK 371

Query: 297 VPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQI 356
            PALLDSGTT++YFP +            + S    Y + CN      T +++DFGGF I
Sbjct: 372 FPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSCNGVS-SSTNFVFDFGGFHI 430

Query: 357 RSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN--YE 414
             P+SD+ + T+   TC   + P  S +++LGD+FLT AYVV+DL+  E+S+AQAN   +
Sbjct: 431 TGPVSDFLLPTS-GNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEISLAQANTGTQ 489

Query: 415 GGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
                I++I+ +VP A++AP Y++ W    P+   G +
Sbjct: 490 NLDSNIQIISDSVPSAIKAPLYSETWSKAMPISTGGNI 527

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 10  AVLATNVACASLVERE---EAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN-DWVDI 65
           ++L TN+  +++ E E   +++++V + F+K  G S+ +A   +     L KR+  + ++
Sbjct: 13  SLLFTNILASTIPEHETTDQSSKYVILPFNKLVGDSYEDATPDKKPHFALVKRDGSYENV 72

Query: 66  EIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
            I N+Q FYSV L IGTP Q++ VL+DTGSSDLW++G+
Sbjct: 73  AIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGS 110

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  277 bits (709), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 182/522 (34%), Positives = 259/522 (49%), Gaps = 74/522 (14%)

Query: 3   AQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR--- 59
           A   A+  ++++       +E ++ +++VR+ FDK RG +  +A  G      L KR   
Sbjct: 7   AAFLAISGLVSSTAVSLQEIEPQDVSKYVRISFDKLRGDTAEDARVGLMPRAELVKRADG 66

Query: 60  ---------NDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG-----V 105
                    N++  +E+       +V L I T   ++ V+   GS++ +  G+      V
Sbjct: 67  SETIKIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVM---GSNNPFCEGSSRSSKHV 123

Query: 106 RCGPN------------------------------NYPNPNQ---------LNCYEHGSF 126
             G N                              +   P++         L+C  +G+F
Sbjct: 124 LLGENIGLEDETVKKDFFSSFRSLLTATATSTVSASAVAPSRTSVAASDATLSCSSYGTF 183

Query: 127 DTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG 186
            T  SS++K NNT F+I+YGD TYA GTWG D + L    V  L+             LG
Sbjct: 184 ATGSSSSFKSNNTDFYIQYGDLTYALGTWGHDDVTLQDITVSDLSMAVANESNSTFGVLG 243

Query: 187 IGLPAMETT-----MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGA 241
           IGL  +E T     +SS +  Y Y NLP +L     I +  YS+F+++L+A+ GSVLFGA
Sbjct: 244 IGLTGLEVTNVGSLVSSSRSAYTYQNLPALLVDQGKIHQNAYSLFLDDLDAEHGSVLFGA 303

Query: 242 VDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALL 301
           VDHSKY G L TVPLVN         P++L VTL  +G+   +      T   + +PALL
Sbjct: 304 VDHSKYTGNLYTVPLVNIYKSSGFPDPIQLDVTLQGLGMSANKTNITFTT---TPIPALL 360

Query: 302 DSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLS 361
           DSGTTLTY P              + S +VGY V   S        ++DFGGF I+S L 
Sbjct: 361 DSGTTLTYLPSSMVQSIARRLSAQY-SYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQ 419

Query: 362 DYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIE 421
           ++ ++      C  G++P SS   ILGD FLT AYVV+DLE LEVSMAQANY+GG E IE
Sbjct: 420 NF-LIKASSNFCALGLVPQSSSRAILGDNFLTAAYVVYDLENLEVSMAQANYDGGSEDIE 478

Query: 422 VIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL-----GNLTAT 458
           VI+  +P AV+APGY+  W +  P+   G +     GN T+T
Sbjct: 479 VISSTIPGAVKAPGYSSTWSSRIPISTGGNIFTVSGGNSTST 520

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  279 bits (714), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 162/443 (36%), Positives = 238/443 (53%), Gaps = 20/443 (4%)

Query: 26  EAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVD-IEIDNQQMFYSVNLSIGTPP 84
           EA  FV + F K+ G S S++   +     L KR+   D +E+ N+ +FY++++ IGTP 
Sbjct: 23  EAPGFVGVQFSKRYGKSISDSSLAKG---NLVKRSSGTDEVELINESVFYAIDMEIGTPK 79

Query: 85  QEVRVLMDTGSSDLWVVGAG-----VRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNT 139
           Q V VL+DTGSSD WV  +       +   +   + + ++C  +G+F  S SS++  NNT
Sbjct: 80  QSVTVLVDTGSSDFWVPSSTNPYCESKSATSTIASSDLIDCTTYGTFSVSDSSSFVYNNT 139

Query: 140 QFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQ 199
            F  +Y D + A G WG D +D G   +  ++             LGIGL  +E+T S  
Sbjct: 140 DFQTQYADGSSATGFWGHDVVDFGGQELSDISIAVADQTDSSFGVLGIGLTGLESTYSGS 199

Query: 200 QFG------YQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNT 253
                    YQYDN P+ L + NVI+   YS++++     +G++LFG VDH+KY G LNT
Sbjct: 200 AAASSSTGRYQYDNFPIRLVQENVIQANAYSLYLDPATGSSGTILFGGVDHNKYSGDLNT 259

Query: 254 VPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQ 313
           +PL+N         P++L VTL  +G+  G       T+  +++PALLDSGTTLTY P  
Sbjct: 260 IPLINTLEANGYTSPIKLQVTLNGLGVSDGS---STSTVTTTQIPALLDSGTTLTYLPTA 316

Query: 314 XXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTC 373
                       + S   GY++ C +     +  +YDFGGFQI++PL+  S+       C
Sbjct: 317 MFDLLAEQIGATYSSTSNGYVLSCANVD-EDSMIVYDFGGFQIQTPLAG-SLYQLSDDQC 374

Query: 374 RFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRA 433
              I   SS Y  LGD+FLT AYVV+DL+  E+SMAQ NY    E IE+I+ +VP A +A
Sbjct: 375 ELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINYNATTEDIEIISDSVPGATKA 434

Query: 434 PGYNDPWKAYTPLVFNGELGNLT 456
            GY + W     +   G +  LT
Sbjct: 435 AGYYNTWTTSESITAGGNIFTLT 457

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  276 bits (706), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 174/490 (35%), Positives = 250/490 (51%), Gaps = 66/490 (13%)

Query: 9   GAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEID 68
           GAVLA++ A  +        ++V+M F K R  SFS   SG  ++ R A  +D++ ++++
Sbjct: 14  GAVLASSQASPN--------KYVQMGFHKSR--SFS---SGGDSLARRA--DDYLSVDVE 58

Query: 69  NQQMFYSVNLSIGTPPQEVRVLMDTGSSDLW----------------------------- 99
           NQQ++YSV L +GTPPQ V VL+DTGSSDLW                             
Sbjct: 59  NQQLYYSVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYCIGFKQPGSAKFALEEKEAAN 118

Query: 100 --VVGAGVRCGPNNYPNP--------NQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDST 149
             V+ A    GP              +Q +C   G+F+ S SS++K NNT F   Y D+T
Sbjct: 119 ATVLTAQNAEGPTRSSKAAKATGGHLDQFDCALLGTFNNSESSSFKSNNTDFLTGYADNT 178

Query: 150 YAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT-----MSSQQFGYQ 204
           +A G WGTD + +G  +V  ++             LGIG+P +E++      +     Y+
Sbjct: 179 FASGFWGTDVVRIGDVDVSDVSLAVVNLTNSTSPVLGIGMPVLESSNAGRLAAETNSSYE 238

Query: 205 YDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRR 264
           YDN P+ LK   VI+K  YS+F+N+ +A  GSVLFGAVDHSKY+  L TVP+VN    + 
Sbjct: 239 YDNFPVQLKNKGVIEKIAYSLFLNDSDATEGSVLFGAVDHSKYENGLFTVPMVNTYKDQG 298

Query: 265 VNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXX 324
           V  P+E +VT+  +G    + +  + T+  +  P LLDSG+T +Y P             
Sbjct: 299 VQHPIEFYVTMYGLGF---KKDGFLNTITTTNFPVLLDSGSTTSYLPDTLVSMLASALNA 355

Query: 325 XWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDY 384
            +  +  GY + C S     T   +D GGF I  PLSD  +    +  C   +       
Sbjct: 356 TFSEKINGYTLKCPSEE-DATFLSFDLGGFLIDVPLSDL-VAKRHKNQCVLMVKGQGEGE 413

Query: 385 --VILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKA 442
              ILGD FL+ AYVV+DLE+ E+S+ QA+     E IEVI   VP AVRAP Y+ PW  
Sbjct: 414 GGYILGDTFLSSAYVVYDLESYEISIGQASTGDAAEDIEVIKSTVPGAVRAPFYDRPWTG 473

Query: 443 YTPLVFNGEL 452
            T +  +G +
Sbjct: 474 GTVISMSGNI 483

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  277 bits (708), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 198/341 (58%), Gaps = 8/341 (2%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           ++C  +G FD+S+SST++ N T F I YGD T+A GTWG D+L+L   NV GL+F     
Sbjct: 175 IDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNNLNVTGLSFAVANE 234

Query: 178 XXXXXXXLGIGLPAMETT-----MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNA 232
                  LGIGL  +E+T     +SS Q  Y Y+N PMVLK +  IK   YS+F+NE NA
Sbjct: 235 TNSTVGVLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLNETNA 294

Query: 233 KTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
           K GS+LFGAVDH KY G L T+P++N         P++  VTL  +GL  G  E    T+
Sbjct: 295 KHGSILFGAVDHGKYSGDLYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDSEST--TI 352

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFG 352
             +K+PALLDSGTT++Y P++            + S+   Y++DC +        ++DFG
Sbjct: 353 TTTKIPALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFG 412

Query: 353 GFQIRSPLSDYSMMTNVRG-TCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           GF I   LS Y +  +     C  G  P S   VILGD FL+ AYVV+DL+ +E+SMAQ 
Sbjct: 413 GFYISGNLSSYQLSADSSSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMAQV 472

Query: 412 NYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           +  G  E I+VI  +VP AV+AP Y+  W     +V  G++
Sbjct: 473 DLSGRSEDIDVIEDSVPSAVKAPSYSSTWSTDGSIVSGGDI 513

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 1/75 (1%)

Query: 30  FVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVDIEIDNQQMFYSVNLSIGTPPQEVR 88
           +VR+ F KK G SF  A S +    RL KR +D+  +++ NQ  FYSV+L IGTP Q+V 
Sbjct: 36  YVRIQFQKKYGDSFENASSNKKTEARLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVT 95

Query: 89  VLMDTGSSDLWVVGA 103
           VL+DTGSSDLWV G+
Sbjct: 96  VLVDTGSSDLWVTGS 110

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  271 bits (693), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 143/335 (42%), Positives = 198/335 (59%), Gaps = 11/335 (3%)

Query: 122 EHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXX 181
           E+G+F+T+ SSTW  N+T F I YGDS+ A G WG D L +   +V G++F         
Sbjct: 186 EYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNST 245

Query: 182 XXXLGIGLPAMETTMS--SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLF 239
              LGIGL  +ETT S  S    Y Y+NLPM+LK + VI    YS+F+NE +  TG++LF
Sbjct: 246 VGVLGIGLSGLETTYSGTSSSESYIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGNLLF 305

Query: 240 GAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPA 299
           GAVDHSKY G+L T+P+VN         P+E  VT+  +G+ T      + T+   K+PA
Sbjct: 306 GAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATM---KIPA 362

Query: 300 LLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG-YIVDCNSRRLHQTAYIYDFGGFQIRS 358
           LLDSGTT+ YFP +             +S+E+G Y + C S     T +++DFGGF I  
Sbjct: 363 LLDSGTTIVYFP-ETLLELVADQLGASYSDELGFYAMSCVSSS-DDTEFVFDFGGFHITV 420

Query: 359 PLSDYSMMTNVRGT-CRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGK 417
           PLSD+  +  V G+ C   +     + +ILGD FLT AYVV+DLE  E+SMAQANY+   
Sbjct: 421 PLSDF--LIRVSGSECILAMAAQDDESIILGDYFLTNAYVVYDLENYEISMAQANYDSED 478

Query: 418 EQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           E IEVI+  VP AV+A  Y++ W +   +   G++
Sbjct: 479 EDIEVISSTVPSAVKAASYSNSWSSTGSITSGGDI 513

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 58/103 (56%), Gaps = 12/103 (11%)

Query: 8   LGAVLATNVACASLVEREEAA-------QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN 60
           L   L T +  AS+V ++          +++++ FDK  G SF      +++   L KR 
Sbjct: 10  LSTSLITALTDASIVAKDSKQPSDFNKNKYLKLGFDKYVGESFD-----KSSKDSLQKRA 64

Query: 61  DWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
           ++    + NQ  FYSV L+IGTP Q V VL+DTGSSDLWV G+
Sbjct: 65  EYAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGS 107

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 148/345 (42%), Positives = 207/345 (60%), Gaps = 15/345 (4%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           L+C E+G+F++SRSST+K+N T F I YGDST+A GTW  D L+L   NV GL+F     
Sbjct: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301

Query: 178 XXXXXXXLGIGLPAMETTMS-----SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNA 232
                  LGIGLPA+E+T S     +Q+  YQY N PMVLK++  I  T YS+F+++L+ 
Sbjct: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361

Query: 233 KTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
             GSVLFGA+DHSKY G L TVP++N       + P++  VTL  IGL  G   ++  TL
Sbjct: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG---ERNLTL 418

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFG 352
             +K+ ALLDSGTT++YFP              + +    Y V C S     T  ++DFG
Sbjct: 419 TTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVS-SNTNLVFDFG 477

Query: 353 GFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412
           GF I  PL D+ + T+ + TC   + P  S +VILGD+FLT AYVV+DL+   +++AQA+
Sbjct: 478 GFHISGPLQDFLIQTS-QQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALAQAD 536

Query: 413 ----YEGGKEQIEVIAGA-VPRAVRAPGYNDPWKAYTPLVFNGEL 452
                +     IE+I  + +PRA+RAP Y++ W A  P+   G +
Sbjct: 537 TSTSNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNI 581

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 54/80 (67%), Gaps = 5/80 (6%)

Query: 29  QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-----WVDIEIDNQQMFYSVNLSIGTP 83
           ++V++ F+K  G SF  A      + +L KR++     + D++I NQQ FYSV L+IGTP
Sbjct: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115

Query: 84  PQEVRVLMDTGSSDLWVVGA 103
           PQ V VL+DTGS+DLWV G+
Sbjct: 116 PQHVTVLVDTGSADLWVTGS 135

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  264 bits (674), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 173/452 (38%), Positives = 236/452 (52%), Gaps = 55/452 (12%)

Query: 27  AAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVDIEIDNQQMFYSVNLSIGTPPQ 85
           A  ++++DF   R PS S           L KR +D   + + N    Y V L++GTPPQ
Sbjct: 13  AQAYLKLDF--TRVPSAS----------VLEKRADDLSPVPLRNDVDQYIVQLAVGTPPQ 60

Query: 86  EVRVLMDTGSSDLWVVGA-GVRCGPNN----------------YP-NPNQ-------LNC 120
            V V +DTGS+DLW  GA    C  N                 +P NP+Q       L+C
Sbjct: 61  MVSVQLDTGSADLWFSGADNPYCKTNKKKAPKSKDLQPVDNSGFPTNPDQIGKKARNLDC 120

Query: 121 YEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXX 180
            ++G F+ S SST+K+N+T   + Y D ++  GTWGTD + LG  N+ G+ F        
Sbjct: 121 KKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEISNS 180

Query: 181 XXXXLGIGLPAMETTMSSQQFG------YQYDNLPMVLKRNNVIKKTVYSMFINELNAKT 234
               LG+ LP+ E+T S    G      YQY NLP+ LK   +I K  YS+++N+  +K 
Sbjct: 181 SSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQGIIDKVTYSIYLNDTKSKY 240

Query: 235 GSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLG 294
           GS+LFGAVDHSKY GTL T+PLVN+ Y   VNKP EL +TL  IG  +        TL  
Sbjct: 241 GSILFGAVDHSKYTGTLYTLPLVNSEY-DVVNKPYELDITLNGIGYQSMSSN---MTLYD 296

Query: 295 SKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGY-IVDCNSRRLHQTAYIYDFGG 353
            KV AL+DSGTT++ FP +                  G  +  C S++      +++ GG
Sbjct: 297 QKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSKK-DNAKLLFNLGG 355

Query: 354 FQIRSPLSDYSMMTNVRGTCRFGIMPH--SSDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
             I   + +++  T V+G C   I+P    SD VILGD F+   Y VFDLEA EVS+AQA
Sbjct: 356 ALIYVDIKEFT--TKVKGKCYLEIIPSGAESDLVILGDNFMRSVYTVFDLEANEVSIAQA 413

Query: 412 NYEGG-KEQIEVIAGAVPRAVRAPGYNDPWKA 442
           N+      QIE I   VP AV+AP Y + + A
Sbjct: 414 NFNSSLPAQIEEIKSTVPSAVKAPQYYNTFSA 445

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  265 bits (677), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 162/505 (32%), Positives = 250/505 (49%), Gaps = 56/505 (11%)

Query: 6   AALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVD 64
           +    +L   +   S++E  E ++ V + F K +G +FS +        RL+KR +D+ +
Sbjct: 5   SVFAVLLLPALGVGSVIE-PETSKHVSIPFKKAKGKTFSGSADSNKWRNRLSKRGDDYEN 63

Query: 65  IEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA-GVRCGPN------------- 110
           + +   ++ Y V LS+GTP Q+  V +DTGSSDLWV  +    C P+             
Sbjct: 64  LGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYCMPSETTHNEKVYGEAA 123

Query: 111 -----------------------NYPNPNQ----------LNCYEHGSFDTSRSSTWKDN 137
                                  + P+  Q          ++C   G+F+ + SS++  N
Sbjct: 124 YGETAFDQTALDQFETLLASATEDDPSYTQTEAVPSSEATIDCASFGTFNYTLSSSFSAN 183

Query: 138 NTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTM- 196
           +T+F+I Y DST A+G W  D L LG   +  + F             G+G P  E+T  
Sbjct: 184 DTEFYISYLDSTAAYGIWAQDVLKLGDLEISDMPFAVAVVGDVQTPVFGVGFPGTESTAG 243

Query: 197 SSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPL 256
           SS +  Y+Y N P++LK    +KK VYS+F++  ++ +GS L GAVDHSKY G L T+P+
Sbjct: 244 SSVKEPYEYANFPVLLKSQGYVKKVVYSLFLDAQDSSSGSFLLGAVDHSKYSGGLYTLPM 303

Query: 257 VNANYRRRV--NKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQX 314
            +         + P    +TL  +G+    D+ + +T+  ++    LDSG+T T FP + 
Sbjct: 304 YSGTDGDDTLSSTPSRFIITLQGLGI---SDKGENKTVATTRSLVYLDSGSTGTVFPSEY 360

Query: 315 XXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCR 374
                      +  +   Y++ C S+    T ++YDFGGF I SPLS+Y   T     C 
Sbjct: 361 AELIADSLGASYSGDYEAYVMKCPSKD-DDTNFVYDFGGFTISSPLSNYMEATGDDSVCV 419

Query: 375 FGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAP 434
             I      Y++LGD FL  AYVV+DLE  E+S+AQANY+GG E IEV++ ++P AV+AP
Sbjct: 420 LDIDTDDIPYIVLGDAFLVSAYVVYDLEDYEISIAQANYDGGSENIEVVSDSIPSAVKAP 479

Query: 435 GYNDPWKAYTPLVFNGELGNLTATA 459
            Y+  W  Y      G +    A A
Sbjct: 480 FYSSTWSTYVTATSGGNIFTAVANA 504

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  269 bits (688), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 173/483 (35%), Positives = 243/483 (50%), Gaps = 57/483 (11%)

Query: 1   MIAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR- 59
           M    A L   LA  V C   V       +V +DF K +G S+ +A  G A   +L KR 
Sbjct: 9   MSVPCAMLALFLALFVPC---VIASSGMGYVAIDFAKAKGISYQDARVG-ARPAKLQKRA 64

Query: 60  ---NDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG-------------- 102
               + ++ E+ N  +FYSV L IGTPPQ+V VL DTGSSDLWV                
Sbjct: 65  LSQGETLNSELVNNNVFYSVGLDIGTPPQQVTVLFDTGSSDLWVSSNDNPYCSNGDSTES 124

Query: 103 ----------------------AGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQ 140
                                 +G+   P        ++C ++G+F+  RS++   N ++
Sbjct: 125 YANYRADLKSSSALTAAPTTTISGITIAPT-------IDCAQYGTFNADRSTSLFANYSK 177

Query: 141 -FHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMS-- 197
            F + Y D +YA G W  D+L +   ++  L F            LG+GL  +E+T+   
Sbjct: 178 PFFVSYNDDSYALGYWARDKLVVDGDDISSLEFAVAEISNSTVGVLGVGLQGLESTVHYR 237

Query: 198 SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLV 257
           S      Y N PMVLK N  I K  YS+++N L+A +GSVLFG VDHSKY G L T+PLV
Sbjct: 238 SPNISSIYPNFPMVLKENGAIDKIAYSLYLNSLDAPSGSVLFGGVDHSKYTGGLYTLPLV 297

Query: 258 NANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
           N      V  PV+  VT+  IG+ + +   + +T   +K+ AL+DSGTTL Y   +    
Sbjct: 298 NTYKDYGVKTPVQFDVTVQGIGIESEK-ACRQETFTTTKIAALMDSGTTLMYTAPEIVNK 356

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGI 377
                   +      ++  C S     T +I+DFGGFQI+SPLS+Y + T+    C  G+
Sbjct: 357 IALYVNASFSPGYGLFMFRCPSDG-DDTQFIFDFGGFQIKSPLSNYILRTDDENICGLGL 415

Query: 378 MPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYN 437
           +  S+   I GD FL  AYVV+DLE LE+S+AQAN+  G  +IE I   +PRA RA  Y 
Sbjct: 416 I-SSNQGTIFGDEFLASAYVVYDLENLELSLAQANWNPGSPEIEKIVSEIPRAQRASQYW 474

Query: 438 DPW 440
           + W
Sbjct: 475 NTW 477

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  262 bits (670), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 221/393 (56%), Gaps = 25/393 (6%)

Query: 56  LAKRN-DWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG--------VR 106
           L KRN + + + + N+Q+FY+ +L++GTPPQ + VL+DTGSSDLWV G+           
Sbjct: 41  LWKRNQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYCLSNETT 100

Query: 107 CGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQAN 166
             P+     + ++C  +G+F+   S T+  ++++F I Y D+T+A+G W  D +  G   
Sbjct: 101 TEPSKNITKSVVDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNF 160

Query: 167 VDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFGYQ------YDNLPMVLKRNNVIKK 220
           +  + F            LGIG   +E+       GY+      Y N P+ LK N VI K
Sbjct: 161 IADMQFAVANETNSTVGVLGIGFERLESVK-----GYEGAPNTYYQNFPLALKNNGVIDK 215

Query: 221 TVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGL 280
           T YS+++N L++ +GS+LFG +D +KY G L T PLVN  +   VNKP + HVT+  IG+
Sbjct: 216 TAYSLYLNSLDSSSGSILFGGIDSNKYTGDLYTFPLVNI-HPSVVNKPAKFHVTVQGIGV 274

Query: 281 HTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSR 340
            +   E  +  L+ +K PALLDSGTTL   P +            ++  E  Y + C   
Sbjct: 275 QSSGSEQSI--LMSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPE 332

Query: 341 RLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFD 400
               T +++DFG  +I+ PL ++ +       C FG++P + D +ILGD+FL+ AYVV+D
Sbjct: 333 N-DDTEFLFDFGDLKIKVPLKNFILAPEDNEYCGFGVLP-TVDTMILGDMFLSAAYVVYD 390

Query: 401 LEALEVSMAQANYEGGKEQIEVIAGAVPRAVRA 433
           LE+ EVS+AQAN+   + +I+ I   VP A +A
Sbjct: 391 LESYEVSLAQANWNSDESEIQAIRHTVPGATKA 423

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 142/342 (41%), Positives = 213/342 (62%), Gaps = 12/342 (3%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQA-NVDGLTFXXXX 176
           +NC  +G+FD   SST++ N T F IRY D+++A G WG D L      NV GL+F    
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 177 XXXXXXXXLGIGLPAMETTMS---SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAK 233
                   LGIGLP +E T +        Y YDN P+VLK +  I K+ YS+++N+ +AK
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAGVYQTTKPYTYDNFPLVLKNSGAIHKSAYSLYLNKQSAK 401

Query: 234 TGSVLFGAVDHSKYKG-TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
            G+VLFGA+DHS+Y+G TL T+PLVN++     +KP+E  VTL  +G+   R+ +   T+
Sbjct: 402 NGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGN--FTV 459

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG-YIVDCNSRRLHQTAYIYDF 351
             +++ ALLDSGTTLTYFP              + SE +G Y+++C   R   T  ++DF
Sbjct: 460 TTTQIVALLDSGTTLTYFPKDMLNLLAKRINASY-SEALGYYVMNCPDSR-DNTQLVFDF 517

Query: 352 GGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           GGF I++ L+++ ++++  G C  G++P++ +  ILGD+FLT AYVV++L+ LE+SMAQA
Sbjct: 518 GGFHIKTNLTNF-VLSSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMAQA 576

Query: 412 NYEGGK-EQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           N+  G  E IEVI+  +P AV+APGY+  +     +V  G++
Sbjct: 577 NFNNGNDEDIEVISSTIPNAVKAPGYSYTYSVSKSIVPGGDI 618

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)

Query: 55  RLAKRND-WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
           +L KR+D +  I+I NQQ FYSVNL IGTP Q + VL+DTGSSDLWV G+
Sbjct: 80  KLIKRHDGYEKIQIINQQSFYSVNLQIGTPAQSITVLVDTGSSDLWVTGS 129

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  265 bits (677), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 156/416 (37%), Positives = 226/416 (54%), Gaps = 25/416 (6%)

Query: 54  PRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYP 113
           P+L +R D   + +  Q  FYS++L+IGTP Q+V VL+DTGSSDLWV GA      NN  
Sbjct: 31  PQLVRREDGDSVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGA------NNPY 84

Query: 114 NPNQLN--CYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDL--GQANVDG 169
               L+  C E+G+FD  +SST++D N+   I Y D T   G WG D L+L  G   +  
Sbjct: 85  CQTSLSSECKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQN 144

Query: 170 LTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFG--YQYDNLPMVLKRNNVIKKTVYSMFI 227
                          +G+G P +ETT + Q  G  Y Y N PM LK+  V   TV+++ +
Sbjct: 145 TMIGVADSSDSVAGVIGLGFPGLETTNNVQANGESYTYANFPMQLKQQGVTDATVFAIAL 204

Query: 228 NELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDED 287
           +  N+  G +LFGAVD  KY G L T+P+VN+   R    P+ + VTL  IG+ +  D  
Sbjct: 205 D--NSYGGDILFGAVDEGKYIGGLYTLPVVNS---RGTATPIRMEVTLQGIGVDS--DGG 257

Query: 288 KVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAY 347
             +T   + + AL+DSG+T+ Y P              +      Y +DC +  +     
Sbjct: 258 DQETFSSTPMLALVDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGT-NVENDNL 316

Query: 348 IYDFGGFQIRSPLSDYSMMTNVR---GTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEAL 404
           I+DFGGF I +P+S+Y ++T+ R   G C FGI+  S + V+LGD FL+ AYVVFDL+  
Sbjct: 317 IFDFGGFHISTPVSNY-IITDQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHY 375

Query: 405 EVSMAQANYEGGKEQI-EVIAGAVPRAVRAPGYNDPWKAYTPLVFNGELGNLTATA 459
           E+SMAQ N   G   + +V +G +P A +AP Y+  W    P+   G +  L +T+
Sbjct: 376 EISMAQGNSNNGDGNVKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIFTLGSTS 431

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  262 bits (669), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 158/502 (31%), Positives = 246/502 (49%), Gaps = 66/502 (13%)

Query: 5   IAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVD 64
           IA+L + L  +     L   E   +++++DF        SE +   + +P L KR+ +  
Sbjct: 15  IASLTSALIVDKNVEQLSSNEN--KYLKLDFA-------SETFEKSSRLP-LQKRDTYAT 64

Query: 65  IEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG---------------------- 102
           + I + + +Y V LS+GTP Q V +L+DT SSD+WV                        
Sbjct: 65  VNI-SAEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLCDGDIFYDNVEKTAKHV 123

Query: 103 -------AGVRCGPNN------------------YPNPNQLNCYEHGSFDTSRSSTWKDN 137
                  + V  G +N                  YP    ++C   G+F+ + SSTW  N
Sbjct: 124 VVAAAEESTVSDGDSNGLLDGEPVSTTPFESSVIYPAEGLVDCGFFGTFNPNDSSTWSTN 183

Query: 138 NTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMS 197
           +T F I Y D++ A G WG D L +G  ++ G+ F            LGIGLP  ETT  
Sbjct: 184 HTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANYTNSSLGVLGIGLPGSETTYL 243

Query: 198 SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLV 257
           +    Y YDNLPMVLK++ VI    YS+ +   N  T  +LFGAVDHSKY G+L T+P++
Sbjct: 244 TNS--YMYDNLPMVLKKSGVIDSAAYSLLLAAYNNYTSGLLFGAVDHSKYSGSLYTIPMI 301

Query: 258 NANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
           N    R    PVE  VT+  +G+ +      + T+   K PALLDSG+T  +FP      
Sbjct: 302 NIYESRGYESPVEFDVTIYGLGISSTDSNTTIATM---KTPALLDSGSTAIFFPTTLLNL 358

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGI 377
                   +  E+  Y +  +   +   ++++DFGGF I  P+ +   ++         I
Sbjct: 359 AAEQLNATYSEEKGLYTIPYSPANI---SFVFDFGGFHINLPIRELCSVSYGEPEYILNI 415

Query: 378 MPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYN 437
           + H+ + ++LG+ FL RAYVVFD E  E+SM Q++Y+  +E IE I   VP AV+   Y+
Sbjct: 416 VAHNENRIVLGEAFLARAYVVFDFENYEISMGQSSYDYAEEDIEAIISTVPGAVKVASYS 475

Query: 438 DPWKAYTPLVFNGELGNLTATA 459
           + W ++  +   G++  +++ A
Sbjct: 476 NSWSSFGSITSGGDIFTISSNA 497

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  262 bits (670), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 170/491 (34%), Positives = 241/491 (49%), Gaps = 79/491 (16%)

Query: 22  VEREEAA-------QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN-------DWVDIEI 67
           VE +EA        +F+ + FD+  G S+ ++  G+     L KR         + D+ +
Sbjct: 31  VEAKEAKNIQPIKPKFLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSYEDVIL 90

Query: 68  DNQQMFYSVNLSIGTPPQEVRVLMD-----------------TGSSD----LWV------ 100
            NQ  FYSV L IGTP Q+V V++D                 TG  D    +W       
Sbjct: 91  TNQLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETSNPFCSTGDDDTEDSVWSPFLLKD 150

Query: 101 ---------------------------VGAGVRCGPN-NYPNPNQLNCYEHGSFDTSRSS 132
                                      +   +  G N   P    +NC E G+F+T +SS
Sbjct: 151 KIDPRVLKHKGKRTTSIDVTATATTGSINISIDLGSNFTLPPEFLINCTEFGTFNTKKSS 210

Query: 133 TWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAM 192
           T+K+N+T F I YGD+T+A G WG D L     NV GL+F            LGIGLP +
Sbjct: 211 TFKNNHTDFFISYGDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPEL 270

Query: 193 ETTM-----SSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKY 247
           E+T      S  +  Y Y+N P VLK + +I KT YS+F+N+ ++  GS+L GAVD SK+
Sbjct: 271 ESTYFGTVNSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKF 330

Query: 248 KGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTL 307
              L TVP++N N  +    P    V +  +   T     +   +  S++P LLDSGTT+
Sbjct: 331 ADKLYTVPMLNINPSKGYTDPSAFLVLMQKM---TRYKYGQGHLVPSSRIPVLLDSGTTM 387

Query: 308 TYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNS-RRLHQTAYIYDFGGFQIRSPLSDYSMM 366
            Y P              +  E   Y + C S  + +QT++ +DFGGFQI++ LSD+ + 
Sbjct: 388 VYLPRSIVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVP 447

Query: 367 TNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGA 426
           T+  G C FG++P   +  ILGD FLT AYVV+DLE  E+SMAQA Y+GG+     I   
Sbjct: 448 TD-NGQCIFGMIPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVYDGGEPNYIPIVST 506

Query: 427 VPRAVRAPGYN 437
           VP AVRA  Y+
Sbjct: 507 VPSAVRAKYYS 517

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  263 bits (673), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 204/345 (59%), Gaps = 10/345 (2%)

Query: 113 PNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQA-NVDGLT 171
           P+   +NC  +G+FD   SST++ N T F IRY D++YA G WG D L      NV GL+
Sbjct: 256 PSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLS 315

Query: 172 FXXXXXXXXXXXXLGIGLPAMETTMS---SQQFGYQYDNLPMVLKRNNVIKKTVYSMFIN 228
           F            LGIGLP +E T S        Y YDN P+VLK +  I K+VYS+++N
Sbjct: 316 FAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375

Query: 229 ELNAKTGSVLFGAVDHSKYKG-TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDED 287
           + NAK G+VLFGAVDHS+Y+G TL TVPLVN +     + P+E  +TL  +G+       
Sbjct: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGVTDNT--- 432

Query: 288 KVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAY 347
              T+  +++ ALLDSGTTLTYFP              + S+ +GY V         T  
Sbjct: 433 NNYTVTTTQIVALLDSGTTLTYFPKDMLNLLAKTINASY-SDALGYYVMNCPDSDDNTQI 491

Query: 348 IYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVS 407
           ++DFGGF I + L+++ ++++  G C  G++P++ +  ILGD+FLT AYVV++L+ LE+S
Sbjct: 492 VFDFGGFHINANLTNF-VLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEIS 550

Query: 408 MAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           MAQANY+   E IEVI   VP AV+APGY+  +     +V  G +
Sbjct: 551 MAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNI 595

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%)

Query: 55  RLAKRND-WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
            L KRND + +I+I NQQ FYSVNL IGTP Q + VL+DTGSSDLWV G+
Sbjct: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGS 136

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  257 bits (656), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 155/424 (36%), Positives = 225/424 (53%), Gaps = 44/424 (10%)

Query: 56  LAKRNDW-VDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG-AGVRCGPN--- 110
           L KR+D  + +E++N  + Y+V LS+GTPPQ + V +DTGSSDLW    A   C  N   
Sbjct: 31  LNKRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYCKNNRKH 90

Query: 111 -------------NYP-NPNQL-------NCYEHGSFDTSRSSTWKDNNTQFHIRYGDST 149
                        +YP +PNQ+       +C   G F+TS+SST+K+N T F + Y D+T
Sbjct: 91  SPKKSQIEPLNDADYPTSPNQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTT 150

Query: 150 YAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFG------- 202
           +A G WG D L      VD +TF             GI LPA ETT      G       
Sbjct: 151 FASGPWGVDTLSFNGVKVDNVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNS 210

Query: 203 YQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYR 262
           Y+Y N PM+LK   ++KK  YS+++N+  +K GS+LFGAVD SKY GTL T+PLVN+ Y 
Sbjct: 211 YEYSNFPMLLKEQGIVKKIAYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLY- 269

Query: 263 RRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXX 322
           ++V+KP +  +TL  IGL T    DK  TL   K+  LLD+G T +  P +         
Sbjct: 270 KQVSKPFQFEITLNGIGLQTA---DKNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKV 326

Query: 323 XXXWHSEEVGYIV--DCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPH 380
                 +  G+I    C +++  +T  +++FGG +I   + D  +   ++G C   +   
Sbjct: 327 NGTIDDDN-GFIKLDKCPNKKEKRTV-VFNFGGAEISIDIRD--LTRKIKGKCYLQMQAR 382

Query: 381 SS-DYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDP 439
              ++  LGD+FL   YVV++LE  E+S+A AN+      I+ I   VP AV+AP Y + 
Sbjct: 383 DDIEFAALGDIFLRHVYVVYNLEDEEISIANANFNYSTPDIQEIVSTVPGAVKAPQYYNT 442

Query: 440 WKAY 443
           +  Y
Sbjct: 443 YSVY 446

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  261 bits (666), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 192/343 (55%), Gaps = 12/343 (3%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           ++C E+G+F T  SS++K N TQF I+YGD +YA G WG D + L    V  ++      
Sbjct: 194 ISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANI 253

Query: 178 XXXXXXXLGIGLPAMETT---MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT 234
                  LGIGLP +E T     S    Y Y N P +L     I+K+ YS+F+N+LNA  
Sbjct: 254 SNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATH 313

Query: 235 GSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLG 294
           GSVLFGAVDHSKY GTL T+PLVN+    +V KP++  VTL  +G+          T+  
Sbjct: 314 GSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGITLND---TNTTITT 370

Query: 295 SKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGF 354
           +  PALLDSGTT T+ P              +  E+  Y   C+         ++DFGGF
Sbjct: 371 TPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEIS-DSDELVFDFGGF 429

Query: 355 QIRSPLSDYSMMT-----NVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMA 409
            I+S L ++++ T     N    C   ++P++   +ILGD FLT AYVV+DLE LE+SMA
Sbjct: 430 HIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMA 489

Query: 410 QANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           QAN +GG E IE I   VP AV+APGY+  W +  P+   G +
Sbjct: 490 QANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNI 532

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 61/100 (61%), Gaps = 1/100 (1%)

Query: 5   IAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWV- 63
           I  L  ++++    A     ++ ++FV++ FDK RG     A +G+    +  KR+D   
Sbjct: 9   ILGLAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTA 68

Query: 64  DIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
             EIDNQ  FYSV + +G+P Q+V +L+DTGSSD+WV+G+
Sbjct: 69  SFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGS 108

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  256 bits (653), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 162/455 (35%), Positives = 234/455 (51%), Gaps = 51/455 (11%)

Query: 15  NVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFY 74
           ++   SL+   +A  ++++DF+K   P  S+  + RA        ND     + N    Y
Sbjct: 3   SIVLVSLLAFTQA--YLKLDFEKT--PKISDELTKRA-------DNDSFIAPLLNGGELY 51

Query: 75  SVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNN------------------YP-NP 115
           +V +++GTPPQ + V +DTGSSDLW V A      NN                  +P +P
Sbjct: 52  TVQIAVGTPPQNLTVQLDTGSSDLWFVSASNPYCKNNKKFAPKKQDLMPITSDDGFPTSP 111

Query: 116 NQ-------LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVD 168
           NQ       +NC ++G F+ S SST+  N+T F + YGD T+A G WGTD + L    V+
Sbjct: 112 NQVPKALRNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKVE 171

Query: 169 GLTFXXXXXXXXXXXXLGIGLPAMETT--MSSQQ----FGYQYDNLPMVLKRNNVIKKTV 222
            +TF             GIGLP  E+T  M S+        QY N P+ LK+   I K  
Sbjct: 172 NVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLKQQGKIDKVA 231

Query: 223 YSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHT 282
           YS+++N   +K GS+LFGAVDHSKY G L T+P+VN  +   V  P EL VTL+ +GL  
Sbjct: 232 YSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVN-RFGHLVENPYELEVTLSGLGLQ- 289

Query: 283 GRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSE-EVGYIVDCNSRR 341
            R    + TL    +PALLD+GTT TY P                 +  +  +  C S++
Sbjct: 290 -RATSNI-TLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKK 347

Query: 342 LHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDL 401
            + T  +++F G QI+  + D+  +   +G C    +   S + +LGD F+   Y VFDL
Sbjct: 348 SNDTI-VFNFSGAQIKIKMVDF--VEKHKGKCYLPCVSQESSFFLLGDSFMRHVYTVFDL 404

Query: 402 EALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGY 436
           +  E+S+AQAN+   KE IE I+  VP AV+AP Y
Sbjct: 405 DDKEISIAQANFNSTKEDIEEISSTVPSAVKAPQY 439

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  252 bits (644), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 153/427 (35%), Positives = 227/427 (53%), Gaps = 46/427 (10%)

Query: 56  LAKR--NDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA---------- 103
           LAKR  +D++++++DN+Q+FY V +SIG+  Q + +L+DTGSSD WV+GA          
Sbjct: 28  LAKRADDDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSNRG 87

Query: 104 ----------GVRCGPNNYPNPNQ--------LNCYEHGSFDTSRSSTWKDNNTQFHIRY 145
                      V  G N YP   +         +C +  +F++S S+T+K N+T F I Y
Sbjct: 88  KKPKKKDQPSSVDPGRNGYPTKAEAIPYAERTFDCSDFKTFNSSSSNTFKSNDTDFFITY 147

Query: 146 GDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMS-------- 197
           GD +Y  GTWGTD++ L    ++ +TF            LGIGLP +E++++        
Sbjct: 148 GDGSYVEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIGLPELESSITIDTAQLTN 207

Query: 198 -SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPL 256
            S      Y N P  LK N +I K VYS+++N  N K GS+LFGAVDH++Y G L TVPL
Sbjct: 208 TSSVKKNPYMNFPESLKLNKLINKVVYSIYLNRTNDKFGSILFGAVDHNRYDGNLTTVPL 267

Query: 257 VNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL-LGSKVPALLDSGTTLTYFPMQXX 315
           V +N      +P EL VTL  +      D +  Q L   SK PALLD+G+T T+ P+   
Sbjct: 268 VFSNRDFGTPRPNELMVTLNGMSFE-ATDGNVTQILNATSKFPALLDTGSTDTHLPVDVY 326

Query: 316 XXXXXXXXXXW-HSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCR 374
                     +  ++    I  C S++  +T   +  GG  I  P  +  M+  ++G C 
Sbjct: 327 NALAESTNGTYDQTQNKIRIPKCLSKK-DKTILNFSLGGVNIGVPYKE--MVKKIKGKCY 383

Query: 375 FGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGG-KEQIEVIAGAVPRAVRA 433
             + P  SD+ ILGD  +  AY+VFDLE  E+S+AQA++     E IEV+   +P A RA
Sbjct: 384 INVAPTGSDFAILGDDVIRYAYMVFDLEDREISLAQASFNDTLPEDIEVVVSTIPGATRA 443

Query: 434 PGYNDPW 440
             Y++ +
Sbjct: 444 SAYSETY 450

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  253 bits (646), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 131/323 (40%), Positives = 190/323 (58%), Gaps = 10/323 (3%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           ++C  +G+FD ++SST+K NNT F I YGD ++A G WG D ++LG  N+  ++      
Sbjct: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258

Query: 178 XXXXXXXLGIGLPAMETTMSSQQF-----GYQYDNLPMVLKRNNVIKKTVYSMFINELNA 232
                  LGIGLP +ETT SS Q       + Y N PMVLK   + KK VYS+++N  +A
Sbjct: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318

Query: 233 KTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
             GS+LFGAVD SK+ G+L T+P++N    R V++P++  VTL  +GL    ++    TL
Sbjct: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGL---SNQTSTTTL 375

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFG 352
             +K+PALLDSG+TL Y P              +      Y++DC S+   +T  +++FG
Sbjct: 376 STTKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKH-DETKIVFNFG 434

Query: 353 GFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412
           GF I + L+ Y+   +   TC   I+P      ILGD FL  AYVV+DLE  E+SMAQAN
Sbjct: 435 GFNIETNLTTYTTPIS-SDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493

Query: 413 YEGGKEQIEVIAGAVPRAVRAPG 435
           ++   E IEV++ ++P+A  A G
Sbjct: 494 FDVNHEDIEVVSSSIPQATAAAG 516

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 64/100 (64%), Gaps = 4/100 (4%)

Query: 8   LGAVLATNVACASLVERE---EAAQFVRMDFDKKRGPSFSEAWSG-RAAVPRLAKRNDWV 63
           L   L  NVA ++   +E   +  + V++ FDK+ G ++ E+  G R A+P + + +   
Sbjct: 7   LKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEY 66

Query: 64  DIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
           ++ + N+Q FYSV+L +G+P Q++ VL+DTGSSDLW+ G+
Sbjct: 67  ELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGS 106

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  249 bits (636), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 134/337 (39%), Positives = 199/337 (59%), Gaps = 17/337 (5%)

Query: 113 PNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTF 172
           P P  ++C ++G+FD ++S +++ N T+F+I YGD ++A G WGTD ++    N++G++F
Sbjct: 174 PEPT-MDCSQYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSF 232

Query: 173 XXXXXXXXXXXXLGIGLPAMETTMSSQQ-----FGYQYDNLPMVLKRNNVIKKTVYSMFI 227
                        GIGLP  E T +          Y+Y N P VLK    I K  YS+F+
Sbjct: 233 AVANETNSTVGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFL 292

Query: 228 NELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDED 287
           N L+A +G +LFGAVD SKYKG L T+PL+N++  +  N P+E  VTL  +G   G  + 
Sbjct: 293 NSLDASSGDILFGAVDRSKYKGDLYTLPLLNSDPTKYKN-PMEFDVTLQGVGFTNGSSKT 351

Query: 288 KVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG-YIVDCNSRRLHQTA 346
              T   +K+PALLDSGT+L Y P              ++ E++G Y++ C S     + 
Sbjct: 352 TFTT---TKIPALLDSGTSLIYLPDALAKGIAHKLGGSYN-EDIGYYVIGCPSEN-DDSQ 406

Query: 347 YIYDFGGFQIRSPLSDYSMMTNVRG---TCRFGIMPHSSDYVILGDVFLTRAYVVFDLEA 403
            ++DFGGF I++ LS+Y + +   G    C  GI+P S    ILGDVFL  AYVV+DL+ 
Sbjct: 407 LVFDFGGFTIKNNLSNYLLGSPDDGDDSQCVLGILP-SDVQAILGDVFLADAYVVYDLDD 465

Query: 404 LEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPW 440
            EVS+AQA+++  KE I++I+ ++P A RAPGY+  W
Sbjct: 466 YEVSLAQASFDNSKEDIQIISDSIPGAKRAPGYSKTW 502

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 59/95 (62%), Gaps = 2/95 (2%)

Query: 7   ALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIE 66
           A+ ++L+    C S +  + ++  V++ F+K  GP++ E+   R ++    + N   +  
Sbjct: 6   AVVSLLSVASTCKSALIEQTSSPMVKLSFNKWHGPTYEESSLERRSLE--TRNNKEFNFI 63

Query: 67  IDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVV 101
           ++NQQ FYSV+L +GTP Q + VL+DTGSSDLW+ 
Sbjct: 64  VENQQNFYSVDLLVGTPGQNITVLLDTGSSDLWLT 98

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  243 bits (621), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 136/339 (40%), Positives = 193/339 (56%), Gaps = 9/339 (2%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           L C  +G+F T  SS+++ NNT F+I YGDSTYA GTWG D + L    + G++      
Sbjct: 186 LTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDNVTLQDITLSGISMAVANE 245

Query: 178 XXXXXXXLGIGLPAMETT----MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAK 233
                  LGIGL A+E T    ++++   Y Y+NLP  +    +I K  YS+F++ L+AK
Sbjct: 246 SNSTFGVLGIGLAALEVTNVGTLATRGNSYTYENLPAKMVSEGIIHKNAYSLFLDSLDAK 305

Query: 234 TGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLL 293
            GSVLFGAVDHSKY G+L T+PL N+      + P++L VTL   G+          T  
Sbjct: 306 EGSVLFGAVDHSKYTGSLYTLPLSNSYKSMGYSDPIQLEVTLQGFGMTANNTNSTFTT-- 363

Query: 294 GSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGG 353
            + + ALLDSGTTLTY P              + S    Y++ C+  +      ++DFGG
Sbjct: 364 -TPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSCSDVK-DTDELVFDFGG 421

Query: 354 FQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANY 413
           F I S + ++ ++      C  G++P SS  +ILGD FLT AYVV+DL+ LE+S+AQANY
Sbjct: 422 FHINSKVENF-LIRATSNICALGLIPQSSSSLILGDNFLTAAYVVYDLDNLEISLAQANY 480

Query: 414 EGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           +GG   IEVI+ +VP AV+ P Y+  W    P+   G +
Sbjct: 481 DGGSSNIEVISSSVPSAVKGPSYSSTWSTSVPISTGGNI 519

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 6/97 (6%)

Query: 13  ATNVACASLVE-REEAAQ----FVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVD-IE 66
           A  +A A++V  R+E AQ    FV++ FDK RG +  +A +G  A   LAKR D  + + 
Sbjct: 12  ACGLASAAVVSSRDEGAQSASKFVKVSFDKLRGDTAEDATAGAVAHGVLAKRADGSETVV 71

Query: 67  IDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
           I NQQ FYSV L +G+P Q V +L+DTGSSD+WV+G+
Sbjct: 72  IKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGS 108

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  242 bits (617), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 246/514 (47%), Gaps = 92/514 (17%)

Query: 12  LATNVACASLVEREEAAQFV-RMDFDKKRGPSFSEAWSGRAAV-----PRLAKRNDWVDI 65
           L ++V+C   V    ++Q V ++ F+K  G SFSEA + R  V       ++  ND V +
Sbjct: 12  LVSSVSCLPAVHDSRSSQSVAKIGFNKVYGKSFSEATADRKYVNLFRNKNISDDNDEVAL 71

Query: 66  EIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG-AGVRCGPNN-------YPNPN- 116
           + +N   +YSVN+S+GTP Q + + +DTGSSDLWV+   G++C  N+         N N 
Sbjct: 72  Q-NNANTYYSVNISLGTPGQNMTIQLDTGSSDLWVIKPGGLQCTDNDTNLFKKRSENDND 130

Query: 117 ---------QLNCYEHGSFDT--------------SRSSTW------------------- 134
                    QL  YE GSF T              + SS+                    
Sbjct: 131 NDAISSFISQLESYE-GSFSTLFGPGPGSVGTPTGTISSSMPAPTGNGSYDGGDSDSDGS 189

Query: 135 ----------KDNNTQFH--------IRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXX 176
                      DN+  FH        I+Y D +YA G WGTD L LG   V  ++F    
Sbjct: 190 NNCNATAFFEADNSKTFHRNRTDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVAN 249

Query: 177 XXXXXXXXLGIGLPAMETTMSS------QQFGYQYDNLPMVLKRNNVIKKTVYSMFINEL 230
                    GIG P  E++ +S          ++Y N P  LK   +I++  YS+++N  
Sbjct: 250 DTNSTTPVFGIGFPGGESSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSP 309

Query: 231 NAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVE-LHVTLAAIGLHTGRDEDKV 289
           N+  G+VLFG VDHS+Y+G L T+P++          P   L +TL  + +     + KV
Sbjct: 310 NSTYGNVLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHKV 369

Query: 290 QTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI- 348
           +T     +P +LDSGTT  Y P +               E+ GYI+DC   +     YI 
Sbjct: 370 KT---KPIPVVLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDC--PKSGDNDYIT 424

Query: 349 YDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSM 408
           +DFGG  I++ + +Y +       C  GI+P+S    + GDVFLT AYVV+DLE  E+S+
Sbjct: 425 FDFGGVTIKTDIRNY-IFEQSENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISL 483

Query: 409 AQANYEGGKEQIEVI-AGAVPRAVRAPGYNDPWK 441
           AQA++    EQIE I +  VP A RAPGY+  WK
Sbjct: 484 AQASFNSSSEQIEAITSSGVPGAKRAPGYSKTWK 517

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  241 bits (615), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 235/473 (49%), Gaps = 62/473 (13%)

Query: 27  AAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQ--MFYSVNLSIGTPP 84
           A  +V +DF+K  G               L KR D  D+++ N Q  M Y++ LS+GTPP
Sbjct: 11  AQAYVALDFEKSHGDD-------------LVKR-DVQDVKLINSQKAMLYNIQLSVGTPP 56

Query: 85  QEVRVLMDTGSSDLWV---------------------VGAGVR-CGPNNYPNP-NQLNCY 121
           Q +   +DTGSSDLW                      + AG R   P   P     L+C 
Sbjct: 57  QNITAQLDTGSSDLWFPDSTNPYCKANKKQAPKSIASLDAGTRPTSPAQVPKSLRNLDCA 116

Query: 122 EHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXX 181
           E G F++S S+T+  N T+F I Y DS+YA G W TD L L   N+ GL F         
Sbjct: 117 EFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNLYLNGLNISGLNFGLAYFSNSS 176

Query: 182 XXXLGIGLPAMETTMSSQ-----QFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGS 236
              LG+GL  +E +  +         +QY N P +LK+   I K  YS+++N+  +K G 
Sbjct: 177 NSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQILKQKGAISKVTYSLYLNDTKSKYGQ 236

Query: 237 VLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRD--EDKVQTLLG 294
           +LFG VDHSKY G L T+PLVN+ Y++      +L VTL  +G+   RD   +   TL  
Sbjct: 237 ILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADLEVTLNGLGI---RDNTTNTNTTLYT 293

Query: 295 SKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSE-EVGYIVDCNSRRLHQTAYIYDFGG 353
            K+PAL DSGT+ +Y P                ++ E   +  C S++      +++F G
Sbjct: 294 QKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSKK-DTREVVFNFNG 352

Query: 354 FQIRSPLSDYSMMTNVRGTCRFGIM---PHSSDYVILGDVFLTRAYVVFDLEALEVSMAQ 410
            +I  PL  +    +  G C   +M   P++   ++LGD FL + Y VFDLEA E+S+A+
Sbjct: 353 VEIAIPLKQFYQKKS--GKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQELSIAR 410

Query: 411 ANYEGG-KEQIEVIAGAVPRAVRAPGYNDPWKAY---TPLVFNGELGNLTATA 459
           AN+       +E I   VP A++AP Y + + AY   T +V  G + + TATA
Sbjct: 411 ANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAYDNATQVV--GNIFDATATA 461

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  242 bits (617), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 223/424 (52%), Gaps = 39/424 (9%)

Query: 50  RAAVPRLAKRND---WVDIEIDN-QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGV 105
           R++  + AKRN     ++IE+ + +Q +Y+  L IGTPPQ + VL D+GSSDLWV+ A  
Sbjct: 34  RSSKNQYAKRNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASN 93

Query: 106 RCGPNNYPNP--------NQ---LNCYEHGSFDTSRSSTWKDNNT-QFHIRYGDSTYAHG 153
               + Y           NQ   ++C    +F+ S SS++K   T +F+  Y D T+A G
Sbjct: 94  PYCESQYTGSQTYNGSSINQASTIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDKTFADG 153

Query: 154 TWGTDRLDLGQANVDGLTFXXXXXXXXXXX-XLGIGLPAMETTMSSQQFGYQ------YD 206
           +W T++L +   +V  L F             LGIG P  E+       GY       Y 
Sbjct: 154 SWATEKLTMNGVDVSSLQFGLGNCVTTPVSGVLGIGFPRRESVK-----GYDNAPNEFYP 208

Query: 207 NLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVN 266
           N P VLK   +I    YSMF+N+L + TGS+LFGA+D SKY G L T P++N  Y    +
Sbjct: 209 NFPQVLKNQGIIDVVAYSMFLNKLESDTGSILFGAIDTSKYTGDLVTFPMLNI-YPDVTD 267

Query: 267 KPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXW 326
           KP  L V L  +G     +  K +T + SK+P LLDSGTTL   P +            +
Sbjct: 268 KPATLMVILQGLGAQDNANC-KAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATF 326

Query: 327 HSEEVGYIVDCNSRR-LHQTAYIYDFGGFQIRSPLSDYSMMTNVR-GTCRFGIMPHSSDY 384
             +E  YI++C ++  L  T YI+DFGG QI+ PLS++ +      G C F ++P  S+ 
Sbjct: 327 SEDEGIYIMECPTKETLANTDYIFDFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDSNT 386

Query: 385 VILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIA-----GAVPRAVRAPGYNDP 439
           ++LGD+FL+ AYVVFDL+  ++S+A AN +      + I      G +P A  A    DP
Sbjct: 387 MVLGDIFLSSAYVVFDLDNYQISLAAANLDNNVSLEDSIINIPSDGNIPNAKMATV--DP 444

Query: 440 WKAY 443
           W  Y
Sbjct: 445 WSTY 448

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  241 bits (615), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 192/341 (56%), Gaps = 23/341 (6%)

Query: 113 PNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLG-QANVDGLT 171
           P    ++C  +G+FD S+SST+  N+T F IRYGD T+A GTWG D ++     N+   +
Sbjct: 179 PQDAHIDCSTYGTFDPSKSSTFVSNDTNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFS 238

Query: 172 FXXXXXXXXXXXXLGIGLPAMETT---MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFIN 228
           F            LG+GLP +E T   +S  +  Y Y N PM LK++ +I + VYS+++N
Sbjct: 239 FGVADLTNSTISVLGMGLPRLEVTYSGLSLDRSPYTYANFPMALKQSGLIDRMVYSLYLN 298

Query: 229 ELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDK 288
           +  A TGSVLFGAVDHSKY G+LNT+PL++ +       P+  +V L  +G+ +  D   
Sbjct: 299 KAGASTGSVLFGAVDHSKYHGSLNTIPLISLS---GSGIPIAFNVALQGLGMSS--DSQG 353

Query: 289 VQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI 348
            QT L + +PALLDSGTT+TY P              +   +  Y++DC S       + 
Sbjct: 354 TQTFLSTPLPALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGS-DDREFN 412

Query: 349 YDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSM 408
           +DFGGFQI  PLS++ ++  +   C   +    ++  ILGD FLT AYVV+DLE LE+SM
Sbjct: 413 FDFGGFQISVPLSNF-ILEALPDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLEISM 471

Query: 409 AQANYEGGKEQ------------IEVIAGAVPRAVRAPGYN 437
           AQA Y+   +             +EV+   +P A +APGY+
Sbjct: 472 AQARYDDDNDSDIEKYNADNKVLLEVVTSNIPSANQAPGYS 512

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/101 (48%), Positives = 60/101 (59%), Gaps = 15/101 (14%)

Query: 12  LATNVACASLVEREEAAQ--FVRMDFDKKRGPS-------FSEAWSGRAAVPRLAKRNDW 62
           L + VAC    E  +A Q   +R+D +K  G S         E  S  +A  RL KR D 
Sbjct: 12  LLSTVAC---FENNDAFQDKVLRLDINKFYGDSKFNLGSEIDEDISTPSA--RLVKREDG 66

Query: 63  VDI-EIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG 102
            +I EI NQQ FYSV+L +GTPPQ+V VL+DTGSSDLWV G
Sbjct: 67  HEIIEIQNQQAFYSVDLMLGTPPQKVTVLVDTGSSDLWVTG 107

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  235 bits (599), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 160/443 (36%), Positives = 233/443 (52%), Gaps = 25/443 (5%)

Query: 2   IAQIAALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND 61
           I+ +A L A+       A L   E ++ FV M+F++  G S   A S R+ +  + +  +
Sbjct: 6   ISSVALLSAI---QHVYAHLGAEESSSGFVSMNFNRLYGASPDTAVSKRS-MSHIKRSEN 61

Query: 62  WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCY 121
           +  + + N+  FYS++L+IG+  Q V VL+DTGSSDLWV            P P+    Y
Sbjct: 62  YEQVRLKNEACFYSMDLAIGSNHQNVTVLVDTGSSDLWV------------PGPDSSASY 109

Query: 122 EHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXX 181
             G F    S++ K N T+F  +Y D T A+G W  D + LG   V  +TF         
Sbjct: 110 --GVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDSN 167

Query: 182 XXXLGIGLPAMETTMSSQQFG-YQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFG 240
              LG+GL  +E T ++     YQYDN P+ L R  +I+   YS+++N+ +A +G+VLFG
Sbjct: 168 FGVLGLGLTGLEATYTNALSSPYQYDNFPVKLVRQGLIQANAYSLYLNKADASSGNVLFG 227

Query: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
           AVDH+KY GTL+T+P VN       N  +E HVTL  + L T    D   TL  SK P L
Sbjct: 228 AVDHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLST---NDGQTTLTTSKFPVL 284

Query: 301 LDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL 360
           +DSG T +Y P              + +E VGY++ C S     T   Y+FGGF I +PL
Sbjct: 285 VDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTCPSED-DDTVISYNFGGFNIDTPL 343

Query: 361 S-DYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQ 419
           S   + + +   TC   I P  S++  LGD FL   Y         +S+AQA Y   +E+
Sbjct: 344 SGSVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESLSLAQAQYT-DEEE 402

Query: 420 IEVIAGAVPRAVRAPGYNDPWKA 442
           IE+I+ ++P A++A GY+D W A
Sbjct: 403 IEIISSSIPGAIKAAGYSDIWSA 425

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  232 bits (592), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 146/448 (32%), Positives = 228/448 (50%), Gaps = 55/448 (12%)

Query: 27  AAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQE 86
           A  ++++DF+K          S +A+   + + +++V++ + N    Y V L++GTPPQ 
Sbjct: 13  AQAYLKLDFEK----------SPKASSDLVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQN 62

Query: 87  VRVLMDTGSSDLWVVGA------------------------GVRCGPNNYPNPNQ-LNCY 121
           + V +DTGSSDLW   A                        G     N  P  ++ LNC 
Sbjct: 63  ITVQLDTGSSDLWFPSADNPFCKENKKYAPKGKDVQPLDDSGYPSASNQVPKSSRTLNCK 122

Query: 122 EHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXX 181
           ++G F++S SST+K N+++F + Y D ++A G WG+D +   + N+  + F         
Sbjct: 123 KYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFNELNISNVNFALGSFANSS 182

Query: 182 XXXLGIGLPAMETTMSSQQFG--------YQYDNLPMVLKRNNVIKKTVYSMFINELNAK 233
              LG+GLP +E+T      G        +QY N P+ LK+N VI K  YS+++N   +K
Sbjct: 183 NGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLKQNGVIDKIAYSLYLNSSKSK 242

Query: 234 TGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLL 293
            GSVLFGAVDH++Y G L T+PL N+ ++   + P +L +T+  +GL  G D +   TL 
Sbjct: 243 FGSVLFGAVDHNRYNGPLYTLPLANSLFQNFTD-PFQLEITMNGLGLQ-GNDAN--ITLY 298

Query: 294 GSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWH-SEEVGYIVDCNSRRLHQTAYIYDFG 352
             K  ALLDSGTTLT                     ++   +  C S++ ++   I++F 
Sbjct: 299 DKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLPKCPSKKENKK-LIFNFS 357

Query: 353 GFQIRSPLSDYSMMTNVRGTCRFGIMPH---SSDYVILGDVFLTRAYVVFDLEALEVSMA 409
           G ++   ++   MM   +G C      H   S+D +I GD FL   Y+V++LE  E+S+A
Sbjct: 358 GAEVAVDIN--QMMNKHKGKCYLQFAVHEDTSNDAIIFGDNFLRSVYLVYNLEDKEISIA 415

Query: 410 QANYEGG-KEQIEVIAGAVPRAVRAPGY 436
            AN+     E IE I   VP A+RAP Y
Sbjct: 416 PANFNSSLPENIEPIKSTVPSAIRAPQY 443

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  232 bits (592), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 160/475 (33%), Positives = 223/475 (46%), Gaps = 58/475 (12%)

Query: 27  AAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN------DWVDIEIDN-QQMFYSVNLS 79
           A  ++++DF+++     +           LAKR+      + +D+ I+    + Y+V L 
Sbjct: 10  AQAYLQLDFERQTAQDVA-----------LAKRHTSNGVANAMDVPIEQIGDLMYTVQLH 58

Query: 80  IGTPPQEVRVLMDTGSSDLWV-VGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNN 138
           +GTPPQ V V +DTGSSDLW  V +   C  N    P ++       F T      K   
Sbjct: 59  VGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNAKLAPKKVKALPATGFATENDQVAKKLR 118

Query: 139 T-----------------------QFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXX 175
           T                       +F ++Y D TYA G WGTD   L   NV  +TF   
Sbjct: 119 TFDCDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMWGTDTFKLNHHNVSNITFALA 178

Query: 176 XXXXXXXXXLGIGLPAMETTMSSQ------QFGYQYDNLPMVLKRNNVIKKTVYSMFINE 229
                    LG+G PA ETT          +  YQYDN P+ LKR   IKK  YS+F+N+
Sbjct: 179 NIANASMGVLGVGFPAEETTDDPSPGSLIDKEHYQYDNFPIALKRTRTIKKVSYSIFLND 238

Query: 230 LNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKV 289
            N+K G +LFG VDHSKY+GTL TVP+VN              +TL  +G    RD+ K 
Sbjct: 239 TNSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTSRPEITLNGLGF---RDDKKN 295

Query: 290 QTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIY 349
            TL G K+P LLD+GTTL Y P Q              S+  G  +         +  I+
Sbjct: 296 VTLWGEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSKTGGIKLKKCPNAKDNSELIF 355

Query: 350 DFGGFQIRSPLSDYSMMTNVRGTCRFGIMPH---SSDYVILGDVFLTRAYVVFDLEALEV 406
           +F G +I  P+S  +M+   +G C   I  H   S   ++LGD+F+   Y VF++E +EV
Sbjct: 356 NFAGAEI--PVSLLNMVEKRKGKCYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDMEV 413

Query: 407 SMAQAN-YEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYT-PLVFNGELGNLTATA 459
           S A AN  +    QIE I   VP AV+AP Y + + +   P     ++   TATA
Sbjct: 414 SFAVANGNDSAPLQIEAIISDVPSAVKAPQYYNTFASSNLPSTVTNDIFASTATA 468

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  238 bits (607), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/459 (34%), Positives = 226/459 (49%), Gaps = 19/459 (4%)

Query: 1   MIAQIA-ALGAVLATNVACASLVEREEAAQFVRMDFDKKRGPSFSEA-WSGRAAVPRLAK 58
           M+A I  AL     TNV+ A L++  +    V + F K    S  E  ++   +  +L K
Sbjct: 1   MVAPILFALLFTQLTNVS-AELIQFYDKKAAV-IPFRKYYADSLEELDYNTSTSETKLVK 58

Query: 59  RNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQL 118
           R D  DI + N+  FYS  + +GTP Q + V++DTGSSDLWV+G      P    +    
Sbjct: 59  R-DGEDIVLTNRNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHDNLTCP--LASDGSF 115

Query: 119 NCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXX 178
           NC   GSF  S+SST+  N+T+F I Y       G WG D L +G  N  GL+F      
Sbjct: 116 NCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNATGLSFGVVHTT 175

Query: 179 XXXXXXLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVL 238
                 LGIGLP  ETT   Q   Y+YDN PMVLK   +I    YS++++  ++  G  L
Sbjct: 176 TSSAGILGIGLPDTETTAVGQYGHYKYDNFPMVLKNKGIISHQGYSIYLDSSSSTYGEFL 235

Query: 239 FGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVP 298
            G VD SKY GTL  +PLVN  Y    + P + HVTL  +GL T  +     TL  +K+ 
Sbjct: 236 LGGVDTSKYTGTLYKLPLVNW-YNTYFSSPGDFHVTLQGLGLIT--NSGSAVTLTETKMA 292

Query: 299 ALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS 358
            +LD+G+T+T  P              + S    Y+  C +     +  +++FGG   + 
Sbjct: 293 VILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTE---TSKLVFNFGGINYKL 349

Query: 359 PLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGG-- 416
           P+S + + T     C   +   S    ILGD FL   Y  FDLE  E+ +A A+++    
Sbjct: 350 PMSSF-INTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLAMADFDSSSN 408

Query: 417 -KEQIEVIA--GAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
            K +  VIA    +P AV+AP Y+  W  Y  +V  G +
Sbjct: 409 NKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSM 447

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  228 bits (580), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 144/428 (33%), Positives = 219/428 (51%), Gaps = 40/428 (9%)

Query: 49  GRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA-GVRC 107
           G + + + ++  +   I + +    Y V + IGTPPQ   + +DTGSSD+ +  A    C
Sbjct: 45  GASGISKRSEAFNSTLINMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYC 104

Query: 108 ----GPNNYPNPN--------------------QLNCYEHGSFDTSRSSTWKDNNTQFHI 143
                 NN    N                       C   G+F  + SST+K N T F++
Sbjct: 105 ESLADENNISTSNYELTATAIEILSTAAPSAAYNAPCSYWGTFSPNSSSTFKYNETIFNL 164

Query: 144 RYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT------MS 197
            YGD++Y  GT+GTD + LG   +   TF            LG+ LP+ E T      +S
Sbjct: 165 TYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTNNGGILGVSLPSAEVTDDTEDALS 224

Query: 198 SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLV 257
           S    + Y+N PM LK    IKK  YS+F+NE +A+ GS+LFGAVD S+Y G L T+P++
Sbjct: 225 SNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSARFGSILFGAVDKSEYSGQLYTLPML 284

Query: 258 NANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
            A Y         + VT  ++ +   +  +K  T+   + P L DSGT+ +  P +    
Sbjct: 285 QA-YNTLDATDAGMFVTAQSVAILDSKSGNK--TVSEVQFPVLFDSGTSTSVLPTKIADA 341

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGI 377
                   + S++ GYI DC   +++ T   +DFGGF I + +S++  +T  +  C   I
Sbjct: 342 IGRSFDGKYSSDDQGYIFDC--AKVNNTLLSFDFGGFNISANISNF--VTPAKDHCILQI 397

Query: 378 MPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYN 437
           +P  + +V LGD FL   YVV+DLE  EVS+AQA+++  +E I +I+ +VP A  APGY+
Sbjct: 398 LPSDTIFV-LGDAFLVDTYVVYDLENHEVSVAQASFDNKEEDIGIISDSVPGATPAPGYS 456

Query: 438 DPWKAYTP 445
             W+ YTP
Sbjct: 457 STWR-YTP 463

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  226 bits (575), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 233/463 (50%), Gaps = 80/463 (17%)

Query: 27  AAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIE-----IDNQQMFYSVNLSIG 81
           A  +V++DF K  G               LAKR D VD E      D  Q  Y V +++G
Sbjct: 14  AQAYVKLDFTKTPGSD-------------LAKR-DVVDPEAAQLTFDKDQ--YIVEVAVG 57

Query: 82  TPPQEVRVLMDTGSSDLWVVGAG----------------VRCGPNNYP-NPNQ------- 117
           TPPQ+V + +DTGSSDL+V+                   +    ++YP  PNQ       
Sbjct: 58  TPPQKVLLQIDTGSSDLFVIEESNPYCKNNKNKAPKKKDLESPGDDYPRTPNQVPKSDRT 117

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           L+C ++G ++ + SST+  N T   I YGD+ +  GTWGTD + +G  N+  L+      
Sbjct: 118 LDCKKYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIGVSPM 177

Query: 178 XXXXXXXLGIGLPAMETTM--SSQQFG---YQYDNLPMVLKRNNVIKKTVYSMFINELNA 232
                  LG+GLP  E+T   SS   G   YQY N P+ LK   +I+K  YS+++NE  +
Sbjct: 178 TNTSTGILGVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAYSIYLNETGS 237

Query: 233 KTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
           K GS+LFGAVDHSKY+G L T PLVN+ Y+   + P +  +T+  +GL    D     TL
Sbjct: 238 KYGSILFGAVDHSKYQGPLYTFPLVNSKYKEGSD-PFQFEITMNGVGLVGKTDN---ITL 293

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVD----------CNSRRL 342
              K+P LLDSG+T++  P                +++V   VD          C S++ 
Sbjct: 294 YDQKLPTLLDSGSTISLLPRDVADLV---------AQQVNGTVDGKGNCIKLPKCPSKKD 344

Query: 343 HQTAYIYDFGGFQIRSPLSDYSMMTNVRGTC--RFGIMPHSSDYVILGDVFLTRAYVVFD 400
           +Q   I++F G +    ++D+  M   +G C  +F  +    ++ +LGD F+   Y VF+
Sbjct: 345 NQ-KLIFNFSGAEFSVNVTDF--MEKHKGKCYLQFSAL-DGINFALLGDNFMNNVYTVFN 400

Query: 401 LEALEVSMAQANYEGG-KEQIEVIAGAVPRAVRAPGYNDPWKA 442
           L+  E+S+AQANY    K  IE I   VP AV AP Y + + A
Sbjct: 401 LDDKELSLAQANYNSSLKPDIEEIKDTVPSAVLAPQYYNTFSA 443

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  227 bits (578), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 188/349 (53%), Gaps = 29/349 (8%)

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           L+C     FD  +SS++K N+T F   YGD++YA G WGTD + LG  ++  + F     
Sbjct: 167 LDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGNLSIADVFFAVANF 226

Query: 178 XXXXXXXLGIGLPAMET--TMSSQQFGYQ-------------------YDNLPMVLKRNN 216
                  LG+GLPA+E+     S  F                      Y N P +LK+ N
Sbjct: 227 SNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNASDADIDNISKPTYANFPQILKQKN 286

Query: 217 VIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLA 276
           VI+K  YS+F+N+ NA  G +LFGAVDHSKY G+L+T+PLVN+ Y   +N   +L +TL 
Sbjct: 287 VIEKVAYSLFLNDTNATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGINDTTQLEITLD 346

Query: 277 AIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYI-- 334
            +GL   + +    T+   K+PALLDSGTT++Y P+                 + G+I  
Sbjct: 347 GMGLKNSQGQ---FTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVD-PQTGFIEL 402

Query: 335 VDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTR 394
            +C ++    T  +++FGG  I    +++   ++    C    MP     ++LGD FL  
Sbjct: 403 KNCPAKN-DNTQLVFNFGGAFISIKYTEFIEKSD-DDNCYVTFMPQGEPGILLGDNFLRN 460

Query: 395 AYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAY 443
           AY+V+DLE +E+S+AQAN+ GG E IE I   VP AV+APGY+  +  +
Sbjct: 461 AYIVYDLEDMEISIAQANFNGGAENIEAIVKNVPSAVKAPGYSASFTEF 509

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (61%), Gaps = 3/92 (3%)

Query: 15  NVA-CASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKR--NDWVDIEIDNQQ 71
           NVA  A  V    A +++++DF+K R     E     +A  +L KR  +D V   +  Q+
Sbjct: 5   NVALVAGCVNAVAAEKYLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAFPLVAQE 64

Query: 72  MFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
            +YS+NL +GTPPQ V +L+DTGSSD+WV+G+
Sbjct: 65  NYYSINLEVGTPPQNVSLLLDTGSSDMWVIGS 96

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  222 bits (566), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 134/434 (30%), Positives = 220/434 (50%), Gaps = 32/434 (7%)

Query: 43  FSEAWSGRAAVPRLAKRNDW---VDIEIDN-QQMFYSVNLSIGTPPQEVRVLMDTGSSDL 98
            S   S R    R+ KRND    + +++++ QQ +Y+  L +GTPPQ + VL+D+GSSD 
Sbjct: 21  LSSNVSSRPLSNRINKRNDISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDF 80

Query: 99  WVVGAGVRCGPNNYPNPNQ--------------LNCYEHGSFDTSRSSTWK---DNNTQF 141
           W++ +       NY N  +              ++C     ++   SST++   ++N++F
Sbjct: 81  WLMDSKNPFCMENYCNSTEIPKYNNDLITQNLTIDCSYFNKYNPEISSTYQKLPNDNSRF 140

Query: 142 HIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXX-XXLGIGLPAMETTMSSQ- 199
           +++Y D ++  G W  + + +   N+  L               LGI  P  E+      
Sbjct: 141 YLQYTDGSFEDGIWSKETVQIDNYNITSLQLAVANYATTPVGGLLGISFPRRESVKGYDG 200

Query: 200 QFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNA 259
                Y N P VLK  N+I   +YSM++N+LN + GS+LFGA+D SK++G + T P+VN 
Sbjct: 201 ALNEYYPNFPQVLKNENIIDIVLYSMYLNDLN-QDGSLLFGAIDTSKFEGDMITYPMVNV 259

Query: 260 NYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXX 319
            Y   V+KP  L +T+  +      D  + +T + SK P LLDSGTTL   P +      
Sbjct: 260 -YPNVVDKPATLALTIQGVAAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPKELADKMA 318

Query: 320 XXXXXXWHSEEVGYIVDCNSRR-LHQTAYIYDFGGFQIRSPLSDYSMMTNV-RGTCRFGI 377
                 +  ++  YI++C S+  L+   YI+DFGG Q++ PL  + + ++   G C FG+
Sbjct: 319 DFVNATYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQVKIPLEKFILPSDDGSGPCAFGV 378

Query: 378 MPH-SSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGY 436
           +P  ++D ++LGD+FL+  Y VFDL+  ++S+A  N     E  E     +P     PG 
Sbjct: 379 LPETTTDRMVLGDIFLSFVYAVFDLDHYQISLANINKNANSESNEDSIINIPSNGAIPGA 438

Query: 437 N----DPWKAYTPL 446
                 PW  + P+
Sbjct: 439 KVATVKPWSTHEPI 452

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  221 bits (564), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/426 (34%), Positives = 214/426 (50%), Gaps = 43/426 (10%)

Query: 53  VPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVR------ 106
           V  + KRN+ ++  + N    Y V + IGTPPQ + + +DTGSSD+ V  A +       
Sbjct: 46  VSTVFKRNEVLNTTVINGIGVYVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMS 105

Query: 107 -----CGPNNYPNPNQLN---------------CYEHGSFDTSRSSTWKDNNTQFHIRYG 146
                   +NY      N               C   G+FD S SST+++N T F+  YG
Sbjct: 106 DGSDYASTDNYELTATFNGLPSTTISSEAYNTLCSYWGTFDASNSSTFENNATFFNNTYG 165

Query: 147 DSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXX-XXXLGIGLPAMETT------MSSQ 199
           D TY  GT+GTD +      ++  TF             LGI LP  E T      ++  
Sbjct: 166 DGTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGNPSGILGISLPIAEFTDGIEYALALN 225

Query: 200 QFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNA 259
           +  + YDN PM LK    I K  YS+F+N  +A  GS+LFGAVD SKY G L T+P++ A
Sbjct: 226 RTPFIYDNFPMELKNQGKINKIAYSLFLNGPDAHFGSILFGAVDKSKYTGQLYTLPMLQA 285

Query: 260 NYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXX 319
            +    + P  + +T  ++ +      +K  T+   + P +LDSGTT +Y P +      
Sbjct: 286 -FNTLGSNP-GMIITAQSVAILDSESGNK--TVSDIQFPVMLDSGTTFSYLPTEIAEAIG 341

Query: 320 XXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMP 379
                 + S++ GYI DC   +++ T    DFGGF I + +S++  +T+ +  C   +  
Sbjct: 342 KSFDGEYSSDDQGYIFDC--SKVNDTLLSVDFGGFNISANISNF--VTSAKDRCVLNVKQ 397

Query: 380 HSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDP 439
             S Y +LGD FL  AYVV+DLE  E+S+AQA++   +E IEVI+  VP A  APGY   
Sbjct: 398 SESTY-MLGDAFLVDAYVVYDLENYEISIAQASFNNQEEDIEVISDTVPGATPAPGYFST 456

Query: 440 WKAYTP 445
           W  Y P
Sbjct: 457 W-VYKP 461

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  214 bits (545), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 211/425 (49%), Gaps = 51/425 (12%)

Query: 56  LAKRNDWVD---IEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDL-------------- 98
           ++KR++  +   I + +    Y V + IGTPPQ     +DTGSSD+              
Sbjct: 45  ISKRSEAFNSTLINMFSSAHIYVVEMEIGTPPQAAYFQLDTGSSDMCANEADSSYCESFT 104

Query: 99  -----WVVG----------AGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHI 143
                W             +        Y  P    C   G+F  + SST+K N T F+I
Sbjct: 105 DESNIWTSNYELTATASEISSTATSSKAYNTP----CSYWGTFSPNVSSTFKYNETIFNI 160

Query: 144 RYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT------MS 197
            Y D+ Y  GT+GTD + LG   +   TF            LG+ LP++E T      +S
Sbjct: 161 SYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGILGVSLPSVEETDDIEDALS 220

Query: 198 SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLV 257
           S    + Y+N PM LK    I+K  YS+F+NE +A+ GS+LFGAVD SKY G L T+P++
Sbjct: 221 SNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSARFGSILFGAVDKSKYSGQLYTLPML 280

Query: 258 NANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
            A Y         + VT  +  +   +  +K  T+   + P L DSGT+ +  P +    
Sbjct: 281 QA-YNTLDALYSGMFVTAQSAAIIDSKSGNK--TVSEVQFPVLFDSGTSTSVLPTEIADA 337

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGI 377
                   + S++ GYI DC+  +++ T    DFGGF I + +S++ +    +  C   I
Sbjct: 338 IGRSFDGKYSSDDEGYIFDCS--KVNNTQLSIDFGGFNISANISNF-VTPLTKDHCVLQI 394

Query: 378 MPHSSDYV-ILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGY 436
           +P  SD V +LGD FL   YVV+DLE  EVS+AQA++   +E IE+I+ +VP A  APGY
Sbjct: 395 LP--SDTVSVLGDAFLVDTYVVYDLENHEVSVAQASFNNEEEDIEIISDSVPGATPAPGY 452

Query: 437 NDPWK 441
           +  W+
Sbjct: 453 SSTWR 457

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  215 bits (547), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 150/468 (32%), Positives = 226/468 (48%), Gaps = 59/468 (12%)

Query: 17  ACASLVEREEAAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRN-DWVDIEIDNQQMFYS 75
           A AS+V+  +  ++V+M FDK        + +        AKR+ D+V +++ N+++ Y+
Sbjct: 23  AIASVVKLPK--KYVQMGFDK--------SCTSATGDMVFAKRDGDYVLVDLINEKILYT 72

Query: 76  VNLSIGTPPQEVRVLMDTGSSDLWV-------------------VGAG------------ 104
           V L++GTPPQ + V ++ GS+D W+                   VGA             
Sbjct: 73  VQLAVGTPPQNITVSINIGSADPWMTSPDNPYCEIKKHSGYEKQVGANTSVSLLSSLSND 132

Query: 105 -------VRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGT 157
                  V  G ++      ++C  +G+F+ S SS++K+N T F + Y D T A   WGT
Sbjct: 133 RVTMSGTVTTGTSSSMVQPIIDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGT 192

Query: 158 DRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT-MSSQQF----GYQYDNLPMVL 212
           D + +    +  ++F             GIG P++ETT M + +      Y+Y N P  L
Sbjct: 193 DVVRVELLEILDMSFGVANVFNATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQAL 252

Query: 213 KRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELH 272
                + K  YS+F+N+ +A  GSVLFGAVDHSKY+  L TVPLVN    + ++ P   +
Sbjct: 253 NNQGSVDKVAYSLFLNDSHAMKGSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFN 312

Query: 273 VTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG 332
           V  A  G    R   + Q     +   +LDSG T++  P +            +  E   
Sbjct: 313 VFNARRGCPNKR---RPQNRRHDEFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNS 369

Query: 333 YIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFL 392
           Y + C S++    A  +D G F I  PLS++ +    +  C   + P  +   IL D FL
Sbjct: 370 YTLKCPSKKDTSVAS-FDIGRFHIDGPLSNF-VRKYEKNKCILRLDPADNQPYILCDNFL 427

Query: 393 TRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPW 440
           +RAYVV DLE+ E+SM QAN E   EQIE I   VP  VRAP Y+  W
Sbjct: 428 SRAYVVHDLESYEISMGQANTEYAPEQIEAIKSKVPGTVRAPSYDKTW 475

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  214 bits (546), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 130/409 (31%), Positives = 210/409 (51%), Gaps = 37/409 (9%)

Query: 70  QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVV-GAGVRCGPNNYPNPNQ----------- 117
           +QM+Y+  L IGTP Q++ VL DTGS+D WV+  +   C P + P+  Q           
Sbjct: 41  EQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKSNPSLYQNATYNGSKITP 100

Query: 118 -LNCYEHGSFDTSRSSTWKD-NNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXX 175
            ++C    +++ + SST++D +N +F+I Y D T++ G+WG + + +   ++  + F   
Sbjct: 101 SVDCSSMSTYNENSSSTYQDLDNGRFYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLA 160

Query: 176 XXXXXXXX-XLGIGLPAMETTMSSQQFGYQ------YDNLPMVLKRNNVIKKTVYSMFIN 228
                     LGIG P  E+       GY+      Y N P +LK   +I    YS+F+N
Sbjct: 161 KYATTPVSGVLGIGFPRRESVK-----GYEGAPDKYYPNFPQLLKSEQIIDVVAYSLFLN 215

Query: 229 ELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDK 288
             ++  GS++FGA+D SK+ G L T P+VN  Y   V+ P  L +T+  +G       ++
Sbjct: 216 SPDSGMGSIVFGAIDESKFYGDLLTFPMVN-EYPTIVDAPATLAMTIQGLGAQNKSGCER 274

Query: 289 VQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI 348
            +T + +K P LLDSGT+L   P              + ++E  YI++C         Y 
Sbjct: 275 -ETFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNC-PDSADDIEYT 332

Query: 349 YDFGGFQIRSPLSDYSMMTNVRGT-CRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVS 407
           +DFG  QI  PL+   +   V G  C F + P ++D ++LGDVFL+ AYVVFDL+  ++S
Sbjct: 333 FDFGDLQINVPLTSLILSPEVEGGYCGFAVQP-TNDSMVLGDVFLSSAYVVFDLDNYKIS 391

Query: 408 MAQANYEGGKEQIEVI----AGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           +AQAN+   ++  +VI     G++P    A    +PW    P     ++
Sbjct: 392 LAQANWNASEDSKQVINIPTDGSIPGGKSATA--EPWSTNEPFTVTSDI 438

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  208 bits (530), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 125/313 (39%), Positives = 173/313 (55%), Gaps = 13/313 (4%)

Query: 137 NNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTM 196
           N+TQF   YGD TY  GT+GTD + LG   ++  +F            LGI LPA E T 
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 197 S----SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLN 252
           S         ++Y+N PM LK +  I+K  YS+F+NE  A  GS+LFGAVD SKY G L 
Sbjct: 61  SLGGAYNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLY 120

Query: 253 TVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPM 312
           T+P++ A Y    +    + VT  ++ +  G   +K  T+   + P L DSGTT +  P 
Sbjct: 121 TLPMLQA-YDTLDSVSPGMFVTAQSVAVLNGDSGNK--TVSKVRFPVLFDSGTTYSSLPT 177

Query: 313 QXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGT 372
           +            + S + GY  DC+  ++  T    DFGGF I + +S++  +T  +  
Sbjct: 178 EVAHAIGKSFDGKYSSGDQGYTFDCS--KVKDTLLSIDFGGFNISANISNF--VTRTKDH 233

Query: 373 CRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVR 432
           C   I    S +V LGD FL  AYVVFDLE+ EVS+AQA+++  KE+IEVI+  VP A+R
Sbjct: 234 CLLNIEAADSGFV-LGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIR 292

Query: 433 APGYNDPWKAYTP 445
           APGY+  W  YTP
Sbjct: 293 APGYSSTW-VYTP 304

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  211 bits (536), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 133/409 (32%), Positives = 207/409 (50%), Gaps = 37/409 (9%)

Query: 70  QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVV-GAGVRCGPNN----YPNPN-------- 116
           ++M+Y+  L IGTP Q + VL DTGS+D WV+  +   C PN+    Y N          
Sbjct: 41  EEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATYNGEEVKP 100

Query: 117 QLNCYEHGSFDTSRSSTWKD-NNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXX 175
            ++C    +++  RSST++   N +F+I Y D T+A G+WGT+ + +   ++  + F   
Sbjct: 101 SIDCRSMSTYNEHRSSTYQYLENGRFYITYADGTFADGSWGTETVSINGIDIPNIQFGVA 160

Query: 176 XXXXXXXX-XLGIGLPAMETTMSSQQFGYQ------YDNLPMVLKRNNVIKKTVYSMFIN 228
                     LGIG P  E+       GY+      Y N P +LK   +I    YS+F+N
Sbjct: 161 KYATTPVSGVLGIGFPRRESVK-----GYEGAPNEYYPNFPQILKSEKIIDVVAYSLFLN 215

Query: 229 ELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDK 288
             ++ TGS++FGA+D SK+ G L T P+VN  Y   V+ P  L +T+  +G    +   +
Sbjct: 216 SPDSGTGSIVFGAIDESKFSGDLFTFPMVN-EYPTIVDAPATLAMTIQGLGAQ-NKSSCE 273

Query: 289 VQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI 348
            +T   +K P LLDSGT+L   P              +  EE  YI+DC    +    Y 
Sbjct: 274 HETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDC-PVSVGDVEYN 332

Query: 349 YDFGGFQIRSPLSDYSMMTNVRGT-CRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVS 407
           +DFG  QI  PLS   +     G+ C F + P ++D ++LGDVFL+ AYVVFDL+  ++S
Sbjct: 333 FDFGDLQISVPLSSLILSPETEGSYCGFAVQP-TNDSMVLGDVFLSSAYVVFDLDNYKIS 391

Query: 408 MAQANYEGGKEQIEVIA----GAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           +AQAN+   +   +++     G++  A  A    +PW    P     ++
Sbjct: 392 LAQANWNASEVSKKLVNIQTDGSISGAKIATA--EPWSTNEPFTVTSDI 438

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  205 bits (521), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 131/399 (32%), Positives = 198/399 (49%), Gaps = 44/399 (11%)

Query: 75  SVNLSIGTPPQEVRVLMDTGSSDLWVVGA-GVRCGPNNYPNP----------------NQ 117
           +V +SIG   Q +  + DTG SD WVVG   V C   N   P                + 
Sbjct: 104 NVIISIGKEGQNMFFVADTGLSDTWVVGQNSVYCDIENGTTPANHTANFSENTFAFKNHA 163

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
             CY    F+ + S++   NNT F  ++ D T+A GTW  D +++G   ++   F     
Sbjct: 164 FPCYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVAQE 223

Query: 178 XXXXXXXLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSV 237
                  LG+GL   E T +   + Y Y+N P  LK + +IK+ +YS++  +++ + GS+
Sbjct: 224 TNATIGSLGLGLEGNEIT-NEGDYTYTYENFPTKLKNSGMIKRVIYSIYAGKIDTEDGSL 282

Query: 238 LFGAVDHSKYKG-TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSK 296
           LFGAV+HS+Y G TL T+PLVN N     + PVE HVTL  + +   +      T++  +
Sbjct: 283 LFGAVEHSRYVGDTLYTLPLVNVN--NASSDPVEFHVTLQNLVVSVNKTN---TTIMSDR 337

Query: 297 VPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG-YIVDCNSRRLHQTAYIYDFGGFQ 355
             ALL++G  +TY P                 +  G Y+ DC+S    + ++ YDFGGF+
Sbjct: 338 YAALLNTGAIVTYLPTHLFSDFIKKTGLSESQKYYGMYVTDCSS----EISFSYDFGGFK 393

Query: 356 IRSPLSDYSMMTNVR----GTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           I S L+DY    +        C   I  H   Y++LG  F + AYVVFDLE LEVS+AQA
Sbjct: 394 IESSLNDYLFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSSAYVVFDLERLEVSIAQA 453

Query: 412 ----------NYEGGKEQIEVIAGAVPRAVRAPGYNDPW 440
                     N E   + +E++  ++P A +A  Y++ W
Sbjct: 454 AHVYDNFTYSNIEDNPD-VEIVIDSIPSATKAASYSNTW 491

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  199 bits (507), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 178/328 (54%), Gaps = 34/328 (10%)

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           +K N T F+I Y D++Y  GT+GTD + LG   +   TF            LGI LP+ E
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 194 TT------MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKY 247
            T      +SS    + YDN PM LK    I+K  YS+F+NE NA+ GS+LFGAVD SKY
Sbjct: 61  ITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKY 120

Query: 248 KGTLNTVPLVNANYRRRVNKPVELHVTLAAIG---LHTGRDEDKVQTLLGSKV------P 298
            G L T+P++ A            + TL A+G   L T +    + ++ G+K       P
Sbjct: 121 TGQLYTLPMLQA------------YNTLDALGGGMLVTAQSVAILDSISGNKTVSEVQFP 168

Query: 299 ALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS 358
            L DSGT+ +  P +            + S++ GYI DC+  +++ T    DFGGF I +
Sbjct: 169 VLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCS--KVNNTQLSIDFGGFNISA 226

Query: 359 PLSDYSMMTNVRGTCRFGIMPHSSDYV-ILGDVFLTRAYVVFDLEALEVSMAQANYEGGK 417
            +S++ +    +  C   I+P  SD V +LGD FL   YVV+DLE+ EVS+AQA++   +
Sbjct: 227 NISNF-VTPLTKDHCVLQILP--SDTVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEE 283

Query: 418 EQIEVIAGAVPRAVRAPGYNDPWKAYTP 445
           E IE+I+ +VP A  APGY+  W  YTP
Sbjct: 284 EDIEIISDSVPGATPAPGYSSTW-VYTP 310

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  204 bits (519), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 207/409 (50%), Gaps = 37/409 (9%)

Query: 70  QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG-----VRCGPNNYPNPN-------- 116
           + M+Y+  L IGTP Q++ VL DTGS+D W++ +           ++Y N          
Sbjct: 41  EDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFCLSTSSTSSYLNATYDGSIITP 100

Query: 117 QLNCYEHGSFDTSRSSTWKD-NNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXX 175
            ++C    ++    SST+++ +N +F+I Y D T+A GTWGT+ + +    +  + F   
Sbjct: 101 SVDCQSMVTYSEGNSSTYQNLDNGRFYIIYADGTFADGTWGTETVSIDGIVIPNIQFGLA 160

Query: 176 XXXXXXXX-XLGIGLPAMETTMSSQQFGYQ------YDNLPMVLKRNNVIKKTVYSMFIN 228
                     LGIG P  E+       GY+      Y N P +LK   +I    YS+F+N
Sbjct: 161 KYATTPVSGVLGIGFPRRESVK-----GYEGAPNKYYPNFPQILKSEQIIDVVAYSLFLN 215

Query: 229 ELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDK 288
              + TGS++FGA+D SK+ G L T P+VN  Y   V+ P  L +T+  +G    ++  +
Sbjct: 216 SPESGTGSIIFGAIDESKFSGDLFTFPMVN-EYPNIVDTPATLAMTIQGLGAQ-NKNSCE 273

Query: 289 VQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI 348
            +T + +K P LLDSGT+L   P              + +EE  YI+DC +    +  Y 
Sbjct: 274 YETFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAFA-DEIEYT 332

Query: 349 YDFGGFQIRSPLSDYSMMTNVR-GTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVS 407
           +DFG  +I  PL+   +      G C F + P ++D ++LGDVFL+ AYVVFDL+  ++S
Sbjct: 333 FDFGDLKISVPLTSLILSPEAEGGYCGFAVQP-TNDSMVLGDVFLSSAYVVFDLDNYKIS 391

Query: 408 MAQANYEGGKEQIEVIA----GAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           +AQAN++  +   +++     G++P    A    +PW A  P      +
Sbjct: 392 LAQANWDVSEITTKLVNVRADGSIPGGKTATA--EPWTANEPFTVTSNI 438

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  194 bits (492), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/419 (30%), Positives = 211/419 (50%), Gaps = 44/419 (10%)

Query: 55  RLAKRNDW-VDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYP 113
           +LAKRN    D++ +++  FY+  L IG PPQE+ V+ D+GS+D WV+    R  P    
Sbjct: 38  QLAKRNHLKFDLQFEDES-FYATTLKIGDPPQEITVIFDSGSADTWVMS---RYNPFCLS 93

Query: 114 NPN-----------------QLNCYEHGSFDTSRSSTWKD-NNTQFHIRYGDSTYAHGTW 155
           + N                 +++C +  +++ +RS+++++ NN +F+I YGD T+A G W
Sbjct: 94  SSNITANGLKTLYDGKAIIPKVDCSQIKTYNANRSTSFQELNNGRFYIIYGDKTFADGIW 153

Query: 156 GTDRLDLGQANVDGLTF-XXXXXXXXXXXXLGIGLPAMET----TMSSQQFGYQYDNLPM 210
           GT+  + G   +  + F             LGIG    E+    T + + F   Y N P 
Sbjct: 154 GTETFEFGGVKIPNVQFGLADYATTPIGGVLGIGFQRRESVKGYTNAPEVF---YPNFPQ 210

Query: 211 VLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVE 270
           VLK   +I    YS+ + +    +  ++FGA+D + Y G + T P++N  +   V+KP  
Sbjct: 211 VLKNEGIIDTVAYSLSLGQ----SSHIMFGAIDRNSYIGDMVTFPMINM-FPNAVSKPAT 265

Query: 271 LHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEE 330
           L +T+  +G    + E K QT   +K PALLDSG+TL   P++            W   +
Sbjct: 266 LSITIQGLGAQ-NKQECKFQTFSTTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESD 324

Query: 331 VGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTN-VRGTCRFGIMPHSSDYVILGD 389
             Y ++C +   +   YI+DFG  +   PLS+  + +      C FG+   S + ++LGD
Sbjct: 325 GIYTLECPNDTTN-IDYIFDFGDMKFTLPLSNLILPSQGGSNVCGFGLQ-RSDNEIVLGD 382

Query: 390 VFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIA--GAVPRAVRAPGYNDPWKAYTPL 446
           VFL    VVFDL+  ++S+A++N +   E I  I   G +P A+ A    + W  Y P+
Sbjct: 383 VFLCSTLVVFDLDHYQISLAKSNQKSSAEDIVNIPSDGKIPGAIIAKA--EAWTTYEPI 439

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  191 bits (484), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 132/412 (32%), Positives = 197/412 (47%), Gaps = 35/412 (8%)

Query: 56  LAKRNDWVDIEIDNQQMF----------YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGV 105
           L    +W D   D ++ F          Y   + +GTPPQ+++VL DTGS+DLW   +  
Sbjct: 24  LLHPQEWDDTSNDGEKCFSMDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDN 83

Query: 106 RCGPNNYP--------NPNQLN----CYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHG 153
                +YP        N N+ N    C    +++  RSST+     +F I Y + T++ G
Sbjct: 84  EYCAASYPQGDNSTNTNDNEQNMASFCSSSRTYNFQRSSTFTPTGYKFFIDYVN-TFSRG 142

Query: 154 TWGTDRLDLGQANVDGLTFXXXXXXXXXXX-XLGIGLPAMETTMS-SQQFGYQYDNLPMV 211
            W  DRL +G A+V GL F             LG+G   +E+    S      Y NLPM+
Sbjct: 143 IWAKDRLVIGNADVSGLQFGVSNISNTTINGILGVGYERLESVKGYSGAPNRTYPNLPML 202

Query: 212 LKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVEL 271
           LK +  I K  YS+F+N LN+   +V FG VD  KY G L   PLVN    + + +P + 
Sbjct: 203 LKESGKIDKVAYSVFLNHLNSNVSTVTFGGVDSEKYTGDLYKFPLVNI--YKSIPRPSKF 260

Query: 272 HVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEV 331
           H+TL A+ +H G      +T+  + +PAL D+GT     P              +  +  
Sbjct: 261 HITLQALEVH-GNYSSLNKTVSNTPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFS 319

Query: 332 GYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGT--CRFGIMPHSSDYVILGD 389
            Y+  C +     T  ++DFG  QI +PL+++ +     GT  C   I+P    +  LG 
Sbjct: 320 LYLFACPAEE-DDTKLVFDFGDIQIEAPLANFIVPAAELGTEQCGVAIIPEDGTFT-LGI 377

Query: 390 VFLTRAYVVFDLEALEVSMAQANYE-GGKEQIEVIAGAVPRAVRAPGYNDPW 440
            FL   YVV++LE  EV++AQAN++  GK +I  I   +P A +A     PW
Sbjct: 378 PFLRSTYVVYNLEDYEVALAQANWKWDGKSKITPIISNIPGATQATA--TPW 427

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  191 bits (484), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 133/406 (32%), Positives = 198/406 (48%), Gaps = 35/406 (8%)

Query: 73  FYSVNLSIGTPPQEVRVLMDTGSSDLWVV-------------GAGVRCGPNNYPNPNQLN 119
           FYS  L IG+P Q++ +++D+GS+D WV+             GA      N       ++
Sbjct: 46  FYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSGASKNYTYNGKAITETID 105

Query: 120 CYEHGSFDTSRSSTWKDNNT-QFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXX 178
           C    + D + SS ++D N  +F+I Y D ++  G W TD +    A++ GL F      
Sbjct: 106 CQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGVAQYA 165

Query: 179 XXXX-XXLGIGLPAMETTM----SSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAK 233
                  LG+G P  E+      +  +F   YDN P +LK++ +I    YSM++N+ N  
Sbjct: 166 SEEIPGILGLGFPRRESVRGYPGAPNKF---YDNFPQMLKKDGIIDVVAYSMYLNDPNGS 222

Query: 234 TG-SVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
            G SVLFG VD SKY G L T P+ N  Y   V+KP  L VTL   G    + E + +T 
Sbjct: 223 GGGSVLFGGVDPSKYSGDLYTFPMAN-QYPNIVSKPATLAVTLQGFGAQK-KSEGRQETF 280

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWH-SEEVG-YIVDCNSRRLHQTAYIYD 350
             +    LLDSGT+L   P +               SE+ G Y++DC  +    T +++D
Sbjct: 281 DTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKD-DDTEFVFD 339

Query: 351 FGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQ 410
           FG  QI  P+S   +  +    C  G++P    +  LGDVFL+ AY+VFDL+  +VSMA+
Sbjct: 340 FGDLQIAVPVSTLILPPSGESYCGLGVLPKDGTWT-LGDVFLSYAYLVFDLDNYKVSMAK 398

Query: 411 ANYEGGKEQIEVIA----GAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           A + G  +Q   I     G +P A  A     PW +  P   +G +
Sbjct: 399 AKFSGDGDQSPQIKIQTDGTIPGAKSASA--KPWSSSEPSTVSGSI 442

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  190 bits (482), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/411 (29%), Positives = 196/411 (47%), Gaps = 32/411 (7%)

Query: 50  RAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGP 109
           + A   L KR+   + +++ Q  FY+V L +GTP Q++  + DTGSSDLWV         
Sbjct: 36  KPADRSLQKRSKSFESKLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFCL 95

Query: 110 NNYPNPNQ------------LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGT 157
            N  + N             L+C + G FD   S +       F  +Y D +Y+ G W  
Sbjct: 96  GNKLDTNGTNEFHGTEITPILDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVV 155

Query: 158 DRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFGYQ------YDNLPMV 211
           D + +    V  L F            LG+GLP +E        GY       YDN P  
Sbjct: 156 DDISIADQQVPDLQFAVANISSAPSGVLGVGLPRLEAVR-----GYDGAPNANYDNFPQT 210

Query: 212 LKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVEL 271
           LK N +I + +YS++ +  + ++G+VLFG +D  KY G L T+PLVN     ++++P   
Sbjct: 211 LKSNRLINRVLYSLYFDSGDLESGTVLFGGIDEKKYDGVLYTLPLVNI--YEQIDEPAAF 268

Query: 272 HVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEV 331
            +TL  +G+ +     K   +   K PALLDSG+T+   P +            +   + 
Sbjct: 269 DITLQGLGIRS-ESNCKDTVIAHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDG 327

Query: 332 GYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNV-RGTCRFGIMPHSSDYVILGDV 390
            Y++DC +    +T Y +DFG  +++ P+ D   +    +  C   I+    ++ ILGD+
Sbjct: 328 LYVLDCPASNDDRTFY-FDFGELKLKVPIHDLLYLPESGQNYCGLAIIASGEEW-ILGDL 385

Query: 391 FLTRAYVVFDLEALEVSMAQAN-YEGGKEQIEVIAGAVPRAVRAPGYNDPW 440
            L  AYVV+DL+ LE+S+AQ     G + Q     G++P+  ++   + PW
Sbjct: 386 VLKSAYVVYDLDNLEISIAQVKTTSGSRIQTVSATGSLPQTRKS--NSTPW 434

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  182 bits (463), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 176/327 (53%), Gaps = 20/327 (6%)

Query: 124 GSFDTSRSSTWKDNNT--QFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXX 181
           G+FD + SS++  N+T   F I YGD++YA G W TD L +G  +V  +T          
Sbjct: 181 GNFDPNSSSSFNKNDTVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSS 240

Query: 182 XXXLGIGLPAMETTM--SSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLF 239
               GI    +E+++   + Q  ++Y+N P +LK   ++K+  YS+++N   A  G++LF
Sbjct: 241 VAVFGISYRGLESSVFGDNLQDPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILF 300

Query: 240 GAVDHSKYKGTLNTVPLVNANYRRRVNKPVE-LHVTLAAIGLHTGRDEDKVQTLLGSKVP 298
           G VDH+KY G L T+P++     +  + P E   VT+  IG+   +  +   TL  +   
Sbjct: 301 GGVDHNKYSGDLYTLPVLKG---QEDSDPWERFVVTVQGIGI---KGSETQNTLTTTPFI 354

Query: 299 ALLDSGTTLTYFPMQXXXXXXXXXXXXWHSE-EV-GYIVDCNSRRLHQTAYIYDFGGFQI 356
            LLDSGTT  Y P              +  + EV  Y++ C S        +++FGGF I
Sbjct: 355 GLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPS---DDEKIVFNFGGFNI 411

Query: 357 RSPLSDYSMMTNVRGTCRFGIMPHSSDYV-ILGDVFLTRAYVVFDLEALEVSMAQANYEG 415
            + LS+Y +  N  G C   I P +SDY+ ILGD FL  +YVV+D++  E+S+AQAN++ 
Sbjct: 412 ETSLSNY-ITDNGNGQCILNISP-TSDYMGILGDSFLRDSYVVYDMDNNEISLAQANFD- 468

Query: 416 GKEQIEVIAGAVPRAVRAPGYNDPWKA 442
             E +E I G VP A +APGY+  +  
Sbjct: 469 STEDVEAITGPVPGATKAPGYSSTYSG 495

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 2/73 (2%)

Query: 32  RMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLM 91
           ++ F K+ G SF E  S + +        D  +I+I NQ ++YS ++ +GTP QE+ +L+
Sbjct: 31  KIPFSKRYGKSFDE--SRQISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQELTLLL 88

Query: 92  DTGSSDLWVVGAG 104
           DTGSSDLW+   G
Sbjct: 89  DTGSSDLWIPQKG 101

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  179 bits (455), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 210/416 (50%), Gaps = 35/416 (8%)

Query: 55  RLAKRNDWVDIEIDNQQ-MFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYP 113
           R  +R    +I++ ++  ++YS  L IGT  QE+ VL D+GSSD+WV  +       +  
Sbjct: 48  RKLQRRKSTEIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYCLESEG 107

Query: 114 NPNQ----------LNCYEHGSFDTSRSSTWKDNNT-QFHIRYGDSTYAHGTWGTDRLDL 162
             NQ          ++C   G+FD + SS+++  +  +F+I+Y D ++A G W  ++L L
Sbjct: 108 YVNQTYNGETVTPFIDCKALGTFDYNGSSSFERLDIGRFYIKYSDESFADGFWAKEKLRL 167

Query: 163 GQANVDGLTFXXXXXXXXXXX-XLGIGLPAMETTMSSQQFGYQ------YDNLPMVLKRN 215
              ++  L F             LGIG P  E+       GY       Y N P VLK  
Sbjct: 168 NGIDISTLQFGVADYATVPVGGVLGIGFPRRESVK-----GYDDAPNEFYPNFPQVLKNE 222

Query: 216 NVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTL 275
            VI    YSMF+NE+++  GS+LFGAVD +KY G+L T P+VN  Y   V+KP  L +TL
Sbjct: 223 GVIGVAAYSMFLNEVSSDAGSILFGAVDPTKYTGSLYTFPMVN-EYPNVVDKPATLAMTL 281

Query: 276 AAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG-YI 334
            A+G  +     K +T   +K   LLDSGTTL   P +             ++E  G + 
Sbjct: 282 QALGAKSDS-SCKYKTFTTTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNESEGIFY 340

Query: 335 VDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTR 394
            DC S     T +I+DFG  +I  PL+   + ++  G C FG+ P S   + LG +FL+ 
Sbjct: 341 FDCPSDD-DDTEFIFDFGDLKITLPLASLVISSSGDGHCGFGLTPASYS-MTLGAIFLSS 398

Query: 395 AYVVFDLEALEVSMAQANYEGGKEQIEVIA----GAVPRAVRAPGYNDPWKAYTPL 446
           AYVV+DL+  ++S+AQA ++G   Q   +     G +  A +A     PW    P+
Sbjct: 399 AYVVYDLDNYQISIAQAKWDGNPSQKSRVRIPKDGTIYGATKATA--TPWTTDEPV 452

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  166 bits (419), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 115/382 (30%), Positives = 183/382 (47%), Gaps = 33/382 (8%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWV--------VGA--------GVRCGPNNYPNPNQ 117
           Y + + +GTPPQ++  ++DTGS+DLW+        VGA        GV   P+       
Sbjct: 46  YDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQEVRGVTVTPS------- 98

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           ++C    +F    S+T +     F+I Y D T+  G+W TDRL +G  +V G+ F     
Sbjct: 99  IDCRGIKTFCNESSTTLRILPNPFYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGRT 157

Query: 178 XXXXXX-XLGIGLPAMETTMS-SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTG 235
                   LG+G   +E+    +      Y NLP  LK +  ++K  YS+ + + + + G
Sbjct: 158 SNTELSGVLGVGHANLESVRGYAGAPNATYPNLPRQLKLDGSVQKLAYSVSLQKTSERDG 217

Query: 236 SVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGS 295
            +LFGA+D SKY G L+T P++N +    +N P   ++ L  I +  GR     + L+ S
Sbjct: 218 EILFGAIDTSKYVGKLHTFPILNID--PHLNSPSNFYIALQGIDIQGGRSSTG-RPLINS 274

Query: 296 KVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQ 355
              ALLD+GT                    + +E+  +++ C +       + ++FG  Q
Sbjct: 275 SFHALLDTGTGGMVV-SSLAEDIGAALNATYDTEQCVFVIQCPTED-DTRQFNFNFGELQ 332

Query: 356 IRSPLSDYSMMTN--VRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANY 413
           I  P+S++ +  +    G C   IMP +S+   LG  FL   Y VF+LE  E+SMA+AN 
Sbjct: 333 IAVPISNFVVPASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNEISMARANT 392

Query: 414 EGGKEQIEVIAGAVPRAVRAPG 435
              +  I  I   VP A+R  G
Sbjct: 393 NPQEPDIRPIPAGVPAAIRDSG 414

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  161 bits (408), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 96/236 (40%), Positives = 135/236 (57%), Gaps = 9/236 (3%)

Query: 210 MVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPV 269
           M LK +  I+K  YS+F+NE  A  GS+LFGAVD SKY G L T+P++ A Y    +   
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQA-YDTLDSVSP 59

Query: 270 ELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSE 329
            + VT  ++ +  G   +K  T+   + P L DSGTT +  P +            + S 
Sbjct: 60  GMFVTAQSVAVLNGDSGNK--TVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSG 117

Query: 330 EVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGD 389
           + GY  DC+  ++  T    DFGGF I + +S++  +T  +  C   I    S +V LGD
Sbjct: 118 DQGYTFDCS--KVKDTLLSIDFGGFNISANISNF--VTRTKDHCLLNIEAADSGFV-LGD 172

Query: 390 VFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTP 445
            FL  AYVVFDLE+ EVS+AQA+++  KE+IEVI+  VP A+RAPGY+  W  YTP
Sbjct: 173 AFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW-VYTP 227

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  163 bits (413), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 133/427 (31%), Positives = 203/427 (47%), Gaps = 34/427 (7%)

Query: 37  KKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSS 96
           +KR  S   + S R+AV    +R +          ++Y   L  GTPPQ + +++DTGSS
Sbjct: 25  EKRIVSSHASLSKRSAVDLQFRRFN---------NLYYESVLEFGTPPQSIPLVLDTGSS 75

Query: 97  DLWVVGAGVRCGPNN---YPNPNQLNCYEHGSFDTSRSSTWKD-NNTQFHIRYGDSTYAH 152
           DLWV   G     N     P    ++C     +D  +S T+    N  F I Y D+TY  
Sbjct: 76  DLWVTLIGNPLCYNKGSGKPPKCLIDCSGLVFYDMDKSQTFDYLKNVTFKIGYADTTYTS 135

Query: 153 GTWGTDRLDLGQANVDGLTF-XXXXXXXXXXXXLGIGLPAMETTMSSQQF--GYQYDNLP 209
           G W  D + L + ++  L F             LGIG PAME +++  +F  G  Y N P
Sbjct: 136 GIWIVDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPAME-SVNGYEFAPGKFYPNFP 194

Query: 210 MVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPV 269
           + LK         YS+  N+  +K GS+LFG++D S++ G L T P++N  +    ++P 
Sbjct: 195 LALKNAGFTNIAAYSIEYND-ESKKGSILFGSIDTSRFIGPLYTFPMIN-EFPGIADEPS 252

Query: 270 ELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSE 329
            L +TL  IG+  G  E  V +   +K+PALLD+G+TL   P              W  +
Sbjct: 253 TLSLTLDGIGID-GSCEQWVIS--NTKLPALLDTGSTLIELPHPITQSIASYLNATWSDD 309

Query: 330 EVGYIVDCNSRR-LHQTAYIYDFGGFQIRSPLSDYSMMTNVR--GTCRFGIMPHSSDYVI 386
              +++ C S   L  T   + FG   ++ PL  + ++ +    G C  GI   S   VI
Sbjct: 310 HGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFILLPDEESNGLCGLGIT-SSKGRVI 368

Query: 387 LGDVFLTRAYVVFDLEALEVS---MAQANYEGGKEQIEVIA-GAVPRAVRAPGYNDPWKA 442
           LGD FLT  Y VFDL+   +S   MA+++  G  + IE+ A G +  AV +   ++ W  
Sbjct: 369 LGDSFLTHVYTVFDLDNYMISLAPMAKSSLPG--KVIEIPANGLIENAVISK--SEKWTH 424

Query: 443 YTPLVFN 449
           +  +  N
Sbjct: 425 FNDITVN 431

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  164 bits (414), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 182/390 (46%), Gaps = 42/390 (10%)

Query: 80  IGTPPQEVRVLMDTGSSDLWVVGA-GVRCGPNN-----YPNPNQLNCYEHGS-------- 125
           +GTP Q +R L+DT SSD+W++ +    C   N       N N     E  S        
Sbjct: 84  VGTPSQAIRFLLDTDSSDIWLLNSNSTFCESENGTVNIDSNSNSTLANETASRSDAYQCK 143

Query: 126 ----FDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXX 181
               F    SS++  N+  FH++Y D +YA+GTW  D    G  +   +           
Sbjct: 144 LVNVFYPEDSSSFVLNDLDFHVQYDDYSYANGTWSQDTFSFGYPSFYNVNIALVSETNLT 203

Query: 182 XXXLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGA 241
              LG+GL A + T       + Y++L   LK    I+K  YS++ +ELN   G + FG 
Sbjct: 204 VGSLGLGLRANQATNQGDD-PFVYNSLLYRLKTQGWIEKIAYSVYTSELNGTGGGIFFGG 262

Query: 242 VDHSKYKG-TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
           + H  YKG  L T+PLVN +    +++P   H+TL  +   T        ++L  K PAL
Sbjct: 263 LYHDLYKGNVLYTLPLVNVD--PELDEPARFHITLQNL---TTSINGTNFSVLSEKYPAL 317

Query: 301 LDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG-YIVDCNSRRLHQTAYIYDFGGFQIRSP 359
           L +G+  TY P +              ++    Y++ C++       +IYDFGGF+I +P
Sbjct: 318 LSTGSMFTYLPEELFDSFVDEMDLEKGAKHKDLYVIPCDT----NATFIYDFGGFEIETP 373

Query: 360 LSDYSMMTNVRGT----CRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEG 415
           LS Y+       T    C   + PH+  Y+ LG+ F    YV+F+LE LE+SMA A    
Sbjct: 374 LSGYTFKVESNRTADDMCAVMVKPHNKSYLTLGNGFFAATYVLFNLEDLEISMAPA---S 430

Query: 416 GKEQI-----EVIAGAVPRAVRAPGYNDPW 440
           G E +     E I  ++P A RA  Y++ W
Sbjct: 431 GIEYLDAFDYEYIESSIPSASRAASYSNTW 460

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  141 bits (355), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 127/233 (54%), Gaps = 15/233 (6%)

Query: 189 LPAMETT------MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAV 242
           LP++E T      MS     Y YDN PM LKR   I+K  YS+F+NE NA+ GS+LFGAV
Sbjct: 1   LPSVEETDEIENVMSPDTTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAV 60

Query: 243 DHSKYKGTLNTVPLVNANYRRRVNKPVEL---HVTLAAIGLHTGRDEDKVQTLLGSKVPA 299
           D SKY G L T+P++ A      +  +E+    V + ++ +   +  +K  T+   + P 
Sbjct: 61  DKSKYSGQLYTLPMLKAYNTLDSSAGMEITAQSVAILSVAIIDSKSGNK--TVSEVQFPV 118

Query: 300 LLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSP 359
           L DSGT+ +  P +            + S+  GYI DC+  +++ T    DFGGF I + 
Sbjct: 119 LFDSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDCS--KVNNTLLSIDFGGFNISAN 176

Query: 360 LSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412
           +S+ S+    +  C   I    S YV LGD FL   YVVFDLE+ EVS+AQA+
Sbjct: 177 ISN-SVTPITKDHCLLNIEADDSGYV-LGDAFLIDTYVVFDLESHEVSVAQAS 227

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  138 bits (347), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 136/263 (51%), Gaps = 23/263 (8%)

Query: 65  IEIDNQQ---MFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG-VRC---GPNNYPNPNQ 117
           +E+D Q     FYS  LS G P Q V VL+DTGSSDLWV     + C   G N   N + 
Sbjct: 53  LELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYCYEDGKNTNIN-HS 111

Query: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXX 177
           +NC + G++   +SST    + +  I+YGD ++A G W TD L +G  ++  + F     
Sbjct: 112 INCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQFGISNN 171

Query: 178 XXXXXX-XLGIGLPAMETTMSSQQFGYQ------YDNLPMVLKRNNVIKKTVYSMFINEL 230
                   LG+G    E+       GY       Y NLP  LK   +     +S+F+N  
Sbjct: 172 ASTIISGVLGLGFLRTESID-----GYDGSPNKLYYNLPAYLKDQEITNTNAFSLFLNNS 226

Query: 231 NAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQ 290
           N  +G+VLFG +D+SK+ G L T PLVN  Y + +N+P    +TL    L+   +  K  
Sbjct: 227 NDASGTVLFGGIDYSKFSGDLVTFPLVNI-YPKLINEPCTFTITLQQ--LYGKINGGKSI 283

Query: 291 TLLGSKVPALLDSGTTLTYFPMQ 313
            L+  KVPALLDSG++L   P++
Sbjct: 284 GLIKEKVPALLDSGSSLISMPIE 306

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  122 bits (307), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 97/376 (25%), Positives = 163/376 (43%), Gaps = 40/376 (10%)

Query: 73  FYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPN----QLNCYEHGSFDT 128
           +Y  N+ IG PPQ + VL+DTGSSDLWV        PN   NPN     ++C     F+ 
Sbjct: 30  YYETNILIGNPPQNIGVLVDTGSSDLWV------NSPN---NPNCYNGNIDCTGFTFFNK 80

Query: 129 SRSSTWKD--NNTQFHIRYGDSTYAHGTWGTDRLDLGQ------------ANVDGLTFXX 174
           S S T+ +   N+ F I Y D++Y  G WG D + +              AN+    F  
Sbjct: 81  SNSKTFSNIYKNSIFQIGYQDASYTFGKWGVDSISINSSYSDSNEDTGLYANIPNAQFAI 140

Query: 175 XXXXXX-XXXXLGIGLPAMETT----MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINE 229
                      LG+G P  E      +++ +F   Y NLP ++K++        +M++  
Sbjct: 141 ATNSNVPVQAVLGLGFPRREAVNGYKLATNKF---YPNLPQLIKQHGYSDNVTIAMYLGS 197

Query: 230 LNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDE-DK 288
            N    S++FGA D ++Y G L+  P+VN  Y    +KP    +TL ++ +    ++ D 
Sbjct: 198 -NETYNSIMFGAYDKTRYIGDLHNFPMVNQ-YPNVTDKPATFAITLDSMYISMDNNQSDN 255

Query: 289 VQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI 348
           +      K   +LDSGT+L   P              + +    Y++   +        I
Sbjct: 256 IYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMI 315

Query: 349 YDFGGFQIRSPLSDYSMMTNVRGTCRFGIMP--HSSDYVILGDVFLTRAYVVFDLEALEV 406
            +F       P++    +     +  F I+P  + +   +LGD+FL   Y +F+L+   +
Sbjct: 316 INFKFMDFNVPINMLEFILPYDDSYVFAILPTKNVNTGFVLGDIFLPHVYTIFNLDNYTI 375

Query: 407 SMAQANYEGGKEQIEV 422
           S+  +N      + E+
Sbjct: 376 SLGLSNQNITSNEREI 391

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score =  109 bits (273), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/356 (26%), Positives = 154/356 (43%), Gaps = 60/356 (16%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++++GTPPQ  +V++DTGSS+LWV    V CG         L CY H  +D  +SS+
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV--PSVECG--------SLACYLHSKYDHDKSSS 143

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           +K N T F IRYG  +   G    D L++G  N+    F             G       
Sbjct: 144 YKPNGTDFAIRYGTGSL-EGYISQDTLNIGDLNIPKQDFAEATSEPGLTFAFG------- 195

Query: 194 TTMSSQQFGYQYDNL---PMVLKRNNVIKKTV-----YSMFINELNAKT---GSVLFGAV 242
                   G  YD++    +V    N I++ +     ++ ++ + N K+   G +  G +
Sbjct: 196 --KFDGILGLAYDSISVNKVVPPFYNAIEQELLDEKKFAFYLGDANKKSEDGGEITIGGI 253

Query: 243 DHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLD 302
           D +K+KG ++ +P+     RR+        V    IGL      D+   L      A +D
Sbjct: 254 DKTKFKGDIDWLPV-----RRK----AYWEVKFEGIGLG-----DQFAEL--ENHGAAID 297

Query: 303 SGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL 360
           +GT+L   P  +             W  +   Y V+C++R  +     ++F G       
Sbjct: 298 TGTSLIALPSGLAEIINTEIGAKKGWTGQ---YTVECDARP-NLPDLTFNFNGKNFTIGP 353

Query: 361 SDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
            DY++   V G+C   IMP           I+GD FL + Y ++DLE   V +A+A
Sbjct: 354 YDYTL--EVSGSCISAIMPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAVGLAEA 407

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score =  106 bits (264), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 155/353 (43%), Gaps = 54/353 (15%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++++GTPPQ+ +V++DTGSS+LWV  +   CG         L C+ H  +D S SS+
Sbjct: 101 YYTDITLGTPPQQFKVILDTGSSNLWVPSS--ECG--------SLACFLHEKYDHSASSS 150

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG-----IG 188
           +K N T F I+YG  +   G    D L +G   +    F             G     +G
Sbjct: 151 YKANGTDFSIQYGSGS-LEGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILG 209

Query: 189 LPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT---GSVLFGAVDHS 245
           L A +T    +     Y+ L       +++ +  ++ ++ + N      G  +FG VD S
Sbjct: 210 L-AYDTISVDKVVPPFYNAL-----EQDLLDEAKFAFYLGDTNKDAEDGGEAIFGGVDKS 263

Query: 246 KYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGT 305
           KY G +  +P+     RR+    V+L       GL  G +  ++++       A +D+GT
Sbjct: 264 KYTGDVTWLPV-----RRKAYWEVKLE------GLGLGDEYAELESH-----GAAIDTGT 307

Query: 306 TLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDY 363
           +L   P  +             W  +   Y ++CN+R        ++F G+       DY
Sbjct: 308 SLITLPSGLAEIINSEIGAKKGWTGQ---YTLECNTRD-QLPDLTFNFNGYNFTIGPYDY 363

Query: 364 SMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           ++   V G+C   I P           I+GD FL + Y ++DLE   V +A+A
Sbjct: 364 TL--EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLEHNAVGLAKA 414

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 98/357 (27%), Positives = 144/357 (40%), Gaps = 62/357 (17%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y   +S+GTPPQ  +V++DTGSS+LWV      CG         L C+ H  +    SS+
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWV--PSDECG--------SLACFLHSKYSHDASSS 147

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           +K N T F I+YG  +   G    D L +G   +    F             G       
Sbjct: 148 YKANGTSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFG------- 199

Query: 194 TTMSSQQFGYQYDNL------PMVLKRNN--VIKKTVYSMFINELN---AKTGSVLFGAV 242
                   G  YD +      P V K  N  ++ +  ++ ++N  +     TG V FG +
Sbjct: 200 --KFDGILGLGYDTISVDKVVPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGI 257

Query: 243 DHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLD 302
           D SKYKG +  +P+     RR+        V    IGL      D+   L G+   A +D
Sbjct: 258 DSSKYKGDITWLPV-----RRKAY----WEVKFDGIGLG-----DEYAELQGTG--AAID 301

Query: 303 SGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSR-RLHQTAYIYDFGGFQIRSP 359
           +GT+L   P  +             W  +   Y VDC SR +L    + ++   F I + 
Sbjct: 302 TGTSLIALPSGLAEVLNSEIGAKKGWTGQ---YTVDCESRDQLPDLTFTFNGKNFTITA- 357

Query: 360 LSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
              Y     V G+C     P           I+GD FL + Y ++DL    V +AQA
Sbjct: 358 ---YDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLGNNAVGLAQA 411

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 144/357 (40%), Gaps = 62/357 (17%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y   +++GTPPQ  +V++DTGSS+LWV      CG         L C+ H  +    SS+
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWV--PSDECG--------SLACFLHSKYSHDASSS 152

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           +K N T F I+YG  +   G    D L +G   +    F             G       
Sbjct: 153 YKANGTNFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFG------- 204

Query: 194 TTMSSQQFGYQYDNL------PMVLKRNN--VIKKTVYSMFINELN---AKTGSVLFGAV 242
                   G  YD +      P V K  N  ++ +  ++ ++N  +     TG V FG +
Sbjct: 205 --KFDGILGLGYDTIAVDKVVPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGI 262

Query: 243 DHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLD 302
           D SKYKG +  +P+     RR+        V    IGL      D+   L G+   A +D
Sbjct: 263 DSSKYKGNITWLPV-----RRK----AYWEVKFDGIGLG-----DEYAELEGTG--AAID 306

Query: 303 SGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSR-RLHQTAYIYDFGGFQIRSP 359
           +GT+L   P  +             W  +   Y VDC SR +L    + ++   F I   
Sbjct: 307 TGTSLIALPSGLAEVLNAEIGAKKGWSGQ---YTVDCESRDQLPDLTFTFNGKNFTI--- 360

Query: 360 LSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
            S Y     V G+C     P           I+GD FL + Y V+DL    V +AQA
Sbjct: 361 -SAYDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQA 416

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 95/355 (26%), Positives = 145/355 (40%), Gaps = 59/355 (16%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y   +S+GTPPQ  +V++DTGSS+LWV  A   CG         L C+ H  +D   SS+
Sbjct: 91  YYTEISLGTPPQNFKVILDTGSSNLWVPSA--ECG--------SLACFLHAKYDHDSSSS 140

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           +K N + F I+YG  +   G    D L +G   +    F             G       
Sbjct: 141 YKANGSSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFG------- 192

Query: 194 TTMSSQQFGYQYDNL------PMVLK--RNNVIKKTVYSMFINELNAKT--GSVLFGAVD 243
                   G  YD++      P V     N ++ +  +S ++   +  T  G   FG +D
Sbjct: 193 --KFDGILGLAYDSISVDKVVPPVYNAIHNGLLDEPKFSFYLGNADKSTDGGEATFGGID 250

Query: 244 HSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDS 303
            SKY+G +  +P+     RR+        V    IGL      D+   L G    A +D+
Sbjct: 251 SSKYEGNITWLPV-----RRKAY----WEVKFDGIGLG-----DEYAILDGHG--AAIDT 294

Query: 304 GTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLS 361
           GT+L   P  +             W  +   Y V+C++R       + +FGG+       
Sbjct: 295 GTSLIALPSGLAEILNAEIGAKKGWSGQ---YSVECDTRDSLPDLTL-NFGGYNFTITPY 350

Query: 362 DYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           DY++   V G+C     P           I+GD FL + Y V+DL    V +A+A
Sbjct: 351 DYTL--EVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVGLAKA 403

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 154/358 (43%), Gaps = 64/358 (17%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++++GTPPQ  +V++DTGSS+LWV      CG         L C+ H  +D   SS+
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV--PSNECG--------SLACFLHSKYDHEASSS 140

Query: 134 WKDNNTQFHIRYG---------DSTYAHGTWGTDRLDLGQANVD-GLTFXXXXXXXXXXX 183
           +K N T+F I+YG           T + G     + D  +A  + GLTF           
Sbjct: 141 YKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTF----AFGKFDG 196

Query: 184 XLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT---GSVLFG 240
            LG+G   +        F   Y+ +     + +++ +  ++ ++ + +  +   G   FG
Sbjct: 197 ILGLGYDTISVDKVVPPF---YNAI-----QQDLLDEKKFAFYLGDTSKDSENGGEATFG 248

Query: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
            +D SK+KG +  +P+     RR+        V    IGL      D+   L G    A 
Sbjct: 249 GIDESKFKGDITWLPV-----RRKAY----WEVKFEGIGLG-----DEYAELEGHG--AA 292

Query: 301 LDSGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS 358
           +D+GT+L   P  +             W  +   Y +DCN+R       I++F G+    
Sbjct: 293 IDTGTSLITLPSGLAEMINAELGAKKGWTGQ---YTLDCNTRD-SLPDLIFNFNGYNFTI 348

Query: 359 PLSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
              DY++   V G+C   I P           I+GD FL + Y ++DL    V +A+A
Sbjct: 349 GPYDYTL--EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLAKA 404

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/358 (25%), Positives = 157/358 (43%), Gaps = 64/358 (17%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++++GTPPQ  +V++DTGSS+LWV      CG         L C+ H  +D   SS+
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV--PSNECG--------SLACFLHSKYDHEASSS 140

Query: 134 WKDNNTQFHIRYG---------DSTYAHGTWGTDRLDLGQANVD-GLTFXXXXXXXXXXX 183
           +K N T+F I+YG           T + G     + D  +A  + GLTF           
Sbjct: 141 YKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTF----AFGKFDG 196

Query: 184 XLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT---GSVLFG 240
            LG+G   +        F   Y+ +     + +++ +  ++ ++ + +  T   G   FG
Sbjct: 197 ILGLGYDTISVDKVVPPF---YNAI-----QQDLLDEKRFAFYLGDTSKDTENGGEATFG 248

Query: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
            +D SK+KG +  +P+     RR+        V    IGL  G +  ++++       A 
Sbjct: 249 GIDESKFKGDITWLPV-----RRKAY----WEVKFEGIGL--GDEYAELESH-----GAA 292

Query: 301 LDSGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS 358
           +D+GT+L   P  +             W  +   Y +DCN+R  +    I++F G+    
Sbjct: 293 IDTGTSLITLPSGLAEMINAEIGAKKGWTGQ---YTLDCNTRD-NLPDLIFNFNGYNFTI 348

Query: 359 PLSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
              DY++   V G+C   I P           I+GD FL + Y ++DL    V +A+A
Sbjct: 349 GPYDYTL--EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKA 404

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score =  100 bits (248), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 95/352 (26%), Positives = 151/352 (42%), Gaps = 52/352 (14%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++S+GTPPQ  +V++DTGSS+LWV  +   C        N L C+ H  +D   SS+
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWVPSS--EC--------NSLACFLHSKYDHDASSS 141

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG-----IG 188
           +K N T+F I+YG S    G    D L++G   +    F             G     +G
Sbjct: 142 YKANGTKFAIQYG-SGSLEGYISQDTLNIGDLTIPKQDFAEATSEPGLTFAFGKFDGILG 200

Query: 189 LPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT-GSVLFGAVDHSKY 247
           L A +T    +     Y+ +   L      KK  + +   + + K  G +  G +D SK+
Sbjct: 201 L-AYDTISVDKVVPPFYNAIEQGLLDE---KKFAFYLGDTKKDEKNGGEITIGGIDESKF 256

Query: 248 KGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTL 307
           KG +  +P+    Y     + + L    AA+  H                 A +D+GT+L
Sbjct: 257 KGDIEWLPVRRKAYWEVKFEGIALGDQYAALENHG----------------AAIDTGTSL 300

Query: 308 TYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRR-LHQTAYIYDFGGFQIRSPLSDYS 364
              P  +             W  +   Y +DC++R  L    + ++   F I SP  DY+
Sbjct: 301 ITLPSGLAEIINTEIGAKKGWTGQ---YTLDCDTRDGLPDLTFNFNGKNFTI-SPF-DYT 355

Query: 365 MMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           +   V G+C   IMP           I+GD FL + Y ++DL+   V +A+A
Sbjct: 356 L--EVSGSCISAIMPMDFPEPMGPMAIVGDAFLRKYYSIYDLDNHAVGLAEA 405

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 99.4 bits (246), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 156/358 (43%), Gaps = 64/358 (17%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++++GTPPQ  +V++DTGSS+LWV      CG         L C+ H  +D   SS+
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV--PSNECG--------SLACFLHSKYDHEASSS 140

Query: 134 WKDNNTQFHIRYG---------DSTYAHGTWGTDRLDLGQANVD-GLTFXXXXXXXXXXX 183
           +K N T+F I+YG           T + G     + D  +A  + GLTF           
Sbjct: 141 YKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTF----AFGKFDG 196

Query: 184 XLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT---GSVLFG 240
            LG+G   +        F   Y+ +     + +++ +  ++ ++ + +  +   G   FG
Sbjct: 197 ILGLGYDTISVDKVVPPF---YNAI-----QQDLLDEKKFAFYLGDTSKDSENGGEATFG 248

Query: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
            +D SK+KG +  +P+     RR+        V    IGL  G +  ++++       A 
Sbjct: 249 GIDESKFKGDITWLPV-----RRKAY----WEVKFEGIGL--GDEYAELESH-----GAA 292

Query: 301 LDSGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS 358
           +D+GT+L   P  +             W  +   Y +DCN+R       I++F G+    
Sbjct: 293 IDTGTSLITLPSGLAEMINAELGAKKGWTGQ---YTLDCNTRD-SLPDLIFNFNGYNYTI 348

Query: 359 PLSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
              DY++   V G+C   I P           I+GD FL + Y ++DL    V +A+A
Sbjct: 349 GPYDYTL--EVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLAKA 404

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 153/365 (41%), Gaps = 71/365 (19%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++S+GTPPQ+ +V++DTGSS+LWV    V CG         L C+ H  +D S+SST
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWV--PSVDCG--------SLACFLHNKYDHSQSST 140

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG-----IG 188
           +  +     I YG  +   G    D L +G   +    F             G     +G
Sbjct: 141 YIKDGRPLSISYGSGS-IEGYISEDNLQIGDLTIQNQKFGETTSEPGLAFAFGKFDGILG 199

Query: 189 LPAMETTMSSQQFGYQYDNLPMVLK--RNNVIKKTVYSMFINELN--------AKTGSVL 238
           L A +T         Q D  P      + +++ ++ +S ++  +N        A  G V 
Sbjct: 200 L-AYDTIA-------QDDITPPFYSAIQQHLLDESKFSFYLKSVNDPAAEGGSASDGGVF 251

Query: 239 -FGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGL---HTGRDEDKVQTLLG 294
             G VD SK+KG L  +PL        V +     V L AI L    TG+ E+       
Sbjct: 252 TLGGVDSSKFKGDL--IPL-------HVRRQAYWEVPLNAIKLGDQSTGKLEN------- 295

Query: 295 SKVPALLDSGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSR-RLHQTAYIYDF 351
               A +D+GT+L   P  M             W  +   Y ++C++R +L    +  D 
Sbjct: 296 --TGAAIDTGTSLITLPSDMAEIINAQIGAKKGWTGQ---YTLECSTRAKLPDLTFTLDG 350

Query: 352 GGFQIRSPLSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEV 406
             F     LS +     V G+C   I P           ILGD FL R Y VFDL+A  V
Sbjct: 351 HDFV----LSPFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVFDLDANVV 406

Query: 407 SMAQA 411
           S+A+A
Sbjct: 407 SLAEA 411

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 96/373 (25%), Positives = 150/373 (40%), Gaps = 56/373 (15%)

Query: 56  LAKRNDWVDIEIDN-QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPN 114
            AK ND    E+ N     Y+ +++IGTPPQ+ RV++DTGSS LWV G   R        
Sbjct: 74  FAKNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKECRA------- 126

Query: 115 PNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXX 174
              + C  H  +D  RSST+K+N T   + YG  +   G    D   +    + G  F  
Sbjct: 127 ---MACRLHKRYDHDRSSTYKENGTLTGVTYGSGS-IMGYVSEDTFRISDLEIPGQQFTE 182

Query: 175 XXXX-------XXXXXXLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFI 227
                            LG+  P++         GY        L    ++K+ V+ M++
Sbjct: 183 TTDEPGSVFVFAAFDGILGLAYPSL---------GYGVTPPFQQLMEKKLVKEPVFGMYL 233

Query: 228 NELNAKTGS--VLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRD 285
           +++    G+  ++ G  D +K+KG +  +P+    Y   V   V +           G D
Sbjct: 234 DDMKTGEGNGQLVLGGYDETKFKGEIAWLPVRRQAYWEVVFDSVTV-----------GDD 282

Query: 286 EDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQT 345
              ++        A +DSGT+L  FP +                +    VDC ++   QT
Sbjct: 283 NIPLENY-----GAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYVDCANK---QT 334

Query: 346 A--YIYDFGGFQIRSPLSDYSM-MTNVRGTCRFGIMPHSSD----YVILGDVFLTRAYVV 398
           A    + FGG +      DY + +      C   I+    D      I+GDVFL R Y +
Sbjct: 335 APPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIGDVFLRRYYSI 394

Query: 399 FDLEALEVSMAQA 411
           +D     V +A A
Sbjct: 395 YDFGNNAVGLATA 407

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 84/168 (50%), Gaps = 9/168 (5%)

Query: 290 QTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIY 349
           +T + +K P LLDSGT+L   P              + ++E  YI+DC     +   Y +
Sbjct: 17  ETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDC-PESTYDVEYTF 75

Query: 350 DFGGFQIRSPLSDYSMMTNVRGT-CRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSM 408
           DFG  QI  PL+   +     G  C F + P ++D ++LGDVFL+ AYVVFDL+  ++S+
Sbjct: 76  DFGDLQINVPLTSLILSPETEGGYCGFAVQP-TNDSMVLGDVFLSSAYVVFDLDNYKISL 134

Query: 409 AQANYEGGKEQIEVI----AGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452
           AQAN+    +  +++     G++P    A     PW    P     ++
Sbjct: 135 AQANWNASNDSKQLVNIPTDGSIPSGKSATA--QPWSTNVPFTVTSDI 180

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 151/358 (42%), Gaps = 64/358 (17%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++S+G PPQ  +V++DTGSS+LWV      CG         L C+ H  +D   SS+
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWV--PSTECG--------SLACFLHSKYDHEASSS 141

Query: 134 WKDNNTQFHIRYG---------DSTYAHGTWGTDRLDLGQANVD-GLTFXXXXXXXXXXX 183
           +K N T+F I+YG           T + G     + D  +A  + GLTF           
Sbjct: 142 YKPNGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTF----AFGKFDG 197

Query: 184 XLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT---GSVLFG 240
            LG+G   +        F   Y+ +     + +++ +  ++ ++ + +  +   G   FG
Sbjct: 198 ILGLGYDTISVDKVVPPF---YNAI-----QQDLLDEKKFAFYLGDTSKDSENGGEATFG 249

Query: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
            +D SK+KG +  +P+     RR+        V    IGL       +   L G    A 
Sbjct: 250 GIDKSKFKGDVTWLPV-----RRKAY----WEVKFEGIGLG-----HEFAELEGHG--AA 293

Query: 301 LDSGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS 358
           +D+GT+L   P  +             W  +   Y +DCN+R        ++F G+    
Sbjct: 294 IDTGTSLITLPSGLAEMINAEIGAKKGWSGQ---YALDCNTRD-GLPDLTFNFNGYNFTI 349

Query: 359 PLSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
              DY++   V G+C   I P           I+GD FL + Y ++DL    V +A+A
Sbjct: 350 GPYDYTL--EVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLAEA 405

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 98/367 (26%), Positives = 161/367 (43%), Gaps = 62/367 (16%)

Query: 64  DIEIDNQ-QMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYE 122
           D+ +DN     Y  ++SIGTPPQ+ +V++DTGSS+LWV   G           + L CY 
Sbjct: 75  DVPLDNYLNAQYYTDVSIGTPPQKFKVILDTGSSNLWVPSVGC----------SSLACYL 124

Query: 123 HGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXX 182
           H  +D S SST++ N + F I+YG  +   G    D L +G   +    F          
Sbjct: 125 HSKYDHSLSSTYRSNGSDFVIQYGSGS-LKGYISQDTLTIGDLIIPQQDFAEATAEPGLA 183

Query: 183 XXLG-----IGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFI-NELNAKT-G 235
              G     +GL A ++   ++     Y+ +        ++ K +++ ++ +E ++K  G
Sbjct: 184 FAFGKFDGILGL-AYDSISVNKAVPPLYNAI-----HRGLLDKPMFAFYLGDEKSSKNGG 237

Query: 236 SVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGS 295
              FG  D S+++G +  +P+     RR+    V+        G+  G   DK   L G 
Sbjct: 238 EATFGGYDPSRFEGEIKWLPV-----RRKAYWEVQFD------GIKLG---DKFMKLEGH 283

Query: 296 KVPALLDSGTTLTYFPMQXXXXXXXX--XXXXWHSEEVGYIVDCNSR----RLHQTAYIY 349
              A +D+GT+L   P Q              W+ +   Y +DC  R    +L    Y +
Sbjct: 284 G--AAIDTGTSLITLPSQIADFLNNEIGAKKSWNGQ---YTIDCKKRESLPKLTLNFYNH 338

Query: 350 DFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEAL 404
           +F       P  DY++   + G+C   I P           I+GD FL R Y ++DLE  
Sbjct: 339 NF----TIDPF-DYTL--EISGSCISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENN 391

Query: 405 EVSMAQA 411
            V +A++
Sbjct: 392 AVGLAKS 398

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 98.2 bits (243), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 95/193 (49%), Gaps = 10/193 (5%)

Query: 265 VNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXX 324
           V+ P  L +T+  +G    +   + +T + +K P LLDSGT+L   P             
Sbjct: 203 VDVPATLAMTIQGLGAQ-NKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNA 261

Query: 325 XWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRG-TCRFGIMPHSSD 383
            + ++E  YI+DC     +   Y +DFG  QI  PL+   +     G  C F + P ++D
Sbjct: 262 SYSADEGIYILDC-PESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQP-TND 319

Query: 384 YVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIA----GAVPRAVRAPGYNDP 439
            ++LGDVFL+ AYVVFDL+  ++S+AQAN+    +  +++     G++P    A     P
Sbjct: 320 SMVLGDVFLSSAYVVFDLDNYKISLAQANWNASNDSKQLVNIPTDGSIPSGKSATA--QP 377

Query: 440 WKAYTPLVFNGEL 452
           W    P     ++
Sbjct: 378 WSTNVPFTVTSDI 390

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 95/353 (26%), Positives = 148/353 (41%), Gaps = 55/353 (15%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++++GTP Q  +V++DTGSS+LWV    V C        N L CY H  +D S SST
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWV--PSVDC--------NSLACYLHAKYDHSDSST 138

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG-----IG 188
           +K N T F I+YG  +   G    D L +G   + G  F             G     +G
Sbjct: 139 YKKNGTTFSIQYGSGS-MEGYISQDVLQIGDLVIPGQDFAEATSEPGLAFAFGKFDGILG 197

Query: 189 LPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINE--LNAKTGSVLFGAVDHSK 246
           L A +T   ++     Y+ +        ++ + ++S ++ +   +   G V FG  D S 
Sbjct: 198 L-AYDTIAVNRVVPPFYNAI-----NKKLVDEPIFSFYLGDDTKSEDGGQVTFGGYDSSL 251

Query: 247 YKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTT 306
           + G +  +P+     RR+        V   AI L      ++V  L+     A +D+GT+
Sbjct: 252 FTGDITWLPV-----RRK----AYWEVKFDAIALG-----NEVADLVNHG--AAIDTGTS 295

Query: 307 LTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSR-RLHQTAYIYDFGGFQIRSPLSDY 363
           L   P  +             W  +   +IVDC +R  L    + +D   F I    + Y
Sbjct: 296 LITLPSGLAEVINSQIGAKKSWSGQ---WIVDCKTRDTLPDMTFTFDGYNFTI----TPY 348

Query: 364 SMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
                V G+C   I P           I+GD FL R Y ++D+    V +A A
Sbjct: 349 DYTLEVSGSCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVGLAAA 401

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 91/355 (25%), Positives = 144/355 (40%), Gaps = 59/355 (16%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y   +++G+PPQ  +V++DTGSS+LWV  A   CG         L C+ H  +D   SST
Sbjct: 96  YFTEITLGSPPQSFKVILDTGSSNLWVPSA--ECG--------SLACFLHTKYDHEASST 145

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           +K N ++F I+YG  +   G    D L +G   +    F             G       
Sbjct: 146 YKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEATSEPGLAFAFG------- 197

Query: 194 TTMSSQQFGYQYDNL------PMVLK--RNNVIKKTVYSMFINELNAKT--GSVLFGAVD 243
                   G  YD++      P V    +N ++   V++ ++ + +     G   FG +D
Sbjct: 198 --KFDGILGLAYDSISVNRIVPPVYNAIKNKLLDDPVFAFYLGDSDKSEDGGEASFGGID 255

Query: 244 HSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDS 303
             KY G +  +P+     RR+        V    IGL      ++  TL G    A +D+
Sbjct: 256 EEKYTGEITWLPV-----RRKAY----WEVKFEGIGLG-----EEYATLEGHG--AAIDT 299

Query: 304 GTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLS 361
           GT+L   P  +             W  +   Y VDC SR       + +F G+       
Sbjct: 300 GTSLIALPSGLAEILNAEIGAKKGWSGQ---YSVDCESRDSLPDLTL-NFNGYNFTITAY 355

Query: 362 DYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           DY++   V G+C     P           I+GD FL + Y ++D+    V +A+A
Sbjct: 356 DYTL--EVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVGLAKA 408

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 88/354 (24%), Positives = 148/354 (41%), Gaps = 56/354 (15%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++ IGTPPQ  +V++DTGSS+LWV      CG         L CY H  ++   SST
Sbjct: 99  YFADIKIGTPPQSFKVVLDTGSSNLWVPSK--ECG--------SLACYLHSKYNHDESST 148

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG-----IG 188
           +K N + F I+YG  +   G    D +++G   +    F             G     +G
Sbjct: 149 YKANGSAFAIQYGSGSL-EGYISQDVMEIGDLKITKQDFAEATSEPGISFAFGKFDGILG 207

Query: 189 LPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT---GSVLFGAVDHS 245
           L A +T   ++     Y+ +        ++ +  ++ ++ + +      G  +FG +D +
Sbjct: 208 L-AYDTIAVNRVVPPVYNAI-----NQGLLDEPKFAFYLGDASKSKDNGGEAVFGGIDET 261

Query: 246 KYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGT 305
           K++G +  +P+     RR+    V+L       GL  G +  +++        A +D+GT
Sbjct: 262 KFEGDITWLPV-----RRKAYWEVKLE------GLGLGEEYTELENH-----GAAIDTGT 305

Query: 306 TLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSR-RLHQTAYIYDFGGFQIRSPLSD 362
           +L   P  +             W  +   Y ++C+ R  L    + +D   F I    S 
Sbjct: 306 SLITLPSGLAEIINSEIGAKKGWTGQ---YTIECDKRASLPDMTFTFDGYNFTI----SP 358

Query: 363 YSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           Y     V G+C   I P           I+GD FL + Y V+DL    V +A A
Sbjct: 359 YDYTLEVSGSCISAITPMDFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLAPA 412

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 95/371 (25%), Positives = 156/371 (42%), Gaps = 71/371 (19%)

Query: 65  IEIDN--QQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLN--C 120
           I +DN     +YS  + +GTPPQ  +V+MDTGSS+LWV            PN N ++  C
Sbjct: 91  IALDNFVNNQYYS-EIGLGTPPQSFKVVMDTGSSNLWV------------PNKNCVSEAC 137

Query: 121 YEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXX 180
             H  FD  RSS++  N+++F + YG  +   G    D L +G   +    F        
Sbjct: 138 LNHARFDHDRSSSYAKNDSRFSVSYGKGS-MEGFVSYDTLKIGDLTIKNQGFAEATVEPG 196

Query: 181 XXXXLGIGLPAMETTMSSQQF----GYQYDNLPM--------VLKRNNVIKKTVYSMFIN 228
                G             QF    G  YD L +              ++ + V++ +++
Sbjct: 197 SAFVYG-------------QFDGILGLAYDGLAVNHIVPPFYEAVHQGLLDEPVFAFYLS 243

Query: 229 EL---NAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELH-VTLAAIGLHTGR 284
           +    ++  G V+FG  D +K+ G ++ +P++     R+    VEL+ +TL       G 
Sbjct: 244 DEKKGDSLAGEVVFGGYDETKFTGEISWLPVI-----RKAYWEVELNSITL-------GS 291

Query: 285 DEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQ 344
            + ++Q   G+     LD+GT+   FP +               ++   I  C+      
Sbjct: 292 QKFQLQNYGGA-----LDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPCSGSGFPD 346

Query: 345 TAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMP----HSSDYVILGDVFLTRAYVVFD 400
             +      F I S  SDY +  +   TC   I P     +   VI+GDVFL R Y ++D
Sbjct: 347 LTFELAGRSFTISS--SDYVVQWD-DTTCAVAITPLDLGGAGKMVIIGDVFLRRWYSIYD 403

Query: 401 LEALEVSMAQA 411
           L    V +A++
Sbjct: 404 LSKNAVGLAKS 414

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/358 (25%), Positives = 145/358 (40%), Gaps = 65/358 (18%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y   +S+GTPPQ  +V++DTGSS+LWV      C        + L C+ H  +D   SS+
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWV--PSTEC--------SSLACFLHSKYDHDSSSS 154

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG-----IG 188
           +K N T+F IRYG  +   G    D L+LG  ++    F             G     +G
Sbjct: 155 YKPNGTEFAIRYGSGS-LEGYISQDTLNLGDLSITKQDFAEATSEPGLQFAFGKFDGILG 213

Query: 189 LPAMETTMSSQQFGYQYDNLPMVLK------RNNVIKKTVYSMFI--NELNAKTGSVLFG 240
           L            GY   ++  V+       +  ++ +  ++ ++  +  +   G   FG
Sbjct: 214 L------------GYDTISVDGVVPPFYNAWKQGLLDEPKFAFYLGRDGESQDGGVATFG 261

Query: 241 AVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
            VD SKY+G +  +P+     RR+        V    IGL  G +  +++        A 
Sbjct: 262 GVDDSKYEGEITWLPI-----RRKAY----WEVKFDGIGL--GEEYAELENH-----GAA 305

Query: 301 LDSGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS 358
           +D+GT+L   P  +             W  +   Y V+C +R        +  GG     
Sbjct: 306 IDTGTSLIALPSGLAEIINAEIGAKKSWTGQ---YTVECEARSSLPNM-TFTLGGHNFE- 360

Query: 359 PLSDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
            L+ Y  +  V G C   I P           I+GD FL + Y ++DL    V +A A
Sbjct: 361 -LTAYDYILEVSGQCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGLADA 417

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 147/356 (41%), Gaps = 57/356 (16%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++S+GTP Q  +V++DTGSS+LWV    V CG         L C+ H  +D S SS+
Sbjct: 91  YYTDISLGTPAQNFKVILDTGSSNLWV--PSVDCG--------SLACFLHSKYDHSASSS 140

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLG-----IG 188
           +K N T F I+YG  +   G    D L +G   +    F             G     +G
Sbjct: 141 YKPNGTDFAIQYGSGS-LEGYISQDTLSVGDLVIPKQDFAEATSEPGLAFAFGKFDGILG 199

Query: 189 LPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAKT------GSVLFGAV 242
           L A  T    +     Y+ +       +++ +  ++ ++ + +         G   FG +
Sbjct: 200 L-AYNTISVDKVVPPFYNAI-----DQDLLDEPRFAFYLGDSSDSEDSSVSGGVATFGGI 253

Query: 243 DHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLD 302
           D SK+KG ++ +P+     RR+        V    IGL      D+   L G    A +D
Sbjct: 254 DKSKFKGEISWLPV-----RRKAY----WEVKFEGIGLG-----DEFAILDGHG--AAID 297

Query: 303 SGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL 360
           +GT+L   P  +             W  +   Y VDC +R        ++F G       
Sbjct: 298 TGTSLITLPSGLAEIINSEIGAKKGWSGQ---YTVDCETRS-SLPDLTFNFSGKNYTIGP 353

Query: 361 SDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
            DY++   V G+C   I P           I+GD FL R Y V+DL    V +A+A
Sbjct: 354 YDYTL--EVSGSCISAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAKA 407

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 148/356 (41%), Gaps = 59/356 (16%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++S+GTP Q  +V++DTGSS+LWV      C          L CY H  +D   S+T
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWV--PSKDC--------TSLACYLHSKYDHDESTT 153

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           ++ N T+F I+YG  +   G    D L +G    D +              L       +
Sbjct: 154 YEKNGTKFTIQYGSGS-MDGYISRDTLIIGD---DLVIPEQDFAEATSEPGLAFAFGKFD 209

Query: 194 TTMSSQQFGYQYDNL---PMVLKRNNVIKKTV-----YSMFI---NELNAKTGSVLFGAV 242
             +     G  YD +    +V    N IK+ +     ++ ++   N+ N   G   FG  
Sbjct: 210 GIL-----GLAYDTIAVNKVVPPFYNAIKQGILDENKFAFYLGDTNKDNKSGGEATFGGY 264

Query: 243 DHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLD 302
           D SK+ G +  +P+     RR+        V   +I L      D+V +L G    A +D
Sbjct: 265 DKSKFTGDITWLPV-----RRK----AYWEVKFDSIALG-----DEVASLDG--YGAAID 308

Query: 303 SGTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL 360
           +GT+L   P  +             W  +   Y +DC++R        ++F G+      
Sbjct: 309 TGTSLITLPSGLAEVINTQIGAKKSWSGQ---YTIDCDTRDALPDM-TFNFNGYNFTVSP 364

Query: 361 SDYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
            DY++   + G+C   I P           I+GD FL + Y ++DL+   V +A++
Sbjct: 365 YDYTL--EMSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLAKS 418

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 90/345 (26%), Positives = 139/345 (40%), Gaps = 59/345 (17%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           Y  ++SIG+P Q  RV+MDTGSS+LWV    V C        N L C+ H  +D   SST
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWV--PSVDC--------NSLACFLHNKYDHRVSST 148

Query: 134 WKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAME 193
           +  N T+F IRYG S    G    D + +G   +    F             G       
Sbjct: 149 YVRNGTRFAIRYG-SGALEGYMSNDTVTVGDLQIPKQDFAEATSEPGLAFAFG------- 200

Query: 194 TTMSSQQFGYQYDNLPM---VLKRNNVIKKTV-----YSMFINE--LNAKTGSVLFGAVD 243
                  FG  +D + +   V    N + + +     ++ ++ +  L  + G V FG  D
Sbjct: 201 --KFDGIFGLAFDTISVNRAVPPFYNAVNRGLLDAPQFAFYLGDKRLRKEGGEVTFGGYD 258

Query: 244 HSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDS 303
            +++ G +  +P+     RR     V+ +      G+  G     +     +   A +D+
Sbjct: 259 ETRFTGNITWLPV-----RREAYWEVDFN------GISFGSQYAPL-----TATGAAIDT 302

Query: 304 GTTLTYFP--MQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLS 361
           GT+L   P  +             W  +   Y++DC SRR       ++ GG        
Sbjct: 303 GTSLITLPSGLAEILNAQIGARKNWSGQ---YVLDC-SRRSTLPDITFNLGGSNFSIGPY 358

Query: 362 DYSMMTNVRGTCRFGIMPHS-----SDYVILGDVFLTRAYVVFDL 401
           DY++     GTC   I+P           I+GD FL R Y V+DL
Sbjct: 359 DYTL--EASGTCISAIVPMDFPEPVGPLAIIGDAFLRRWYSVYDL 401

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 85/351 (24%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 74  YSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSST 133
           YSV++++GTP Q  RV +DTGSS LW+     RC        +Q+ C     + +  SST
Sbjct: 83  YSVDITLGTPAQNFRVALDTGSSLLWI--PSDRC-------TSQI-CRTRNRYRSGASST 132

Query: 134 WKDNNTQFHIRY--GDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXX------XL 185
           +K  +    ++Y  GD   A      D L    A ++   F                  +
Sbjct: 133 FKATDKTLRLQYVKGD---AKARVSYDTLYFAGAKIENQGFGEAEAIGDDFSGARFDGII 189

Query: 186 GIGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINEL---NAKTGSVLFGAV 242
           GIG P++         GY        L  +  +K  ++ ++I+     N+  G ++ G  
Sbjct: 190 GIGYPSI---------GYGIKPPINTLIDSGGLKDPMFGIYISNAQNRNSPVGEIVLGGY 240

Query: 243 DHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLD 302
           +  K+KG +  +P++   +             L+A     G     VQ L      A+ D
Sbjct: 241 NTQKFKGDIKWLPVLRKAF---------WETDLSA--FKVGNFALDVQGL-----TAVFD 284

Query: 303 SGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSD 362
           +G++    P               H +   Y VDC++        + DFGG  ++    D
Sbjct: 285 TGSSFIIMPEDTYTDFVSQFPGASHDDGTDY-VDCSTVNSGPDLTL-DFGGVALKLSARD 342

Query: 363 YSMMTNVRGTCRFGIMPHS--SDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           Y M    R TC   +  +S  +  VILGD FL R Y +++     + +A A
Sbjct: 343 YVMQLG-RNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVASA 392

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 96/423 (22%), Positives = 155/423 (36%), Gaps = 73/423 (17%)

Query: 44  SEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103
           S+  SG A  P LA +            M Y V    GTP QE  + +D      WV+  
Sbjct: 22  SDQKSGAAMFPTLAVKK--------TISMTYVVQAMFGTPGQEEFLKLDIIQPYTWVISG 73

Query: 104 GVRCGPNNYPNPNQLN--CYEHGSFDTSRSSTWKDN----NTQFHIRYGDSTYAHGTWGT 157
            +      Y   N++N  C     + +  S+++K+     N  +++ + D T  +G+ G 
Sbjct: 74  DI------YEQCNRVNSGCTHGNLYYSGESTSFKNQSGSLNAAYNMSFIDYTEFYGSAGI 127

Query: 158 DRLDLGQANVDG----------------------LTFXXXXXXXXXXXXLGIGLPAMETT 195
           D  +       G                       +F            LG+G   +  T
Sbjct: 128 DIANFTSVESSGTEGDPTNTQVQWFGKHTLSIPEFSFFRAEHSNIVDGSLGLGARILSGT 187

Query: 196 MSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFI----NELNAK------TGSVLFGAVDHS 245
                          +LK  N IK T YS+++    + LNA        G++L GAVD +
Sbjct: 188 AEDSSGFDSSFFFLDMLKNANFIKSTSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPN 247

Query: 246 KYKGTL---NTVPLVNANYRRRVNK-PVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALL 301
            + G       +P  ++      N  P+   V L  + +   +      T  G   P LL
Sbjct: 248 YFIGNFYRFKMLPFRDSKTETTFNSLPI---VPLTKVDIVNAKGTAVNVTQPGFMEPVLL 304

Query: 302 DSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLS 361
           D   T++Y P++            +      ++VDC+          + FG  +I  PLS
Sbjct: 305 DPRYTISYLPIELILQIAMQTNAVYVKSLDLWLVDCDVANFDAKIR-FQFGDLKIDVPLS 363

Query: 362 DY------------SMMTNVRGTCRFGIMP-HSSDYVILGDVFLTRAYVVFDLEALEVSM 408
            +            + +     TC+  + P +SS + ILG  FL   Y+  DLE   V+M
Sbjct: 364 HFVSSGYVGSPIASTQLGASNMTCQLNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAM 423

Query: 409 AQA 411
           AQA
Sbjct: 424 AQA 426

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 120 CYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXX 179
           C   G+F    SST+K N+TQF   YGD TY  GT+GTD + LG   ++  +F       
Sbjct: 30  CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTE 89

Query: 180 XXXXXLGIGLPAMETTMS----SQQFGYQYDNLP 209
                LGI LPA E T S         ++Y+N P
Sbjct: 90  NQGGILGISLPAGENTHSLGGAYNTTPFEYENFP 123

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 83/189 (43%), Gaps = 45/189 (23%)

Query: 56  LAKRNDWVDIEIDNQQMF-----YSVNLSIGTPPQEVRVLMDTGSSDLWVVGA-GVRCGP 109
           ++KR++  +  I N  MF     Y V + IGTPPQ   + +DTGSSD+ V  A    C  
Sbjct: 73  ISKRSEAFNSTIIN--MFASAGIYVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKS 130

Query: 110 ---------NNY------------PNPNQ---LNCYEHGSFDTSRSSTWKDNNTQFHIRY 145
                    +NY            P P+     +C   G+F+ + SST+K N T F + Y
Sbjct: 131 LADDNNIWTSNYELTATATETLSTPLPSVHHITSCSYWGTFNPNISSTFKYNETIFDLTY 190

Query: 146 GDSTYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETT------MSSQ 199
                  GT+GTD + LG   +   TF            LGI LP+ E T      +SS 
Sbjct: 191 -------GTYGTDVVSLGNITLSNYTFGVSNDTTMSYGILGISLPSEEITDRGQDALSSN 243

Query: 200 QFGYQYDNL 208
           +  + YDN 
Sbjct: 244 KTPFAYDNF 252

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 93/432 (21%), Positives = 161/432 (37%), Gaps = 75/432 (17%)

Query: 39  RGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDL 98
           RG S S + +   + P L    D   +        Y VN S GTP Q  ++ +D     +
Sbjct: 15  RGASQSSSENSIDSFPVLTANRDRAGL--------YYVNASFGTPGQSQKLRIDLVQPYM 66

Query: 99  WVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQ--FHIRYGDSTYAHGTWG 156
           WV    +R    N     +   Y    ++ S+SST +  N    + + + D    +GT  
Sbjct: 67  WVFSEDMRQARQNRSARAKAETY----YNASKSSTHEKLNGDKIWSMHFMDHIAFNGTTV 122

Query: 157 TDRL----------------------DLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMET 194
            D +                      D   AN   ++               I   A+  
Sbjct: 123 MDEVSFMWSSTSSSSDVATGDSNTTQDFSSANTSRISDKSFSFLSANEVAAYIQQGALGL 182

Query: 195 TMSSQQFGYQYDNLP-----MVLKR---NNVIKKTVYSMFIN----------ELNAKTGS 236
              + Q GY  D+       ++L R    ++I  + +SM++           E +   G 
Sbjct: 183 AGRAAQTGYDNDSSDFDSSYVLLDRLVDESLIYTSSFSMWMGADTRDPLESPEPSNGCGK 242

Query: 237 VLFGAVDHSKYKG---TLNTVPLVNANY-RRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
           V+FGAVD S Y G     +T+P  NA         P+   + L  + + +   E K  T 
Sbjct: 243 VIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGYPI---IPLTKVNVQSKSGETKNMTS 299

Query: 293 LGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFG 352
                P L+DS     Y P++            +      +++ C+  RL   + I++FG
Sbjct: 300 DSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLACDVGRLG-ASIIFEFG 358

Query: 353 GFQIRSPLSDYS------------MMTNVRGTCRFGIMPHS-SDYVILGDVFLTRAYVVF 399
              I  PL++                +N +  C   ++P + S + +LG  F+   Y+  
Sbjct: 359 NLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGGAFIKNVYMAA 418

Query: 400 DLEALEVSMAQA 411
           +LE+ +V++AQA
Sbjct: 419 ELESNQVALAQA 430

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 93/437 (21%), Positives = 157/437 (35%), Gaps = 79/437 (18%)

Query: 43  FSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG 102
           F        A   + K    ++I      ++Y +N+++GTP Q+  +++DT     W++ 
Sbjct: 15  FRRTLCATTATSSIEKPFPTINIGTTGSGIYY-INITMGTPEQQQELMIDTSQPYTWLLS 73

Query: 103 AG--VRCGPNNYPNPNQLN--CYEHGSF--DTSRSSTWKDNNTQFHIRYGD--------- 147
               ++C        N+LN  C     +    S S+   + N  +H+ + D         
Sbjct: 74  GSQDLQC--------NRLNSGCLSGSLYYVKESTSAICINPNRTYHMAFIDQSEINGTHV 125

Query: 148 ------------STYAHGTWGTDRLD---------LGQANVDGLTFXXXXXXXXXXXXLG 186
                       + YAH T+ T             LG +NV  +              L 
Sbjct: 126 IDMMNFTNVDVNTAYAHSTYNTKNNKGLINLGTNYLGVSNVSFINADDTVPYAMGSLGLS 185

Query: 187 IGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFI------------NELNAKT 234
             +    T + S  F   YD L   L + N+I    YS+++            N + +  
Sbjct: 186 GKITGTGTDIDSSNFDNSYDFLDR-LYQTNLIDSHSYSLWLAMNQTYNGTRVQNSVTSSF 244

Query: 235 GSVLFGAVDHSKYKGTLNTVPLVNA----NYRRRVNKPVELHVTLAAIGLHTGRDEDKVQ 290
           G ++ GAVD + + G+     ++ A    +    +  P+   + +  I + +   E    
Sbjct: 245 GKLILGAVDPTLFTGSFLQFEMLPALESDSATETIGYPI---IPMGPIYVVSKSGEMANV 301

Query: 291 TLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYD 350
           T      P  LDS  T TY P+             +      ++V CN    H T   + 
Sbjct: 302 TSKDFLEPVFLDSTYTSTYLPLNMIIQVAIQIGAMYVESLERWLVPCNIANQHATL-DFT 360

Query: 351 FGGFQIRSPLSD-----YSMMTNVR-------GTCRFGIMPHS-SDYVILGDVFLTRAYV 397
           F    IR PL+D     Y   TN           C   I  +  + Y ILG  FL   Y+
Sbjct: 361 FQDVSIRVPLTDLLGTTYDSSTNTSMHFSTGDEACYLKIFSNQMTGYNILGRPFLKHVYM 420

Query: 398 VFDLEALEVSMAQANYE 414
             DL+   +++AQA  E
Sbjct: 421 AVDLDGNNIAIAQATQE 437

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 89/200 (44%), Gaps = 26/200 (13%)

Query: 218 IKKTVYSMFI--NELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTL 275
           +K  ++ +F+  N  +   G ++FG  D +K+ G+L  +P+    +       VE +   
Sbjct: 88  LKDPMFGIFLPKNLAHINEGEIIFGGYDSTKFAGSLEWLPITKKGFWE-----VEFN--- 139

Query: 276 AAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIV 335
               + TG       T+ G  + A+LD+G++LT  P +              S+  G  V
Sbjct: 140 ---SISTGES-----TVQGEGLGAILDTGSSLTLLPTEIFDKFNGALEAALGSK-TGGRV 190

Query: 336 DCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSS----DYVILGDVF 391
            C++R       +++ GG +     ++Y M       C   I P +S    + VILG  F
Sbjct: 191 SCSARE-TAPEIVFELGGKKFAITGNEYIMPAGSE--CMVTIRPQASGAQSNVVILGTPF 247

Query: 392 LTRAYVVFDLEALEVSMAQA 411
           L + Y V+DL +  V +A+A
Sbjct: 248 LRKFYSVYDLGSDRVGLAEA 267

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 91/415 (21%), Positives = 162/415 (39%), Gaps = 75/415 (18%)

Query: 73  FYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLN--CYEHGSFDTSR 130
            Y VN + GTP QE R+ +D     +W+V   +      YP  N+L   C  +GS     
Sbjct: 36  LYYVNSTFGTPGQEQRLRIDLSQPYIWLVSGEI------YPQCNKLGSGCL-NGSLYYPL 88

Query: 131 SSTWKD--NNTQFHIRYGDSTYAHGTWGTDRLDLGQAN---------------------- 166
            ST  +  ++    +++ D    +GT   D ++  Q +                      
Sbjct: 89  QSTTSNLVDDDYIRLQFLDLISINGTKYRDNMNFTQLSTLKNGTSLNDSNVLWNETQGWL 148

Query: 167 -VDGLTFXXXXXXXXXXX-XLG----IGLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKK 220
            ++  +F             LG    I +PA ++ +SS  F   Y  L   LK   VI+ 
Sbjct: 149 TINSTSFILANETGSLVHGALGLSGPISVPASDS-VSSLNFDDSYYFLTH-LKNAGVIET 206

Query: 221 TVYSMFIN---------ELN-AKTGSVLFGAVDHSKYKGTL---NTVPLVN-ANYRRRVN 266
           + YS+++N         ++N A  G++L G+VD   Y G L    ++P  + ++      
Sbjct: 207 SSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKDESSGYLSTG 266

Query: 267 KPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXW 326
            P+   V ++ + +     E    T      P  + S    +Y P+             +
Sbjct: 267 YPI---VPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSIQTNAVY 323

Query: 327 HSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSD-----YSM-------MTNVRGTCR 374
                 ++V C+   +     I++FG   I  P  D     Y+M        TN +  C 
Sbjct: 324 VESLDRWLVACDIGDMGSN-LIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEACY 382

Query: 375 FGIMP-HSSDYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVP 428
             + P +++ + +LG  F+  AY+V D++   +++AQA      E +E  A   P
Sbjct: 383 LKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQA---ASDEAVEKAANNSP 434

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 91/427 (21%), Positives = 164/427 (38%), Gaps = 80/427 (18%)

Query: 65  IEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG--VRCGPNNYPNPNQLNCYE 122
           I  D   ++Y+ N+S+G+P Q  ++ +D      WV+     ++C      N     C+E
Sbjct: 40  IYCDKDGVYYA-NVSLGSPAQPHKMRIDISKPYSWVISGAQDIQC------NKLHSGCFE 92

Query: 123 HGSF--DTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDG----------- 169
           +  F  + S S     N+ ++++ + D+   +GT   D ++    ++ G           
Sbjct: 93  NDVFYPNESISGVSLSNSYEYNMNFIDNVRVNGTLFMDTMNFTDTSMLGNLSNTVQNNSM 152

Query: 170 ------------LTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFGYQYDNLPMVLKRN-N 216
                       ++F            LG+G     +        +Q     +    N N
Sbjct: 153 LTMTSDYLALRNISFVTTSSSTTDLGSLGLGGSIHSSVFDIDSENFQDTFFLLKTMANLN 212

Query: 217 VIKKTVYSMFINEL---------NAKTGSV----LFGAVDHSKYKG---TLNTVPLVNAN 260
           +IK   YS+++            +A  GSV    + GAVD S Y+G     NT+  +  +
Sbjct: 213 LIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTISYIEPS 272

Query: 261 YR-RRVNKPV----ELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXX 315
           +       P+     +++T  A        E  +Q       PALLDS    ++ P    
Sbjct: 273 HNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQ-------PALLDSSFVGSFLPANTI 325

Query: 316 XXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI-YDFGGFQIRSPLSDY----------S 364
                     +      ++V C+   +   A+I + F G  I+ PLSD           S
Sbjct: 326 IQIAIQIGAIYIESLNRWVVPCSVASMG--AHIDFTFDGLDIKVPLSDLLTSSKDPATNS 383

Query: 365 MMTNVRGTCRFGIMPHSSD---YVILGDVFLTRAYVVFDLEALEVSMAQA-NYEGGKEQI 420
            M    G     +M +S++   + +LG  F+  AY+  DL+  +V++AQA N  G    I
Sbjct: 384 TMHFAEGESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAKNTTGDSTSI 443

Query: 421 EVIAGAV 427
             +  A+
Sbjct: 444 VTVIPAL 450

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 92/432 (21%), Positives = 159/432 (36%), Gaps = 88/432 (20%)

Query: 69  NQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCG---PNNYPNPNQLNCYEHGS 125
           N Q  Y VN S+G P QE  +++DT    LWV+   V       NN  N N L  Y    
Sbjct: 69  NLQGRYYVNASVGEPQQEQSLVLDTTEPYLWVISGNVEMNCTDTNNVCNANSLYYY---- 124

Query: 126 FDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLD-------------LGQAN------ 166
            + S S+   D N  + + + +     G+   D ++             L Q+N      
Sbjct: 125 -NESSSAVAIDENADYQMDFLNYVSFAGSSYMDTINFTDISIKNNYTNTLLQSNLSAYVN 183

Query: 167 -------VDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFGYQYDNLPMVL---KRNN 216
                  V  ++F            + +GL    T+ +  +    YD+   +    K  N
Sbjct: 184 LTNDHLWVKNVSFLDSTTATSLYSGV-LGLGGSITSSNEYENSGNYDSSYFIFNKFKEAN 242

Query: 217 VIKKTVYSMFINELNAKT-------------GSVLFGAVDHSKYKGTL---NTVPLVNAN 260
           + +   YS+++ E  +               G +L G +D + Y+G+L   + +P V+  
Sbjct: 243 ITQSNSYSLWLVEDESSLTTTSTKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIPYVD-- 300

Query: 261 YRRRVNKPVELHVT----LAAIGLHTGRDEDKVQTLLGSK---VPALLDSGTTLTYFPMQ 313
                  P  L  +    +  +G+   + E   +  + SK    P LLDS     Y P  
Sbjct: 301 -------PESLVSSQGYPILPMGVIYVKSESGARLNVTSKDFLEPVLLDSSQQGNYLPEN 353

Query: 314 XXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGT- 372
                       +      ++V C+    +  + ++ F G +I  PL +  ++TN   T 
Sbjct: 354 AIIQIAIQIGATYIESMDRWLVSCDMAS-YGASVLFTFDGLEIDVPLEN--LLTNTFETG 410

Query: 373 -------------CRFGIMPHSS-DYVILGDVFLTRAYVVFDLEALEVSMAQANYEGGKE 418
                        C   I  +++  Y +LG  F    Y+  DLE   V++AQA      +
Sbjct: 411 SNSSIYYSDGETACALTIYDNANMGYNLLGSAFFRNTYIAVDLEGNTVAIAQAKPSDEDD 470

Query: 419 QIEVIAGAVPRA 430
              + A  +P A
Sbjct: 471 SSNLSATTLPAA 482

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 98/240 (40%), Gaps = 33/240 (13%)

Query: 212 LKRNNVIKKTVYSMFINELNA----------KTGSVLFGAVDHSKYKG---TLNTVPLVN 258
           LK   +I  + YS+++               + G ++FGAVD +  +G     + +P ++
Sbjct: 204 LKEARLINSSSYSLWLGSQKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYIH 263

Query: 259 ANYRRRV-NKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
               +     PV   V +  I + +        T  G   P LLD    L+Y P +    
Sbjct: 264 PQTGKVAYGYPV---VPMGPIYITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQ 320

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGT----- 372
                   +      ++V C+      T   + FG   I+ PLSD    T+ + T     
Sbjct: 321 IAIQIAAVYVESLDLWLVSCDVASSGATV-DFSFGDLTIKVPLSDLLASTHDQSTNTTLH 379

Query: 373 -------CRFGIMPHS-SDYVILGDVFLTRAYVVFDLEALEVSMAQ-ANYEGGKEQIEVI 423
                  C   + P++ + Y +LG  F+  AY+  DLE   V+M Q AN++ G E+ E+I
Sbjct: 380 FNTGQEACVLQLYPNTFTGYNVLGQAFMKNAYLAVDLEGKGVAMGQAANFKSG-ERKEII 438

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 88/408 (21%), Positives = 154/408 (37%), Gaps = 72/408 (17%)

Query: 68  DNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFD 127
           D++ ++Y VN+SIG P QE  V +D     +W+      C  ++        C    SF+
Sbjct: 47  DSKALYY-VNISIGIPSQEENVRVDIAQPYIWLPAKNSTCETSS--------CVVTSSFN 97

Query: 128 --TSRSSTWKDNNTQFHIRYGDSTYAHGTWGTD-----------RLDLGQANVDGLTFXX 174
             TS SS    +   F + + DS   +GT+  D           +L+    + DGL    
Sbjct: 98  NQTSNSSVLLQDGQIFSLDFIDSISLNGTFYKDDLTCSNLVQPLKLNESLKSPDGLYTTN 157

Query: 175 XXXXXXXXXXLG--------------IGLPAMETT-MSSQQFGYQYDNLPMV--LKRNNV 217
                     L               +GL +  T+ +S     +  D+   +  L  + V
Sbjct: 158 TTDDSITLVALSFINAIDYQGLTIGSLGLASSTTSDLSGASLDFVDDSFSFLTYLSNSEV 217

Query: 218 IKKTVYSMFI----------NELNAKT----GSVLFGAVDHSKYKGTL---NTVPLVNAN 260
           I    YS+++            +N+ T    G+++ GAVD   Y+G L   + +P +  N
Sbjct: 218 IDTPSYSLWLGGDTLPYTNMTSINSTTIDYCGNLVLGAVDQRYYEGRLVQFDMLPALLNN 277

Query: 261 YRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXX 320
               V   + + + +  I +          T      P LLDS  T    P+        
Sbjct: 278 VTEAVTYGLPI-IPMGPIYIENSSGTQLNLTTTNFLEPVLLDSRYTNARLPLNTVIQIAT 336

Query: 321 XXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDY--SMMTNVRG------- 371
                +  E   +IV+C+   ++     ++F G  I   L+D+   ++ +  G       
Sbjct: 337 QLNAAYVEEFGSWIVECSLAEMNVNLN-FNFQGLTIPVSLNDFLSRVINSTTGEPIKFSE 395

Query: 372 ----TCRFGIMPHSS-DYVILGDVFLTRAYVVFDLEALEVSMAQANYE 414
                C   + P++   + ILG  FL   Y+  D E   V++A+A  E
Sbjct: 396 SSEDACALAVYPNTDIGFNILGGPFLKNIYLAIDNEGRSVAIAKAVKE 443

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/382 (21%), Positives = 141/382 (36%), Gaps = 53/382 (13%)

Query: 73  FYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLN---CYEHGSFDTS 129
            Y  N+S G P  E  + +D G    W++       PN+      LN    YE    D+ 
Sbjct: 53  LYYANVSFGDPADEQLLRVDIGQPYTWLISK-----PNDSDTAVYLNNGYIYEFSFMDSI 107

Query: 130 RS--STWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLT------FXXXXXXXXX 181
               S   D+     I + + +   GT+  D         D ++      F         
Sbjct: 108 EVNVSATMDSMNFTGIHFTNISDVSGTYSIDSSSTAIIGSDYMSISNISFFETNYASFYT 167

Query: 182 XXXLGIG--LPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINE---------- 229
              LG+G  +      + S++F   +  L  ++    +IK   YS++             
Sbjct: 168 AGSLGLGGRISDGSAAIDSEKFDSSFFFLDRLMNLG-IIKTPSYSLWFGADTVPYDRRKL 226

Query: 230 ---LNAKTGSVLFGAVDHSKYKGTLNT---VPLVNANYRRRVNK-PVELHVTLAAIGLHT 282
                A  G ++ GAVD S Y G L +   +P ++   + + N  P+   + L  I +++
Sbjct: 227 ASGTMADCGKLILGAVDPSLYTGILRSFKMIPFIDPVSQAQSNNYPI---LPLGTIYINS 283

Query: 283 GRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRL 342
              +    T      P LLDS  + TY P+             +      ++V C+  +L
Sbjct: 284 ANGKSLNMTSEEFVEPVLLDSRYSTTYLPIDAIVQIAVQIGATFVESLDKWLVACSVAKL 343

Query: 343 HQTAYIYDFGGFQIRSPLSDYSMMT------------NVRGTCRFGIMPH-SSDYVILGD 389
              +  + FG  +IR PL D+ + T                 C   ++    + Y +LG 
Sbjct: 344 -DVSLDFTFGNIEIRVPLEDFLVTTYDPKSNTSLHFSTGEEACFLAMVSKDKTGYNVLGG 402

Query: 390 VFLTRAYVVFDLEALEVSMAQA 411
            FL   Y+  D+E   +++AQA
Sbjct: 403 PFLKNLYMAVDIEDSSIAIAQA 424

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 101/441 (22%), Positives = 163/441 (36%), Gaps = 78/441 (17%)

Query: 28  AQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEV 87
           A FVR D         S       + P +A       +  D+  ++Y VN SIGTP Q  
Sbjct: 11  AAFVRADL--------SSTADDHTSFPTMA-------VNKDDTGLYY-VNASIGTPGQVQ 54

Query: 88  RVLMDTGSSDLWVVG---AGVRCGPNNYPNPNQLNCYEHGSFDTSRS-STWKDNNTQF-- 141
            + +D     LWV+     G+R       +      Y+H    TS+  +  K  N +F  
Sbjct: 55  MLRIDVAQPYLWVLSQDMQGIRLEEEGEVDNETF--YDHTKSSTSKVLNNSKIRNMEFID 112

Query: 142 HIRYGDSTYAH-----GTWGTDRLDLGQAN-------------VDGLTFXXXXXXXXXXX 183
           HI +  +T+        + GT  L+    N             +   +F           
Sbjct: 113 HISFNATTFMDSIELPSSLGTYDLEYDDQNLTVSRISNSSSLSIHNFSFFNAEYAAAYLQ 172

Query: 184 XLGIGLPAMETTMSSQQFGYQYDNLPMV--LKRNNVIKKTVYSM-----------FINEL 230
              +GL    T  S        D+   +  L +NN I  + YS+           + + L
Sbjct: 173 QGALGLGGKITQASDSDSSNYDDSFFFLDQLVQNNYINTSSYSLWFGGDVIESYAYSSAL 232

Query: 231 NA----KTGSVLFGAVDHSKYKGTL---NTVPLVNANYRRRVNKPVELHVTLAAIGLHTG 283
           ++      G ++FG VD S Y G L   +T+P  N   R  V       V L  + + + 
Sbjct: 233 DSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNV--RTGVTSRGYPIVPLVKVDVKSK 290

Query: 284 RDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLH 343
             + K  T      P LLD+     Y P+             +      +++ C+  +L 
Sbjct: 291 SGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESLNRWLLACDVGKLG 350

Query: 344 QTAYIYDFGGFQIRSPLSD-----YSMMT-------NVRGTCRFGIMPHSS-DYVILGDV 390
            +  ++DFG   I  PLSD     Y   T       N    C    +P+S   + ILG  
Sbjct: 351 ASI-LFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLPNSDLGFSILGGP 409

Query: 391 FLTRAYVVFDLEALEVSMAQA 411
           F+   Y+  +L++ +V++AQA
Sbjct: 410 FIKNVYLAAELQSNQVALAQA 430

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 210 MVLKRNNVIKKTV-YSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNA 259
           M  +R   I+K + YS+F+N  N   GS+LFGAVD SKY   L T P+  A
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQA 51

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 83/394 (21%), Positives = 141/394 (35%), Gaps = 76/394 (19%)

Query: 73  FYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLN--CYEHGSFDTSR 130
            Y VN ++GTP QE  + +D     LWV+        + Y   N+L+  C   GS    R
Sbjct: 45  LYYVNTTLGTPGQEQMLRVDISQPYLWVLSG------SEYAQCNRLDSGCLT-GSLYYVR 97

Query: 131 SSTWKDNNTQ---FHIRYGDSTYAHGT------------------------------WGT 157
            ST   N T+   + +++ D    +GT                              W  
Sbjct: 98  QSTTAMNLTRDRVYDMQFMDYISINGTAVMDTLNLTSVIDNSLGKNILENLTNSTVHWDL 157

Query: 158 DRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAMETTMSSQQFGYQYDNLPMVLKRNNV 217
           D   L   NV  +              LG  + A    ++S  F   +  L   L  NNV
Sbjct: 158 DSDTLSMTNVSFINVDYSGSITQGALGLGGRITAPGEDINSDGFDGSFFFLEQ-LVANNV 216

Query: 218 IKKTVYSMFINE------------LNAKTGSVLFGAVDHSKYKGTL---NTVPLVNANY- 261
           I  + YS+++ +                 G ++ GAVD S Y G     +T+P  + +  
Sbjct: 217 IDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFVRFDTIPFHDVDTG 276

Query: 262 RRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXX 321
                 P+   V L  + +     +    T      P LLD+    ++ P++        
Sbjct: 277 ATSFGYPI---VPLTKVSVKASSGQTLNVTSPDFAEPVLLDTRYLYSFLPLKLIIQIAIQ 333

Query: 322 XXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSM------------MTNV 369
               +      ++V C+   L+  + I++F G  I  P+ D+               +N 
Sbjct: 334 TNAYYVESLDRWLVSCSVGDLNA-SMIFEFNGLSIDVPIKDFLSNSYDSVSNSTLHFSNG 392

Query: 370 RGTCRFGIMP-HSSDYVILGDVFLTRAYVVFDLE 402
              C   + P +++ + +LG  F+  AY+  DLE
Sbjct: 393 NSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 83/397 (20%), Positives = 149/397 (37%), Gaps = 68/397 (17%)

Query: 73  FYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSS 132
            Y +N ++G P Q  R+ +D     LW+   G +C P++    N+   Y+  S +TS   
Sbjct: 51  MYFLNATLGNPEQFQRLRLDIAQPYLWIPNIGSKC-PDSSTTCNERTVYDPSSSNTSIP- 108

Query: 133 TWKDNNTQFHIRYGDSTYAHGTWGTDR-----------------------LDLGQANVDG 169
            ++  +  F   + D+ +A+G+  TDR                       +D G  N+  
Sbjct: 109 -YRSGHV-FDFEFIDALFANGSAYTDRFSFPNILGSTESYSYGNHSGLVEVDHGHLNISS 166

Query: 170 LTFXXXXXX-XXXXXXLGIGLPAMETTMSSQQFGYQYDN---LPMVLKRNNVIKKTVYSM 225
           ++F             LG+G   +E+  S    G QYD    L   LK   +I+   YS+
Sbjct: 167 MSFFSTYNSGGLSIGSLGLG-GNVESRNSDLDSG-QYDGSFFLLEELKEAGLIEGRGYSL 224

Query: 226 FINELNAK--------------TGSVLFGAVDHSKYKG---TLNTVPLVNANYRRRVNK- 267
           ++   N                 G ++ GAV+ +   G   + N +P  N +     N  
Sbjct: 225 WLGGDNTSLVEQEGTVYSSESIAGRLILGAVNPNLIDGKFVSFNMLPYQNPDTLEMSNGY 284

Query: 268 PVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWH 327
           P+   + +  I + +        T      P LLDS  T +  P++            + 
Sbjct: 285 PI---LPMGPINIISKSGASLNMTSNNYLQPVLLDSRYTNSRLPIEAIIQIAIQIDASYV 341

Query: 328 SEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDY------------SMMTNVRGTCRF 375
            +   ++V C+  +       + FG  +I+ PL  +              ++N    C  
Sbjct: 342 EQLNSWVVSCSILK-ESVVLEFSFGPLRIKVPLKQFLKKAIDPDTGNARTLSNGDQACIL 400

Query: 376 GIMP-HSSDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
            + P H   Y ILG  F+   Y+  D E   +++ Q+
Sbjct: 401 SLYPNHDIGYNILGAPFMKSIYLAVDNEGGTIALGQS 437

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%)

Query: 49  GRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGV 105
           G   V  + KRN+ ++  + N    Y V + IGTPPQ V + +DTGSSD+ V  A +
Sbjct: 42  GTQDVSTVFKRNEVLNTTVINGIGVYVVKMEIGTPPQTVYLQLDTGSSDMIVNNADI 98

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 83/199 (41%), Gaps = 20/199 (10%)

Query: 235 GSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELH---VTLAAIGLHTGRDEDKVQT 291
           G +L G VD S + GTL    L+   Y   V+  V      V L  I + +   +    T
Sbjct: 254 GKLLLGGVDPSLFTGTLGKFDLIP--YVDPVSNVVSTGYPIVPLGPIYIISNSGQSMNMT 311

Query: 292 LLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDF 351
                 PALLDS ++++Y P              +      ++V+C+   +  T   + F
Sbjct: 312 SKDFLSPALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVECSMADMGVTLG-FMF 370

Query: 352 GGFQIRSPLSD-----YSMMTNV-------RGTCRFGIMPHSSDYV-ILGDVFLTRAYVV 398
               I+ PLSD     Y   TN        +  C   +  +++  V ILG+ F+   Y+ 
Sbjct: 371 RSLTIKIPLSDLLSSTYDTTTNSSMFFSSGQEACFLTLYANTNTGVNILGEAFMKNIYMA 430

Query: 399 FDLEALEVSMAQA-NYEGG 416
            DLE   +++AQA N E G
Sbjct: 431 VDLEDNSIAIAQAKNIEDG 449

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 49  GRAAVPRLAKRNDWVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWV 100
           G   V  + KR+D ++  + N    Y V + IGTPPQ   + +DTGSSD++V
Sbjct: 42  GSQDVSNVFKRDDVLNSTLINAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYV 93

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/391 (19%), Positives = 143/391 (36%), Gaps = 59/391 (15%)

Query: 69  NQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQL--NCYEHGSF 126
           ++ +   V L +GTP Q  R+ +D     +W+V   +      YP  ++   NC     +
Sbjct: 39  DESLLPVVELRVGTPGQRERLRLDITQPYMWLVSGRL------YPECDRKKGNCLTGNLY 92

Query: 127 DTSRSSTWKDNNTQ-FHIRYGDSTYAHGTWGTDRLDLGQANV---DG------------- 169
               S T+   + + +++   D     G  G + ++  +++V   DG             
Sbjct: 93  FPKASETYHAGDGETYNLTMADGIQISGLLGYEEVNFNRSDVRVRDGNVHLAPREGVKVE 152

Query: 170 -LTFXXXXXXXXXXXXLGI-GLPAMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFI 227
            + F            LG+ G       +     G ++  L   ++   +I    YS++ 
Sbjct: 153 RMGFLEATTMTDIHAGLGLSGRVNNPDPLGDAARGSEFFFLDK-MRDAGLISSRSYSLWF 211

Query: 228 NELNAKT----------GSVLFGAVDHSKYKGTL---NTVPLVN--ANYRRRVNKPVELH 272
              N             G+++ GAVD   Y G     + VP V+  +    R   P+   
Sbjct: 212 GNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVDIASGQHTRGGYPIVPL 271

Query: 273 VTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVG 332
             +  +G   GR  +          P LL+S    ++ P              +      
Sbjct: 272 TRVQLLGTE-GRQLNLTDDTFAE--PVLLNSRFMTSFLPKSIVQQIARQTNAVFTKSSNR 328

Query: 333 YIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRG-----------TCRFGIMPHS 381
            IV+C+  +  + ++ + FG   +  PLSD+   TN+R            TC   +MP +
Sbjct: 329 LIVECSLLK-EEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPDTNETCYLKLMPST 387

Query: 382 S-DYVILGDVFLTRAYVVFDLEALEVSMAQA 411
              + +LG   L + Y+  D E+  V MA A
Sbjct: 388 GMGFSMLGMPILRKLYIAADTESGAVGMALA 418

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 96/235 (40%), Gaps = 45/235 (19%)

Query: 211 VLKRNNVIKKTVYSMFI----------NELNAKTGSVLFGAVDHSKYKGTLNTVPLVNAN 260
           +LK  ++I+ + YS+++           +  +  G +L G VD S + GTL    L+   
Sbjct: 219 LLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIP-- 276

Query: 261 YRRRVNKPVELH---VTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
           Y   V+  V +    V L  I + +   +    T      PALLDS ++++Y P      
Sbjct: 277 YVDPVSNAVSVGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTIIQ 336

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFG---GFQIRS-----PLSD-----YS 364
                   +      ++V C+         I D G   GF++R      PL D     Y 
Sbjct: 337 IAVQIAATYVESLDRWLVQCS---------IADMGVSLGFRLRELTIEIPLRDLLSSTYD 387

Query: 365 MMTNV-------RGTCRFGIMPHSSDYV-ILGDVFLTRAYVVFDLEALEVSMAQA 411
             TN        +  C   +  +++  V ILG+ F+   Y+  DLE   +++AQA
Sbjct: 388 TSTNSSMFFSSGQEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQA 442

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 97/244 (39%), Gaps = 30/244 (12%)

Query: 194 TTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFI--NELNAKT--------GSVLFGAVD 243
           T + S Q+  +Y     +LK  N I+   YS+++  +    KT        G +L G VD
Sbjct: 193 TDIDSSQYT-EYSYFLSLLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVD 251

Query: 244 HSKYKGTLNTVPLVNANYRRRVNKPVELH---VTLAAIGLHTGRDEDKVQTLLGSKVPAL 300
            S + GTL    L+   Y   V   + +    V L  I + +   E    T      PAL
Sbjct: 252 PSLFTGTLGQFDLIP--YADPVTNAITIGYPIVPLGPIYIVSNSGESLNMTSKDFLSPAL 309

Query: 301 LDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPL 360
           LDS ++++Y P              +      ++V C+   +  T   +      I  PL
Sbjct: 310 LDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVQCSMADMGVT-LAFRLRDLFIEIPL 368

Query: 361 SD-----YSMMTNV-------RGTCRFGIMPHSSDYV-ILGDVFLTRAYVVFDLEALEVS 407
            D     Y   TN        +  C   +  +++  + ILG+ F+   Y+  DLE   ++
Sbjct: 369 RDLLSSTYDTSTNSSMLFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIA 428

Query: 408 MAQA 411
           +AQA
Sbjct: 429 IAQA 432

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 83/410 (20%), Positives = 145/410 (35%), Gaps = 74/410 (18%)

Query: 63  VDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYE 122
           + +  DN  ++Y+ N+SIGTP Q+  +++D      WV             +P   N   
Sbjct: 166 ISLNRDNNSLYYT-NVSIGTPGQKQPLVIDIVEPYNWVTHNHFESH-----DPISSNSSG 219

Query: 123 HGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANV-------------DG 169
               + SR+S   D +  FH+ + D    + T   D++     ++             DG
Sbjct: 220 SYQSNLSRTSQQVDGSHVFHLDFVDLDDINATAMMDKISFESLSLKNQSSHTINNTQNDG 279

Query: 170 L--------------TFXXXXXXXXXXXXLGIG--LPAMETTMSSQQFGYQYDNLPMVLK 213
                          +F            LG+G  +    T + S QF   +  L   L+
Sbjct: 280 SGALYNSHSLTLSNSSFFEINDTTSSKGVLGLGGKINDKGTDIDSSQFDSSF-FLLESLR 338

Query: 214 RNNVIKKTVYSMFI---------------NELNAKTGSVLFGAVDHSKYKGTL----NTV 254
            N +I+   YS+++               +E+N   G ++ G VD   Y G L    N +
Sbjct: 339 DNGIIESLSYSLWLGGDTRPYYDVGRNVPDEINC--GKLILGGVDPYYYSGPLKKFNNLI 396

Query: 255 PLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQX 314
            L +         PV    T+  +           +  L    P LLDS  + ++ P + 
Sbjct: 397 FLDSRTDMLSRGYPVLPMRTINVVSATGNSINVTNENFL---TPVLLDSRYSFSHLPAET 453

Query: 315 XXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTN---VRG 371
                      +  E   ++V C    +      ++FG   I  P  D+ M T+      
Sbjct: 454 IVQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQ-FEFGDVSIDVPFKDFLMSTHNPETNS 512

Query: 372 TCRFG----------IMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQA 411
           T +F           +    + + ILG  FL   Y+  D +   +++AQA
Sbjct: 513 TMKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQA 562

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 74/348 (21%), Positives = 140/348 (40%), Gaps = 57/348 (16%)

Query: 89  VLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDS 148
           +++DTGS+  WV G       N          ++      + S++    ++ F I Y   
Sbjct: 110 LVLDTGSAISWVYGVNSSSSAN----------HKARQAFVAHSNSCTVTDSIFTIFYRSG 159

Query: 149 TYAHGTWGTDRLDLGQANVDGLTFXXXXXXXXXXXXLGIGLPAM-ETTMSSQQFGYQYD- 206
           T AHG   T  L +    +    F            + IG+P++ +    S  FG   D 
Sbjct: 160 T-AHGPLYTGTLSINGLKIQDFRFG-----------VAIGVPSLLDAYALSGIFGLPSDP 207

Query: 207 -----NLPMVLKRNNVIKKTVYSMFINELNAKT-------GSVLFGAVDHSKYKGTLNTV 254
                ++  +L+ + +I K  +S+ ++ + +++       G ++FG    + Y+G L+  
Sbjct: 208 TDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYT 267

Query: 255 PLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQX 314
           PLV       +      ++    + L T ++   +   +G +   ++D+G+TL   P + 
Sbjct: 268 PLVPNPQNHWLVAIKAAYIGSERVELPTAKNP-SIDKNIGIR-SGIIDTGSTLVVLPQED 325

Query: 315 XXXXXXXXXXXWHSEEVGYIVDCNSR--------RLHQTAYIYDFGG--FQIRSPLSDYS 364
                        S+   + + CNS         + + T    +F G  +   SP + Y 
Sbjct: 326 ALALHSYFDDSI-SDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGY- 383

Query: 365 MMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412
            ++N++G          S   ILG+VFL   Y VFD+E  +V  A  N
Sbjct: 384 CVSNIQGG-------DISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 95/383 (24%), Positives = 147/383 (38%), Gaps = 75/383 (19%)

Query: 65  IEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHG 124
           ++ D     Y V+++IG     +  ++DTGS+ LWV G             N  +C    
Sbjct: 89  LQSDEHSQAYFVDVTIGDVAYPL--IIDTGSAYLWVYGDSC----------NSSSCKGRK 136

Query: 125 SFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQ-ANVDGLTFXXXXXXXXXXX 183
            F T+       +   F + Y  S  A G    DR+ + + A  D  TF           
Sbjct: 137 LFPTTNV---LQDVASFSLAYT-SGVAVGDVYHDRIIVNELATTDNFTFGVASE------ 186

Query: 184 XLGIGLPAM-ETTMSSQQFGYQYDNLPMV------LKRNNVIKKTVYSMFINELNAKT-- 234
                +P + E   +S  FG   DN   +      L+ +N I    +S+ I  +NA+   
Sbjct: 187 -----VPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSE 241

Query: 235 ---GSV--------LFGAVDHSK--YKGTL---NTVPLVNANYRRRVNKPVELHVTLAAI 278
              G V        +F   D  +  YKG +   + +P  N+ +  ++N    L+V    +
Sbjct: 242 EEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINN---LYVNDYKV 298

Query: 279 GLHTGRDEDKVQTLLGSKV----PALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYI 334
                      +   GSK      +++DSGTTL   P Q              ++   + 
Sbjct: 299 NFT------NYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSI-TDGTNFA 351

Query: 335 VDCNSRRLHQTAYI-YDFGGFQIRSP--LSD-YSMMTNVRGTCRFGIMPHSSDYV-ILGD 389
           + CNS    QT  + +D   + I S   L D YS  +   G C   I     D   ILGD
Sbjct: 352 IMCNST---QTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGD 408

Query: 390 VFLTRAYVVFDLEALEVSMAQAN 412
           VFL   Y VFD+E   +  A+ N
Sbjct: 409 VFLEGIYAVFDVENQRLGFAEGN 431

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 91/232 (39%), Gaps = 39/232 (16%)

Query: 211 VLKRNNVIKKTVYSMFINELNA----------KTGSVLFGAVDHSKYKGTLNTVPLVNAN 260
           +LK  N+I+   YS+++    +            G +L G VD S + GTL    L+   
Sbjct: 219 LLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSLFTGTLGKFDLIP-- 276

Query: 261 YRRRVNKPVELH---VTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXX 317
           Y   V+  V      V L  I + +   +    T      PALLDS ++++Y P      
Sbjct: 277 YVDPVSSAVSTGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTNTIIQ 336

Query: 318 XXXXXXXXWHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRS-----PLSD-----YSMMT 367
                   +      ++V C+   +  +       GF +R      PL D     Y   T
Sbjct: 337 IAVQIAATYVESLDRWLVQCSMANMGVSL------GFTLRELVIEIPLRDLLSSTYDTST 390

Query: 368 NV-------RGTCRFGIMPHSSDYV-ILGDVFLTRAYVVFDLEALEVSMAQA 411
           N        +  C   +  +++  + ILG+ F+   Y+  DLE   +++AQA
Sbjct: 391 NSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 442

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 80/200 (40%), Gaps = 21/200 (10%)

Query: 229 ELNAKTGSVLFGAVDHSKYKGTLNTVPLV----NANYRRRVNKPVELHVTLAAIGLHTGR 284
           E  +  G ++FG VD S   GT  +  ++     ++       P+ L +    I  ++GR
Sbjct: 260 EKKSDYGLIVFGGVDSSLIDGTFQSFTMIPYEDTSDGLTTSGYPI-LPMGPIYIIANSGR 318

Query: 285 DEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQ 344
             +   T L    P LLDS  T +  P              +      ++V C S   + 
Sbjct: 319 TLN--LTTLDFLEPVLLDSRITNSRLPASFIIQVAIQLEAMYLESLDRWVVPC-SLADYN 375

Query: 345 TAYIYDFGGFQIRSPLSDYSMMTNVRG------------TCRFGIMPHSS-DYVILGDVF 391
             + + FG  +IR PL D+ + + + G             C   + P++   + ILG  F
Sbjct: 376 VNFDFSFGSVRIRVPLEDFLVPSGLTGDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPF 435

Query: 392 LTRAYVVFDLEALEVSMAQA 411
           L  A +  D  + ++++ +A
Sbjct: 436 LKNAVIAVDHSSSQIAIGKA 455

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 94/442 (21%), Positives = 165/442 (37%), Gaps = 92/442 (20%)

Query: 63  VDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG--VRCGPNNYPNPNQLN- 119
           +DI   N  ++Y VN++IG+PPQ+  + +DT    +WV+      +C        N+L+ 
Sbjct: 41  LDIGTINDGVYY-VNVTIGSPPQQEMLRIDTSQPFVWVLSGADDKQC--------NRLDS 91

Query: 120 -CYEHGSFDTSRSSTWKD--NNTQFHIRYGDSTYAHGTWGTDRLDLGQANV----DGLTF 172
            C     F    S+T +   N+T + + + D+   +G+   D L+    ++    D  TF
Sbjct: 92  GCLSGNRFYPEESTTGESATNSTIYSLNFLDTFRVNGSIVVDNLNFTNTDITAALDYTTF 151

Query: 173 XXXXXXXXXXX------------------------XLGIGLPAMETT--MSSQQFGYQYD 206
                                               LG+     ET     S  F   + 
Sbjct: 152 NSSKNNSIIDIGDDFLVIKNFGFINAEDSYPTDMGSLGLSSTFNETLNYSPSGNFNTSFS 211

Query: 207 NLPMVLKRNNVIKKTVYSMFI-------NELNAK--------TGSVLFGAVDHSKYKG-- 249
            L M L  + +I    YS+++        +L+++         G +L G+VD S +K   
Sbjct: 212 MLAM-LAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPF 270

Query: 250 -TLNTVPLVNANYR-RRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTL 307
              + +P V+ N +    + PV   + + AI + +        T      P LL+S    
Sbjct: 271 YQFDVLPYVDPNTQIESFSFPV---IPMNAIYIVSKTGTGTNVTSEDFLEPVLLNSNFRS 327

Query: 308 TYFPMQXXXXXXXXXXXXWHSEEVGYIVDCN--SRRLHQTAYIYDFGGFQIRSPLSDY-- 363
            Y P+             +      +++ C+  +  +H   + + F    I++PL D+  
Sbjct: 328 NYLPLNSIIQIAIQVGATYVESLDRWLLPCSIANENVH---FEFTFDKLNIKAPLIDFLE 384

Query: 364 ---------SM-MTNVRGTCRFGIMPHSSDYV---ILGDVFLTRAYVVFDLEALEVSMAQ 410
                    SM  ++    C   + P++  YV    LG  FL   Y+  + E   V MAQ
Sbjct: 385 STFDSTTNTSMHFSDNSEACFLKLYPNT--YVGFNALGRPFLKSVYLAVEQEGRIVGMAQ 442

Query: 411 ANYEGGKEQIEVIAGAVPRAVR 432
           A  E     +   A  VP   R
Sbjct: 443 AVQEMNSTFLN--ADVVPATTR 462

>KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly
           similar to uniprot|Q12303 Saccharomyces cerevisiae
           YLR121C YPS3 Aspartic protease
          Length = 515

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 95/432 (21%), Positives = 160/432 (37%), Gaps = 92/432 (21%)

Query: 27  AAQFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRNDWVDIEI-----------DNQQMFYS 75
           AAQFV ++          +A S +A   +   ++   ++E+           D+    Y 
Sbjct: 55  AAQFVNIN----------DALSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYF 104

Query: 76  VNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWK 135
           VN++IG   +   +++D+GS+ LWV G+            N+L       F T       
Sbjct: 105 VNVTIG--DEIYPLVVDSGSAYLWVYGSSCTSKSCT---SNKL-------FSTDNVKRAA 152

Query: 136 DNNTQFHIRYGDSTYAHGTWGTDRLDLGQ-ANVDGLTFXXXXXXXXXXXXLGI----GLP 190
           D +T F + Y   T A G    DR+ + + A     TF              +    GLP
Sbjct: 153 DEST-FSLIYSSGT-ASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLP 210

Query: 191 AMETTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNAK----------------- 233
           +  +           +++  VL  +N I    +S+ I  LN+K                 
Sbjct: 211 SNNSD--------NIESIISVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTEN 262

Query: 234 TGSVLFGAVDHSKYKGTLNTVPLV-NANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292
            G  + G +    Y G ++   L+ N N+  ++ K   ++V   A+   T       + +
Sbjct: 263 KGLFIIGDLVEDLYTGDIHYASLITNENHYWQL-KIDSVYVNSQAVNFSTS------EAV 315

Query: 293 LGSKVP----ALLDSGTTLTYFPMQXXXXXXXXXXXXWHSEEVGYIVDCNSRRLHQTAYI 348
            GS+       ++DSGTTL   P Q              S+   + + CNS  +      
Sbjct: 316 TGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSV-SDGTNFAIPCNSTEILS---- 370

Query: 349 YDFGGFQIRSPLSD-------YSMMTNVRGTCRFGIMPHSSDYV-ILGDVFLTRAYVVFD 400
            +  G  ++ P+S        Y   +   G C   I     D   ILG VFL   Y VFD
Sbjct: 371 LEING--VKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFD 428

Query: 401 LEALEVSMAQAN 412
           ++  +  +A  N
Sbjct: 429 VQNQQFGLANKN 440

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 81/222 (36%), Gaps = 34/222 (15%)

Query: 211 VLKRNNVIKKTVYSMFINE-------LNAKTGSVLFGAVDHSKYKGTLNTVPLV--NANY 261
           VL R+  I+   ++++++        LNA +G    G      YKG +    LV    NY
Sbjct: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275

Query: 262 RRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQXXXXXXXX 321
                  +  + TL          E+       SK   ++DSG+T    P          
Sbjct: 276 WLIAIDRIFCNSTLVTFQ----NPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI--- 328

Query: 322 XXXXWHSEEVGYIVDCNSRRLHQTAYI---YDFGGFQIRSPLSDYSMMTNVRGTCRFGIM 378
                HS   G I D N   +   + +   ++ G      P S Y       G+  +G  
Sbjct: 329 -----HSYLPGSITDGNYFAVFCNSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYC 383

Query: 379 P--------HSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412
                    HSS   ILGDVF+   Y VFD++  +V  A  N
Sbjct: 384 VSNIEGQAIHSS--WILGDVFIKNFYTVFDMDNQQVGFALKN 423

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,283,804
Number of extensions: 1906588
Number of successful extensions: 4411
Number of sequences better than 10.0: 141
Number of HSP's gapped: 3984
Number of HSP's successfully gapped: 185
Length of query: 499
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 385
Effective length of database: 40,409,475
Effective search space: 15557647875
Effective search space used: 15557647875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)