Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGL070W2.530ON34334311331e-155
Ecym_72572.530ON3523529121e-121
SAKL0A09416g2.530ON3852047561e-97
NCAS0F009302.530ON4222157512e-96
KLTH0D06776g2.530ON4092057208e-92
YHR004C (NEM1)2.530ON4462137238e-92
TDEL0A030502.530ON3552077158e-92
Suva_8.582.530ON4522147202e-91
TPHA0G035002.530ON3922177144e-91
Skud_8.492.530ON4472147184e-91
NDAI0H014202.530ON4482137151e-90
Kwal_26.80012.530ON4132057084e-90
KNAG0C058502.530ON4432127105e-90
ZYRO0B01958g2.530ON3362276876e-88
Smik_8.532.530ON4462136932e-87
CAGL0K02959g2.530ON4642116901e-86
KAFR0A018302.530ON4422176881e-86
Kpol_348.82.530ON4222476722e-84
TBLA0I014602.530ON3932196343e-79
KLLA0E18613g2.530ON3742195672e-69
Kpol_2002.1005.202ON4771482576e-24
SAKL0G12870g5.202ON3991472512e-23
TPHA0E030705.202ON4941582542e-23
Suva_10.995.202ON3851582502e-23
Smik_12.535.202ON4141682504e-23
KAFR0J009905.202ON4831582514e-23
YLR019W (PSR2)5.202ON3971582494e-23
Ecym_71045.202ON4921622498e-23
Skud_12.875.202ON3921582469e-23
NDAI0I021705.202ON3911622461e-22
TBLA0C060905.202ON4841582481e-22
YLL010C (PSR1)5.202ON4271682462e-22
Smik_12.825.202ON3921582442e-22
Skud_12.575.202ON4151582442e-22
CAGL0D03234g5.202ON4101582424e-22
KLTH0B03388g5.202ON4091582415e-22
KLLA0F15620g5.202ON4141472409e-22
NCAS0D027405.202ON3981482391e-21
TDEL0E042705.202ON4531582401e-21
KNAG0M017405.202ON4811582392e-21
CAGL0D05610g5.202ON4471502373e-21
Suva_10.655.202ON4151582338e-21
Kwal_33.151405.202ON4101472321e-20
NDAI0D018605.202ON5141592331e-20
AAL158W5.202ON4781602331e-20
ZYRO0B10428g5.202ON4821582321e-20
Kpol_478.165.202ON3501482282e-20
NCAS0A068005.202ON4731472251e-19
TBLA0H019905.202ON6881472234e-19
TPHA0N006705.202ON4521472214e-19
YPL063W (TIM50)8.527ON476981807e-14
SAKL0H10296g8.527ON478981744e-13
TDEL0B031908.527ON477981727e-13
Smik_16.1728.527ON477981728e-13
Suva_16.2498.527ON480981711e-12
KLTH0E12254g8.527ON476981682e-12
Kwal_27.119908.527ON474981683e-12
Kpol_457.58.527ON489981656e-12
TBLA0A005408.527ON485981656e-12
Skud_16.2188.527ON480981647e-12
NCAS0C022108.527ON491981631e-11
ZYRO0F09130g8.527ON489981631e-11
NDAI0E029108.527ON441981621e-11
CAGL0H05159g8.527ON485981621e-11
KLLA0E23101g8.527ON480981612e-11
TPHA0I020008.527ON478981594e-11
Ecym_11778.527ON490981505e-10
KAFR0E010208.527ON448981425e-09
ADR045W8.527ON476971408e-09
KNAG0A020608.527ON4501041391e-08
Kpol_1068.98.839ON74533712.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGL070W
         (343 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   441   e-155
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   355   e-121
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   295   1e-97
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   293   2e-96
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   281   8e-92
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   283   8e-92
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   280   8e-92
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   281   2e-91
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   279   4e-91
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   281   4e-91
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    280   1e-90
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   277   4e-90
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   278   5e-90
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   269   6e-88
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   271   2e-87
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   270   1e-86
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   269   1e-86
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   263   2e-84
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   248   3e-79
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   223   2e-69
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...   103   6e-24
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   101   2e-23
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...   102   2e-23
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...   100   2e-23
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...   100   4e-23
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...   101   4e-23
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...   100   4e-23
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...   100   8e-23
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    99   9e-23
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     99   1e-22
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...   100   1e-22
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    99   2e-22
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    99   2e-22
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    99   2e-22
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    98   4e-22
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    97   5e-22
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    97   9e-22
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    97   1e-21
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    97   1e-21
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    97   2e-21
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    96   3e-21
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    94   8e-21
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    94   1e-20
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     94   1e-20
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    94   1e-20
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    94   1e-20
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    92   2e-20
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    91   1e-19
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    91   4e-19
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    90   4e-19
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    74   7e-14
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    72   4e-13
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    71   7e-13
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    71   8e-13
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    70   1e-12
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    69   2e-12
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    69   3e-12
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    68   6e-12
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    68   6e-12
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    68   7e-12
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     67   1e-11
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    67   1e-11
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    67   1e-11
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    67   1e-11
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    67   2e-11
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    66   4e-11
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    62   5e-10
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    59   5e-09
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    59   8e-09
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    58   1e-08
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...    32   2.3  

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  441 bits (1133), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 237/343 (69%), Positives = 237/343 (69%)

Query: 1   MNSLSYLTGATQHAAGKGDGRWPGSERGLAKVREEQDXXXXXXXXXXXXXXXXLFXXXXX 60
           MNSLSYLTGATQHAAGKGDGRWPGSERGLAKVREEQD                LF     
Sbjct: 1   MNSLSYLTGATQHAAGKGDGRWPGSERGLAKVREEQDAARAGVGAGAAWVWRVLFFLPKW 60

Query: 61  XXXXXXXXXXXXXTFPLSLIEQTSSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMVLQE 120
                        TFPLSLIEQTSSK                            SMVLQE
Sbjct: 61  LVVKPVVLVWFVLTFPLSLIEQTSSKEADGAPGPEAAEEEQLAEAVEDDDLAGESMVLQE 120

Query: 121 DSVKXXXXXXXXXXXXXXXLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXX 180
           DSVK               LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIH       
Sbjct: 121 DSVKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTS 180

Query: 181 XXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVID 240
                QGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVID
Sbjct: 181 SVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVID 240

Query: 241 WLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQ 300
           WLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQ
Sbjct: 241 WLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQ 300

Query: 301 VEGWISXXXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAFI 343
           VEGWIS                 RFTTDTRNILSLKNGERAFI
Sbjct: 301 VEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAFI 343

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  355 bits (912), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/352 (55%), Positives = 220/352 (62%), Gaps = 9/352 (2%)

Query: 1   MNSLSYLTGATQH-AAGKGDGRWPGSERGLAKVREEQDXXXXXXXXXXXXXXXX-----L 54
           MNSLSYLTG++Q  ++ K + R+P SE  L  V EEQ+                     +
Sbjct: 1   MNSLSYLTGSSQPTSSSKEELRFPFSESSLPNVTEEQEVENGEVSQDSKGGRPSWVWRVV 60

Query: 55  FXXXXXXXXXXXXXXXXXXTFPLSLIEQTSSKXXXXXXXXXXXXXXXXX---XXXXXXXX 111
           F                  TFPL+LIE TSSK                            
Sbjct: 61  FFLPTWLIIKPIWLIWFVLTFPLNLIEHTSSKDGSVEEEEVIPTNSQGSGGGEVIEDDDL 120

Query: 112 XXXSMVLQEDSVKXXXXXXXXXXXXXXXLGKFLFPKKLIPQSILQTDRKKLLVLDLDETL 171
              SMVL EDS+K               LGKFLFPKKLIPQSILQTDRKK+LVLDLDETL
Sbjct: 121 VGESMVLHEDSIKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKVLVLDLDETL 180

Query: 172 IHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASM 231
           IH            QGHMVEVTF+ SGVS+LYYVHKRPYCDLFLSRV KWYDLVIFTASM
Sbjct: 181 IHSMSRSTSSSNTSQGHMVEVTFSVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASM 240

Query: 232 KEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQDIIIVDNSPISY 291
           +EYADPVIDWLESGIS RF++R+YRSDC+LRDG+GYVKDL++ISKNLQD IIVDNSP+SY
Sbjct: 241 REYADPVIDWLESGISARFTKRKYRSDCILRDGIGYVKDLTMISKNLQDTIIVDNSPVSY 300

Query: 292 AMNVDNAIQVEGWISXXXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAFI 343
           AMNVDNAIQVEGWIS                 RFTTDTRNILSLKNGE AF+
Sbjct: 301 AMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAFV 352

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  295 bits (756), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (78%), Gaps = 1/204 (0%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIPQS+L  ++KK+LVLDLDETLIH            QGHMVEV FA SG+
Sbjct: 180 MGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGI 239

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           S+LY+VHKRPYCDLFLS+V+KWY LV+FTASMKEYADPVIDWLES  S  FSQR YR DC
Sbjct: 240 SSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDC 299

Query: 260 LLRDGVGYVKDLSIIS-KNLQDIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXX 318
           +LRDGVGY+KDLS+IS K+L +IIIVDNSPISYAMNVDNAIQVEGWIS            
Sbjct: 300 ILRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLP 359

Query: 319 XXXXXRFTTDTRNILSLKNGERAF 342
                RFTTD RN+LSLK+GE+AF
Sbjct: 360 LLEALRFTTDIRNVLSLKSGEQAF 383

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  293 bits (751), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 163/215 (75%), Gaps = 12/215 (5%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +GKFLFPKKLIP+SI+QT+R+K LVLDLDETLIH            QGH+VEV F+ SGV
Sbjct: 205 MGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGV 264

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLYYVHKRPYCD FLS+VSKWYDL+IFTASMKEYADPVIDWLE  +  +FSQR YR+DC
Sbjct: 265 STLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDC 324

Query: 260 LLRDGVGYVKDLSIISK------------NLQDIIIVDNSPISYAMNVDNAIQVEGWISX 307
           +LRDGVGY+KDLS+IS+            +L +III+DNSPISYAMNV+NAIQVEGWIS 
Sbjct: 325 ILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISD 384

Query: 308 XXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                           RFTTD RN+L+LKNGE+AF
Sbjct: 385 PTDNALLNLLPLLEALRFTTDVRNVLALKNGEKAF 419

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  281 bits (720), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 156/205 (76%), Gaps = 2/205 (0%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIPQS+L   +++ LVLDLDETLIH            QGHMVEV FA SG+
Sbjct: 202 MGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFATSGI 261

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLY+VHKRPYCDLFL++++KWY+LV+FTASMKEYADPVIDWLES    +FS+R YR DC
Sbjct: 262 STLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDC 321

Query: 260 LLRDGVGYVKDLSIISKN--LQDIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXX 317
           +LRDGVGY+KDLS++  N  L DI I+DNSP+SYAM+VDNAIQVEGWIS           
Sbjct: 322 ILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLL 381

Query: 318 XXXXXXRFTTDTRNILSLKNGERAF 342
                 RFTTD RN+L+LK+GE AF
Sbjct: 382 PLLEALRFTTDIRNVLALKSGEHAF 406

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  283 bits (723), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 132/213 (61%), Positives = 158/213 (74%), Gaps = 10/213 (4%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+S+L T +KK LV+DLDETLIH            QGH+VEV F  SG+
Sbjct: 231 MGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGI 290

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
            TLY++HKRPYCDLFL++VSKWYDL+IFTASMKEYADPVIDWLES     FS+R YRSDC
Sbjct: 291 RTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDC 350

Query: 260 LLRDGVGYVKDLSII----------SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISXXX 309
           +LRDGVGY+KDLSI+          S +L D+II+DNSP+SYAMNVDNAIQVEGWIS   
Sbjct: 351 VLRDGVGYIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPT 410

Query: 310 XXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                         R++TD RNIL+LK+GE+AF
Sbjct: 411 DTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 443

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  280 bits (715), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 132/207 (63%), Positives = 160/207 (77%), Gaps = 3/207 (1%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+S+L  +++K LV+DLDETLIH            QGHMVE+ FA SGV
Sbjct: 148 MGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGV 207

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLYYVHKRP+CDLFLS+VSKWYDLV+FTASM+EYADPVIDWLE   S RFS+R YR++C
Sbjct: 208 STLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNC 267

Query: 260 LLRDGVGYVKDLSII---SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXX 316
           +LRDGVGY+KDLSI+   +  L ++I+VDNSPISYAMNVDNAIQVEGWIS          
Sbjct: 268 ILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTL 327

Query: 317 XXXXXXXRFTTDTRNILSLKNGERAFI 343
                  R+TTD R+IL+LKN E+AF+
Sbjct: 328 LPFLEALRYTTDVRDILALKNSEQAFL 354

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  281 bits (720), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 157/214 (73%), Gaps = 11/214 (5%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+SIL T +KK LV+DLDETLIH            QGH+VEV F  SG+
Sbjct: 236 MGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGI 295

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLY++HKRPYCDLFL++ SKWYDL+IFTASMKEYADPVIDWLE   +  FS+R YRSDC
Sbjct: 296 STLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDC 355

Query: 260 LLRDGVGYVKDLSIIS-----------KNLQDIIIVDNSPISYAMNVDNAIQVEGWISXX 308
           +LRDGVGY+KDLSI+             +L D+II+DNSP+SYAMNVDNAIQVEGWIS  
Sbjct: 356 VLRDGVGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDP 415

Query: 309 XXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                          R++TD RNIL+LK+GE+AF
Sbjct: 416 TDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 449

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  279 bits (714), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 138/217 (63%), Positives = 155/217 (71%), Gaps = 14/217 (6%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+SIL + RKK LVLDLDETLIH            Q H+VEV F  SG+
Sbjct: 173 MGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQISGI 232

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLYYVHKRPYCDLFLS VSKWYDL+IFTASMKEYADPVIDWLES     FS+R YR+ C
Sbjct: 233 STLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHC 292

Query: 260 LLRDGVGYVKDLSIISKN--------------LQDIIIVDNSPISYAMNVDNAIQVEGWI 305
           +LRDGVGY+KDLSII+                L +II++DNSP+SYAMNVDNAIQVEGWI
Sbjct: 293 ILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWI 352

Query: 306 SXXXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
           S                 R+TTD RNILSLKNGERAF
Sbjct: 353 SDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  281 bits (718), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 156/214 (72%), Gaps = 11/214 (5%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+SIL T +KK LV+DLDETLIH            QGH+VEV F  SG+
Sbjct: 231 MGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGI 290

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
            TLY++HKRPYCD FL++VS+WYDL+IFTASMKEYADPVIDWLES     FS+R YRSDC
Sbjct: 291 PTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDC 350

Query: 260 LLRDGVGYVKDLSIIS-----------KNLQDIIIVDNSPISYAMNVDNAIQVEGWISXX 308
           +LRDGVGY+KDLSII             +L D+II+DNSP+SYAMNVDNAIQVEGWIS  
Sbjct: 351 VLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDP 410

Query: 309 XXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                          R++TD RNIL+LK+GE+AF
Sbjct: 411 TDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 444

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  280 bits (715), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 156/213 (73%), Gaps = 10/213 (4%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +GKFLFPKKLIP+SI QT+R+K LVLDLDETLIH            QGH+VEV F++SGV
Sbjct: 232 MGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGV 291

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           S LYYVHKRPYCD FLS+V KWYDL+IFTASMKEYADPVIDWLE+     F++R YR+DC
Sbjct: 292 SMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRTDC 351

Query: 260 LLRDGVGYVKDLSII----------SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISXXX 309
           + RDGVGY+KDL+II          +  L ++II+DNSPISYAMN DNAIQVEGWIS   
Sbjct: 352 IRRDGVGYIKDLTIIKDDSNVSVPQTSTLSEVIILDNSPISYAMNADNAIQVEGWISDPT 411

Query: 310 XXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                         R+TTD R+IL+LKNGERAF
Sbjct: 412 DTALLNLLPLLEALRYTTDVRSILALKNGERAF 444

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  277 bits (708), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 153/205 (74%), Gaps = 2/205 (0%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIPQS+L   + + LVLDLDETLIH            QGHMVEV FA SG+
Sbjct: 206 MGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAISGI 265

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLY+VHKRPYCDLFL+ ++ WY+LV+FTASMKEYADPVIDWLES    +FS+R YR DC
Sbjct: 266 STLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDC 325

Query: 260 LLRDGVGYVKDLSIISKN--LQDIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXX 317
           +LRDGVGY+KDLS ++ N  L DI I+DNSP+SYAM+VDNAIQVEGWIS           
Sbjct: 326 ILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLL 385

Query: 318 XXXXXXRFTTDTRNILSLKNGERAF 342
                 RFTTD RNIL+LK+GE AF
Sbjct: 386 PLLEALRFTTDVRNILALKSGEHAF 410

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  278 bits (710), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 159/212 (75%), Gaps = 9/212 (4%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+SIL  ++KK LV+DLDETLIH            QGH+VEV F+ SGV
Sbjct: 229 MGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSISGV 288

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLYYV KRPYCDLFL++VSKWYD+VIFTASMKEYADPVIDWLES  + +FS+R YR+DC
Sbjct: 289 STLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRNDC 348

Query: 260 LLRDGVGYVKDLSIISKN---------LQDIIIVDNSPISYAMNVDNAIQVEGWISXXXX 310
           +LRDGVGY+KDL ++++          L+D+IIVDNSP+SYA+NVDNAIQVEGWI+    
Sbjct: 349 ILRDGVGYIKDLKMVTRGSNLGTSPDRLEDVIIVDNSPVSYALNVDNAIQVEGWINDPTD 408

Query: 311 XXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                          TTD RNILSLKNGE+AF
Sbjct: 409 TDLLNLIPLLEALENTTDVRNILSLKNGEKAF 440

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  269 bits (687), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 129/227 (56%), Positives = 159/227 (70%), Gaps = 3/227 (1%)

Query: 116 MVLQEDSVKXXXXXXXXXXXXXXXLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXX 175
           M LQ D+VK               +G+FLFPKKL+PQSIL  +RKK LV+DLDETLIH  
Sbjct: 112 MFLQRDTVKGGLRGKAFGTKK---MGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSA 168

Query: 176 XXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYA 235
                     QGHMVEV F  S +STLYYVHKRP+CDLFLS+VSKWYDL+IFTASMKEYA
Sbjct: 169 TRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYA 228

Query: 236 DPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNV 295
           DPVIDWLES  + +F +R YR +C++R+GVGY+KDLS++++ L +++++DNSP SYA N 
Sbjct: 229 DPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNE 288

Query: 296 DNAIQVEGWISXXXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
           DNAIQVEGWIS                 R+ TD R+IL LKNGE+A 
Sbjct: 289 DNAIQVEGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKAL 335

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  271 bits (693), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 132/213 (61%), Positives = 158/213 (74%), Gaps = 10/213 (4%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+S+L T +KK LV+DLDETLIH            QGH+VEV F  SG+
Sbjct: 231 MGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGI 290

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
            TLY++HKRPYCDLFL++VSKWY+L+IFTASMKEYADPVIDWLES     FS+R YRSDC
Sbjct: 291 RTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDC 350

Query: 260 LLRDGVGYVKDLSII----------SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISXXX 309
           +LRDGVGY+KDLSII          S +L D+II+DNSP+SYAMNVDNAIQVEGWIS   
Sbjct: 351 VLRDGVGYIKDLSIIKNSEENEKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPT 410

Query: 310 XXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                         R++TD RNIL+LK+GE+AF
Sbjct: 411 DTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 443

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  270 bits (690), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 130/211 (61%), Positives = 155/211 (73%), Gaps = 8/211 (3%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+F FPKKLIP+SIL +++KK LV+DLDETLIH            Q H++EV FA SGV
Sbjct: 251 MGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGV 310

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLYYVHKRPYCDLFLS+V KWY+L+IFTASMKEYADPVIDWLES  S  F+QR YR+ C
Sbjct: 311 STLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHC 370

Query: 260 LLRDGVGYVKDLSII----SKN----LQDIIIVDNSPISYAMNVDNAIQVEGWISXXXXX 311
           + RDGVGY+KDL  I    SKN    L D++I+DNSP+SYAM+VDNAIQVEGWIS     
Sbjct: 371 IARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDT 430

Query: 312 XXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
                       R+TTD RN+L+LKN E+AF
Sbjct: 431 ELLNLLPFLEALRYTTDVRNVLALKNSEKAF 461

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  269 bits (688), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 127/217 (58%), Positives = 156/217 (71%), Gaps = 14/217 (6%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+SIL  +RKK LV+DLDETLIH            QGH+VEV F+ +G+
Sbjct: 223 MGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGI 282

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLYYVHKRP+CDLFLS+VSKWY++VIFTASMKEYADPVIDWLE      F++R YR +C
Sbjct: 283 STLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNC 342

Query: 260 LLRDGVGYVKDLSII--------------SKNLQDIIIVDNSPISYAMNVDNAIQVEGWI 305
           LLRDGVGY+KDLS++               + L ++II+DNSP+SYA+NVDNAIQVEGWI
Sbjct: 343 LLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWI 402

Query: 306 SXXXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
           S                 R+TTD RN+L+LKNGE+ F
Sbjct: 403 SDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMF 439

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  263 bits (672), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 157/247 (63%), Gaps = 44/247 (17%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGV 199
           +G+FLFPKKLIP+SIL + RKK LVLDLDETLIH            Q H+VEV F  SG+
Sbjct: 172 IGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGI 231

Query: 200 STLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDC 259
           STLYYVHKRPYCDLFLS+V +WYDL+IFTASMKEYADPVIDWLE+     FS+R YR+DC
Sbjct: 232 STLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDC 291

Query: 260 LLRDGVGYVKDLSIIS------------------------------------------KN 277
           +LRDGVGY+KDLSI++                                          +N
Sbjct: 292 ILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQN 351

Query: 278 --LQDIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXXXXXXXRFTTDTRNILSL 335
             L ++I++DNSP+SYAMNVDNAIQV+GWIS                 R TTD RNILSL
Sbjct: 352 NLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSL 411

Query: 336 KNGERAF 342
           KNGERAF
Sbjct: 412 KNGERAF 418

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  248 bits (634), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 153/219 (69%), Gaps = 16/219 (7%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTF----- 194
           +G+FLFPKKLIP SIL+T+++K L+LDLDETLIH              H++EV F     
Sbjct: 172 MGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHLIEVKFPTPTS 231

Query: 195 ---AASG----VSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGIS 247
              +A G    +S+LYYV+KRPYCD FL+ VS WYDL+IFTASMKEYADPVIDWLE   +
Sbjct: 232 APTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFN 291

Query: 248 VRFSQRRYRSDCLLRDGVGYVKDLSIISKN----LQDIIIVDNSPISYAMNVDNAIQVEG 303
             F +R YR+ C+LRDG+GY+KDLS+++ +    L ++I++DNSPIS+AMNVDNAIQV+G
Sbjct: 292 GNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQG 351

Query: 304 WISXXXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAF 342
           WIS                 R TTD RNIL+LKNGERAF
Sbjct: 352 WISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAF 390

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  223 bits (567), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 116/219 (52%), Positives = 141/219 (64%), Gaps = 16/219 (7%)

Query: 140 LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQG---------HMV 190
           LGKF FPKKL+PQS+L +  +KLLVLDLDETLIH                       H+V
Sbjct: 155 LGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214

Query: 191 EVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRF 250
           EV F  + +STLY V KRPYCD+FL + S+WYD+ IFTASMKEYADPVIDWL+   SV+F
Sbjct: 215 EVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQF 274

Query: 251 SQRRYRSDCLLRDGVGYVKDLSII------SKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
             R YR DC LR GVGYVKD+  +      S++L  +II+DNSPISYAM++DNAIQV GW
Sbjct: 275 HYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGW 334

Query: 305 ISXXXXXXXXXXXXXXXXXRFTTDTRNILSLKNGERAFI 343
           I+                 R  TD+R IL+LK+G RA I
Sbjct: 335 INDPSDSELLHLLPLLKAMRHVTDSRCILALKSG-RASI 372

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score =  103 bits (257), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 84/148 (56%), Gaps = 9/148 (6%)

Query: 159 RKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRV 218
            KK LVLDLDETL+H               ++ VT      +   YV KRP  D FL RV
Sbjct: 306 NKKCLVLDLDETLVHSSFKYIDTADF----VLPVTIDDQ--THQVYVIKRPGVDEFLKRV 359

Query: 219 SKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNL 278
            K +++V+FTAS+  Y DP++D L+S  S+    R +R  C + DG  YVK+LS I + L
Sbjct: 360 GKIFEVVVFTASVSRYGDPLLDILDSSKSIH--HRLFRESCYIYDG-NYVKNLSQIGRPL 416

Query: 279 QDIIIVDNSPISYAMNVDNAIQVEGWIS 306
            DIII+DNSP SY  +  +AI +  W S
Sbjct: 417 SDIIILDNSPASYIFHPQHAIPISSWFS 444

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score =  101 bits (251), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 82/147 (55%), Gaps = 9/147 (6%)

Query: 160 KKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVS 219
           KK LVLDLDETL+H                VE+      V    YV KRP  D FL RV 
Sbjct: 229 KKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKRPGVDEFLERVG 282

Query: 220 KWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQ 279
           K Y++V+FTAS+  Y DP++D L+   +V    R +R  C   DG  Y+K+LS I + L 
Sbjct: 283 KLYEVVVFTASVSRYGDPLLDILDPRGAVH--HRLFRDSCYNYDG-NYIKNLSQIGRPLS 339

Query: 280 DIIIVDNSPISYAMNVDNAIQVEGWIS 306
           D+II+DNSP SY ++  +AI +  W S
Sbjct: 340 DLIILDNSPASYILHPQHAIPISSWFS 366

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 89/158 (56%), Gaps = 8/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L P+ I +  RKK L+LDLDETL+H               ++ VT      +   YV KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDSA----DFVIPVTI--DNQTHHVYVIKR 365

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL RVS+ Y++V+FTAS+  Y DP+++ L+   ++    R +R  C   +G  YV
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTI-IHHRLFRESCYTYEG-NYV 423

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS + + L +III+DNSP SY  +  +AI +  W S
Sbjct: 424 KNLSQLGRPLNEIIILDNSPASYIFHPQHAIPISSWFS 461

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score =  100 bits (250), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P  +L   +KK L+LDLDETL+H                VE+      V    YV KR
Sbjct: 204 LLPPKLLPFQQKKCLILDLDETLVHSSFKYLHTADFVLP--VEIDDQVHNV----YVIKR 257

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL RVS+ Y++V+FTAS+  YA+P++D L+   ++    R +R  C   +G  Y+
Sbjct: 258 PGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTIH--HRLFREACYNYEG-NYI 314

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L + II+DNSP SY  +  +A+ +  W S
Sbjct: 315 KNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFS 352

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score =  100 bits (250), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 90/168 (53%), Gaps = 11/168 (6%)

Query: 141 GKFLFP--KKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASG 198
           G++  P  K L+P     T  KK L+LDLDETL+H                VE+      
Sbjct: 223 GQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHN 280

Query: 199 VSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSD 258
           V    YV KRP  + FL RV K +++V+FTAS+  Y DP++D L++   +    R +R  
Sbjct: 281 V----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKVIH--HRLFREA 334

Query: 259 CLLRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           C   +G  Y+K+LS I + L DIII+DNSP SY  +  +AI +  W S
Sbjct: 335 CYNYEG-NYIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFS 381

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 86/158 (54%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P       RKK LVLDLDETL+H                V++      V    YV KR
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 355

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL RV + +++V+FTAS+  Y DP++D L+ G S+    R +R  C   +G  Y+
Sbjct: 356 PGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSIH--HRLFREACYNYEG-NYI 412

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS + + L DIII+DNSP SY  +  +AI +  W S
Sbjct: 413 KNLSQLGRPLSDIIILDNSPASYIFHPQHAIPISSWFS 450

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score =  100 bits (249), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 89/158 (56%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P  + +  +KK L+LDLDETL+H                VE+      V    YV KR
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMHSADFVLP--VEIDDQVHNV----YVIKR 269

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL+RVS+ Y++V+FTAS+  YA+P++D L+   ++    R +R  C   +G  Y+
Sbjct: 270 PGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTIH--HRLFREACYNYEG-NYI 326

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L + II+DNSP SY  +  +A+ +  W S
Sbjct: 327 KNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFS 364

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score =  100 bits (249), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 87/162 (53%), Gaps = 13/162 (8%)

Query: 147 KKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLY--Y 204
           + L+P    Q  R+K LVLDLDETL+H              H  +        + ++  Y
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQVHNVY 360

Query: 205 VHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDG 264
           V KRP  D FL RV + Y++V+FTAS+  Y DP++D L+    V    R +R  C   +G
Sbjct: 361 VIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKHNVVH--HRLFRDSCYNYEG 418

Query: 265 VGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
             Y+K+LS I + L D+II+DNSP SY  +  +AI +  W S
Sbjct: 419 -NYIKNLSQIGRPLSDLIILDNSPASYIFHPHHAIPISSWFS 459

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 99.4 bits (246), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P  + +  +KK L+LDLDETL+H                VE+      V    YV KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL RVS+ Y++V+FTAS+  YA+P++D L+   ++    R +R  C   +G  Y+
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTIH--HRLFREACYNYEG-NYI 321

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L + II+DNSP SY  +  +A+ +  W S
Sbjct: 322 KNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 88/162 (54%), Gaps = 13/162 (8%)

Query: 147 KKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLY--Y 204
           + L+P    +   KK LVLDLDETL+H              H  +          ++  Y
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVY 259

Query: 205 VHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDG 264
           V KRP  D FL RV++ Y++V+FTAS+  Y DP++D L+S  S+    R +R  C   +G
Sbjct: 260 VIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSIH--HRLFREACYNYEG 317

Query: 265 VGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
             YVK+L+ I + L +I+I+DNSP SY  +  +AI +  W S
Sbjct: 318 -NYVKNLAQIGRPLSEIVILDNSPASYMFHPQHAIPISSWFS 358

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 87/158 (55%), Gaps = 7/158 (4%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P    +   KK L+LDLDETL+H               ++ +      +  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPDF----ILPIEIEDGQIHNVYVI-KR 355

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL  V KWY++VIFTAS+  YA+P++D L+   ++  + R +R  C   +   ++
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNL-INHRLFRDACYNYEN-NFI 413

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L DIII+DNSP SY  +  +AI +  W S
Sbjct: 414 KNLSQIGRPLHDIIILDNSPASYIFHPQHAIPISSWFS 451

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 89/168 (52%), Gaps = 11/168 (6%)

Query: 141 GKFLFP--KKLIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASG 198
           G++  P    L+P     T  KK L+LDLDETL+H                VE+      
Sbjct: 236 GQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQVHN 293

Query: 199 VSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSD 258
           V    YV KRP  + FL RV K +++V+FTAS+  Y DP++D L++   +    R +R  
Sbjct: 294 V----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVIH--HRLFREA 347

Query: 259 CLLRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           C   +G  Y+K+LS I + L DIII+DNSP SY  +  +AI +  W S
Sbjct: 348 CYNYEG-NYIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFS 394

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 98.6 bits (244), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 88/158 (55%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P  + +  +KK L+LDLDETL+H                VE+      V    YV KR
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYMHTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FLSRV + Y++V+FTAS+  YA+P++D L+   ++    R +R  C   +G  Y+
Sbjct: 265 PGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTIH--HRLFREACYNYEG-NYI 321

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L + II+DNSP SY  +  +A+ +  W S
Sbjct: 322 KNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 98.6 bits (244), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 85/158 (53%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P     T  KK L+LDLDETL+H                VE+      V    YV KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  + FL RV K +++V+FTAS+  Y DP++D L++   +    R +R  C   +G  Y+
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNKVIH--HRLFREACYNYEG-NYI 344

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L DIII+DNSP SY  +  +AI +  W S
Sbjct: 345 KNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFS 382

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 84/158 (53%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P    Q   KK LVLDLDETL+H                V +      V    YV KR
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLP--VNIDDQVHNV----YVIKR 282

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL RV + Y++V+FTAS+  Y DP++D L+   S+    R +R  C   +G  Y+
Sbjct: 283 PGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSIH--HRLFREACYNYEG-NYI 339

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L +III+DNSP SY  +  +AI V  W S
Sbjct: 340 KNLSQIGRPLSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 97.4 bits (241), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 83/158 (52%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P    Q   KK LVLDLDETL+H                VE+      V    YV KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVI--PVEIDNQVHNV----YVIKR 281

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL  V + Y++V+FTAS+  Y DP++D L+    +    R +R  C   DG  Y+
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIH--HRLFRDSCYNYDG-NYI 338

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L D+II+DNSP SY  +  +AI +  W S
Sbjct: 339 KNLSQIGRPLSDLIILDNSPASYIFHPQHAIPISSWFS 376

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 97.1 bits (240), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 82/147 (55%), Gaps = 9/147 (6%)

Query: 160 KKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVS 219
           KK LVLDLDETL+H                VE+      V    YV KRP  D FL R++
Sbjct: 244 KKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDNQVHNV----YVIKRPGVDEFLRRIT 297

Query: 220 KWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQ 279
           + Y++V+FTAS+  Y DP++D L+   ++    R +R  C   +G  Y+K+LS I + L 
Sbjct: 298 ELYEVVVFTASVSRYGDPLLDILDKDKTIH--HRLFRDSCYNYEG-NYIKNLSQIGRPLS 354

Query: 280 DIIIVDNSPISYAMNVDNAIQVEGWIS 306
           D+II+DNSP SY  +  +AI +  W S
Sbjct: 355 DMIILDNSPASYIFHPQHAIPISSWFS 381

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 81/148 (54%), Gaps = 9/148 (6%)

Query: 159 RKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRV 218
            KK LVLDLDETL+H                VE+      V    YV KRP  D FL RV
Sbjct: 227 NKKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVIKRPGVDEFLKRV 280

Query: 219 SKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNL 278
            + Y++V+FTAS+  Y DP+++ L+   SV    R +R  C   +G  Y+K+L+ I + L
Sbjct: 281 GELYEVVVFTASVSRYGDPLLNILDQSNSVH--HRLFREACYNYEG-NYIKNLAQIGRPL 337

Query: 279 QDIIIVDNSPISYAMNVDNAIQVEGWIS 306
            DIII+DNSP SY  +  +AI +  W S
Sbjct: 338 SDIIILDNSPASYMFHPQHAIPISSWFS 365

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 84/158 (53%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P      + KK LVLDLDETL+H                V++      V    YV KR
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFKYLRTADFVL--PVDIDDQIHNV----YVIKR 325

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL RV   Y++V+FTAS+  Y DP++D L+   ++    R +R  C   +G  Y+
Sbjct: 326 PGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKTIH--HRLFRESCYNYEG-NYI 382

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L DIII+DNSP SY  +  +AI +  W S
Sbjct: 383 KNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFS 420

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 84/158 (53%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P        +K LVLDLDETL+H                V++      V    YV KR
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 353

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL RV K Y++V+FTAS+  Y DP++D L+   S+    R +R  C   +G  Y+
Sbjct: 354 PGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSIH--HRLFREACYNYEG-NYI 410

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L +III+DNSP SY  +  +AI +  W S
Sbjct: 411 KNLSQIGRPLSNIIILDNSPASYIFHPQHAIPISSWFS 448

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 95.9 bits (237), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 81/150 (54%), Gaps = 13/150 (8%)

Query: 159 RKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLY--YVHKRPYCDLFLS 216
            KK LVLDLDETL+H              H  +          ++  YV KRP  D FL 
Sbjct: 276 HKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVIKRPGVDEFLQ 327

Query: 217 RVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISK 276
           RV + Y++V+FTAS+  Y DP++D L+   ++    R +R  C   +G  Y+K+LS I +
Sbjct: 328 RVGELYEVVVFTASVSRYGDPLLDVLDKSNNIH--HRLFRDACYTYEG-NYIKNLSQIGR 384

Query: 277 NLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
            L +III+DNSP SY  +  +AI +  W S
Sbjct: 385 PLSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 94.4 bits (233), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 84/158 (53%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P        KK L+LDLDETL+H                VE+      V    YV KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  + FL RV K +++V+FTAS+  Y DP++D L++   +    R +R  C   +G  Y+
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVIH--HRLFREACYNYEG-NYI 344

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L +III+DNSP SY  +  +AI +  W S
Sbjct: 345 KNLSQIGRPLSEIIILDNSPASYIFHPQHAIPISSWFS 382

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 79/147 (53%), Gaps = 9/147 (6%)

Query: 160 KKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVS 219
           KK LVLDLDETL+H                VE+      V    YV KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQIHNV----YVIKRPGVDEFLKLVG 293

Query: 220 KWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQ 279
           + Y++V+FTAS+  Y DP++D L+    +    R +R  C   DG  Y+K+LS I + L 
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQTQCIH--HRLFRDSCYNYDG-NYIKNLSQIGRPLS 350

Query: 280 DIIIVDNSPISYAMNVDNAIQVEGWIS 306
           D+II+DNSP SY  +  +AI +  W S
Sbjct: 351 DLIILDNSPASYIFHPQHAIPISSWFS 377

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 10/159 (6%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L P+  ++   KK LVLDLDETL+H                V +      V    YV KR
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYLPNADFNLP--VNIDDQIHNV----YVIKR 385

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLE-SGISVRFSQRRYRSDCLLRDGVGY 267
           P  D FL +V K +++VIFTAS+  Y DP++D L+  G S+    R +R  C   +G  Y
Sbjct: 386 PGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIH--HRLFREACYNYEG-NY 442

Query: 268 VKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           +K+LS + + L +III+DNSP SY  +  +AI +  W S
Sbjct: 443 IKNLSQMGRPLSEIIILDNSPASYIFHPQHAIPISSWFS 481

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 86/160 (53%), Gaps = 13/160 (8%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLY--YVH 206
           L+P    +   +K LVLDLDETL+H              H  +        + ++  YV 
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQVHNVYVI 348

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL RV + +++V+FTAS+  Y DP++D L+   +V    R +R  C   +G  
Sbjct: 349 KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAVH--HRLFRDSCYNYEG-N 405

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           Y+K+LS I + L D+II+DNSP SY  +  +A+ +  W S
Sbjct: 406 YIKNLSQIGRPLSDLIILDNSPASYIFHPQHAVPISSWFS 445

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 83/158 (52%), Gaps = 9/158 (5%)

Query: 149 LIPQSILQTDRKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKR 208
           L+P        KK LVLDLDETL+H                V++      V    YV KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYLKGADFVL--PVDIDDQIHNV----YVMKR 354

Query: 209 PYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYV 268
           P  D FL +V   +++VIFTAS+  Y DP++D L+   SV    R +R  C   +G  Y+
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKHKSVH--HRLFREACYNYEG-NYI 411

Query: 269 KDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306
           K+LS I + L +III+DNSP SY  +  +AI +  W S
Sbjct: 412 KNLSQIGRPLSEIIILDNSPASYIFHPQHAIPISSWFS 449

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 92.4 bits (228), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 82/148 (55%), Gaps = 8/148 (5%)

Query: 159 RKKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRV 218
            +K LVLDLDETL+H                ++  F         YV KRP  D FL   
Sbjct: 178 NRKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQFQN------VYVIKRPGVDAFLQYT 231

Query: 219 SKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNL 278
           SK +++VIFTAS+++Y +P++D L+S   +    R +R  C   +G  Y+K+L+ + + L
Sbjct: 232 SKLFEVVIFTASVEKYGNPLLDILDSTNDL-VHHRLFRDACYNYNG-NYIKNLAQLGRPL 289

Query: 279 QDIIIVDNSPISYAMNVDNAIQVEGWIS 306
            DIII+DNSP SY  + ++AI +  W S
Sbjct: 290 SDIIILDNSPTSYLFHPNHAIPISSWFS 317

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 80/147 (54%), Gaps = 8/147 (5%)

Query: 160 KKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVS 219
           KK LVLDLDETL+H                V        +  +Y + KRP  + FL RV 
Sbjct: 302 KKCLVLDLDETLVHSSFKYLQT-----ADFVLPVNIDEQIHNVYVI-KRPGVEEFLKRVG 355

Query: 220 KWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQ 279
           + +++V+FTAS+  Y DP++D L+ G  +    R +R  C   +G  Y+K+LS + + L 
Sbjct: 356 ELFEVVVFTASVARYGDPLLDILDPGRQL-IHHRLFREACYNYEG-NYIKNLSQMGRPLS 413

Query: 280 DIIIVDNSPISYAMNVDNAIQVEGWIS 306
           +III+DNSP SY  +  +AI +  W S
Sbjct: 414 EIIILDNSPASYIFHPQHAIPISSWFS 440

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 80/147 (54%), Gaps = 9/147 (6%)

Query: 160 KKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVS 219
           KK L+LDLDETL+H                V++      V    YV KRP  D FL  VS
Sbjct: 518 KKCLILDLDETLVHSSFKYLTSADFVIP--VDIDEQIHNV----YVIKRPGVDQFLETVS 571

Query: 220 KWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQ 279
           K +++V+FTAS+  Y DP++D L+    +    R +R  C   +G  Y+K+LS I + L 
Sbjct: 572 KIFEVVVFTASVSRYGDPLLDVLDKHRCIH--HRLFREACYDYEG-NYIKNLSQIGRPLS 628

Query: 280 DIIIVDNSPISYAMNVDNAIQVEGWIS 306
           ++II+DNSP SY  +  +AI +  W S
Sbjct: 629 ELIILDNSPASYIFHPQHAIPISSWFS 655

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 89.7 bits (221), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 79/147 (53%), Gaps = 9/147 (6%)

Query: 160 KKLLVLDLDETLIHXXXXXXXXXXXXQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVS 219
           +K LVLDLDETL+H                V++      V    YV KRP  D FL  V 
Sbjct: 282 RKCLVLDLDETLVHSSFKYLNIADFVL--PVDIDNQVQNV----YVSKRPGVDEFLKIVG 335

Query: 220 KWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQ 279
             Y++++FTAS+  Y +P++D L+    +    R +R  C + +G  YVK+LS I + L 
Sbjct: 336 DLYEVIVFTASVSRYGNPLMDILDPHKYIH--HRLFRDSCYVYEG-NYVKNLSQIGRPLG 392

Query: 280 DIIIVDNSPISYAMNVDNAIQVEGWIS 306
           DIII+DNSP SY  +  +AI +  W S
Sbjct: 393 DIIILDNSPASYIFHPQHAIPISSWFS 419

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y+D + + L+  I    S   ++  C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 274

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L  +II+D  P SY +  +NAI +E W
Sbjct: 275 HIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPW 312

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   YA+ V + ++  I    +   Y+  CL +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMDP-IHAFVTYNLYKEHCLYKDGV- 273

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L   +I+D  P SY +  +NAI V+ W
Sbjct: 274 HIKDLSKLNRDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP CD FL  +S++Y++V+F+++   YA+ + + L+  I    S   ++  C+ +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 265

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KD+S ++++L  ++ +D  P +Y +  +NAI ++ W
Sbjct: 266 HIKDISKLNRDLGKVVTIDTDPNTYKLQPENAIPMDPW 303

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S+++++V+F+++   Y+D + + L+  I    S   ++  C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 274

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L  +II+D  P SY +  +NAI ++ W
Sbjct: 275 HIKDLSKLNRDLSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S+++++V+F+++   Y++ + + L+  I    S   ++  C+ +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 279

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L  +II+D  P SY +  +NAI +E W
Sbjct: 280 HIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPW 317

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y+D V + L+  I    +   ++  CL +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDP-IHAFITYNLFKEHCLYKDGV- 270

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L   IIVD  P +Y +  +NAI +  W
Sbjct: 271 HIKDLSKLNRDLGKTIIVDCDPNAYKLQPENAIPMRPW 308

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y+D V + L+  I    +   ++  CL +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDP-IHAFITYNLFKEHCLYKDGV- 269

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L   +I+D  P +Y +  +NAI ++ W
Sbjct: 270 HIKDLSKLNRDLGKTVIIDCDPNAYKLQPENAIPMKPW 307

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y++ + + L+  I    S   Y+  C+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDP-IHAFISYNLYKEHCVYKEG-D 283

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L  +IIVD  P SY +  +NAI ++ W
Sbjct: 284 HIKDLSKLNRDLGKVIIVDTDPASYKLQPENAIPMQPW 321

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y+D + + L+  I    S   ++  CL +DGV 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDP-IHAFVSYNLFKEHCLYKDGV- 278

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++ + ++I+D  P SY +  +NAI ++ W
Sbjct: 279 HIKDLSKLNRDEKKVLIIDVDPNSYKLQPENAIPMKPW 316

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  + FL  +S++Y++V+F+++   Y++   + L+  I    S   ++  C+ +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDP-IHAFVSYNLFKEHCVYKDGV- 277

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS + ++L  +II+D  P SY +  +NAI ++ W
Sbjct: 278 HIKDLSKLKRDLSKVIIIDTDPNSYKLQPENAIPMDPW 315

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y + + + L+  +    S   ++  C+ +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDP-LHAFISYNLFKEHCVYKDGV- 285

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS +++++  ++I+D  P +Y +  +NAI V+ W
Sbjct: 286 HIKDLSKLNRDVNKVLIIDTEPNNYKLQPENAIPVKPW 323

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP CD FL  +S++Y++V+F+++   Y+D + + L+  I    S   ++  C+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLDP-IHAFISYNLFKEHCVYKDGI- 278

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KD+S +++++  ++++D  P  Y    +NAI  + W
Sbjct: 279 HIKDISKMNRDVGKVVMIDTDPNCYKSQPENAIPAKPW 316

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y + + + L+  +    S   ++  C+ +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDP-LHAFISYSLFKEHCVYKDGV- 293

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS +++++  ++I+D  P +Y +  +NAI +E W
Sbjct: 294 HIKDLSKLNRDVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   YA+ + + ++  I    S   ++  C+ +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDP-IHAFISYNLFKEHCVYKDGV- 280

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L+ ++I+D    SY +  +NAI ++ W
Sbjct: 281 HIKDLSKLNRDLKKVMIIDTDENSYKLQPENAIPMDPW 318

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   YA+ + + L+  I    +   ++  CL +DGV 
Sbjct: 220 KRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDP-IHAFITYNLFKEHCLYKDGV- 277

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L  ++I+D    S+ +  +NAI +E W
Sbjct: 278 HIKDLSKLNRDLGKVLIIDTDENSFKLQPENAIYLEPW 315

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y++ + + L+  I    S   Y+  C+ ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLYKEHCVYKEGT- 274

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L  ++I+D  P +Y    +NAI V+ W
Sbjct: 275 HIKDLSKLNRDLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   +++ + + L+  I    +   ++  C+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLDP-IHAFITYNLFKEHCVYKDGI- 284

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS ++++L   II+D    ++ +  +NAI  E W
Sbjct: 285 HIKDLSHLNRDLGKTIIIDTDANAFKLQPENAIHAEPW 322

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266
           KRP  D FL  +S++Y++V+F+++   Y++ + + L+  I    S   ++  C+ + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDP-IHAFISYNLFKEHCVYKKG-K 248

Query: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           ++KDLS +++++  +II+D    +Y +  +NAI ++ W
Sbjct: 249 HIKDLSKLNRDVNKVIIIDTDKNNYKLQPENAIPMKPW 286

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 56/97 (57%), Gaps = 2/97 (2%)

Query: 208 RPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGY 267
           RP  D  L  +S +Y+ V+F ++   Y+  V++ L+  I    +   ++  C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDP-IRAFITYNLFKDHCVYKDGI-H 274

Query: 268 VKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
           +KDLS ++++L   +I+D  P S  + ++NAI  E W
Sbjct: 275 IKDLSHLNRDLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 63/104 (60%), Gaps = 2/104 (1%)

Query: 201 TLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCL 260
           T +   KRP  D FL  +S++Y++V+F+++   Y++ + + L+  +    S   ++  C+
Sbjct: 205 TGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLDP-LHAFISYNLFKEHCV 263

Query: 261 LRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGW 304
            +D V ++KDLS ++++++ ++I+D    SY +  +NA+ +  W
Sbjct: 264 YKDHV-HIKDLSKLNRDVRKVVIMDTDANSYKLQPENALPMAPW 306

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 203 YYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYA 235
           YYV  RP    F   VSK Y++ I+T + + YA
Sbjct: 229 YYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYA 261

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,466,817
Number of extensions: 664626
Number of successful extensions: 1574
Number of sequences better than 10.0: 71
Number of HSP's gapped: 1488
Number of HSP's successfully gapped: 73
Length of query: 343
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 233
Effective length of database: 40,868,139
Effective search space: 9522276387
Effective search space used: 9522276387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)