Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR747W1.3ON42642621170.0
Ecym_10061.3ON3643489211e-121
TPHA0E040401.3ON3573418501e-111
ZYRO0F15774gsingletonON4103688511e-110
NCAS0B091301.3ON3673448411e-109
KNAG0C001801.3ON3593418361e-109
SAKL0C00418g1.3ON3643618361e-109
Smik_3.121.3ON3603418261e-107
Suva_3.1501.3ON3613348261e-107
Skud_3.11.3ON3603648221e-106
YCL064C (CHA1)1.3ON3603418201e-106
NDAI0A001201.3ON3773778201e-106
KAFR0F04430singletonON3433438131e-105
KAFR0D001101.3ON3653358101e-105
Kpol_2002.61.3ON3503417911e-102
KLTH0F00440g1.3ON3413317741e-100
TBLA0A049201.3ON3603617724e-99
KAFR0I00130singletonON3443407704e-99
CAGL0B00286g1.3ON3603497568e-97
NDAI0K02950singletonON3343397531e-96
SAKL0C13904gsingletonON3393367452e-95
ZYRO0F18524g1.3ON3353317331e-93
NCAS0A15330singletonON3473407271e-92
KNAG0D05380singletonON3343397173e-91
KLLA0C00440g1.3ON3773337012e-88
Smik_9.2na 1ON3383386756e-85
Scer_YGOB_SDL1 (SDL1)na 1ON3373376503e-81
KLLA0E01805gsingletonON3223316451e-80
Skud_9.2na 1ON3393346303e-78
TDEL0D06540singletonON3373406294e-78
KNAG0A01150singletonON2312234446e-52
YIL167W (SDL1)singletonOFF2101974366e-51
YIL168WsingletonOFF1271282285e-22
SAKL0F11858g7.367ON5622681401e-08
ACR232C7.367ON5602681302e-07
KAFR0K017007.367ON5792851293e-07
NCAS0A142307.367ON5692851161e-05
TBLA0C050707.367ON5752931152e-05
KNAG0C036907.367ON5772901133e-05
TPHA0F031307.367ON5682871115e-05
SAKL0A10626gsingletonON3201611096e-05
Ecym_47087.367ON5703411106e-05
KLLA0E19779g7.367ON5673031106e-05
CAGL0I05126g7.367ON5712901081e-04
YKL218C (SRY1)na 2ON3263011061e-04
NDAI0A018107.367ON5702901062e-04
Kpol_530.167.367ON5662861053e-04
ZYRO0B02772g7.367ON5692861044e-04
TDEL0C018007.367ON5692851034e-04
Smik_5.2257.367ON5762901018e-04
Skud_5.2057.367ON5762901018e-04
Suva_5.1997.367ON5762851000.001
YER086W (ILV1)7.367ON5762901000.001
KLTH0B04884g7.367ON573147930.008
Kwal_33.148227.367ON562147870.039
KLTH0H10846gna 3ON349180722.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR747W
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   820   0.0  
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   359   e-121
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   332   e-111
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   332   e-110
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    328   e-109
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   326   e-109
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   326   e-109
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   322   e-107
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   322   e-107
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   321   e-106
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   320   e-106
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   320   e-106
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              317   e-105
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   316   e-105
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   309   e-102
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   302   e-100
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   301   4e-99
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   301   4e-99
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   295   8e-97
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             294   1e-96
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   291   2e-95
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   286   1e-93
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            284   1e-92
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   280   3e-91
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   274   2e-88
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      264   6e-85
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   254   3e-81
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   253   1e-80
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      247   3e-78
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            246   4e-78
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   175   6e-52
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   172   6e-51
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...    92   5e-22
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    59   1e-08
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    55   2e-07
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    54   3e-07
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    49   1e-05
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    49   2e-05
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    48   3e-05
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    47   5e-05
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    47   6e-05
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    47   6e-05
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    47   6e-05
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    46   1e-04
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    45   1e-04
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    45   2e-04
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    45   3e-04
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    45   4e-04
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    44   4e-04
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    44   8e-04
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    44   8e-04
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    43   0.001
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    43   0.001
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    40   0.008
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    38   0.039
KLTH0H10846g Chr8 (931560..932609) [1050 bp, 349 aa] {ON} simila...    32   2.0  

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/426 (93%), Positives = 397/426 (93%)

Query: 1   MSNKRTYTSTEVQFGDEMDDDFHQHCDSSLVPTGVQVKKGHLISEVLQYIICGMRMRYQF 60
           MSNKRTYTSTEVQFGDEMDDDFHQHCDSSLVPTGVQVKKGHLISEVLQYIICGMRMRYQF
Sbjct: 1   MSNKRTYTSTEVQFGDEMDDDFHQHCDSSLVPTGVQVKKGHLISEVLQYIICGMRMRYQF 60

Query: 61  SRQQTVGSMASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWK 120
           SRQQTVGSMASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWK
Sbjct: 61  SRQQTVGSMASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWK 120

Query: 121 EMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGAD 180
           EMQKIRQNSSLQPHVF               RQLGLPCTVVVPETTRRRMVERIRSTGAD
Sbjct: 121 EMQKIRQNSSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGAD 180

Query: 181 VISMGSVLKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQG 240
           VISMGSVLKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQG
Sbjct: 181 VISMGSVLKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQG 240

Query: 241 VQLESVKGIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSM 300
           VQLESVKGIVCS              EKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSM
Sbjct: 241 VQLESVKGIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSM 300

Query: 301 NPKSVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAAL 360
           NPKSVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAAL
Sbjct: 301 NPKSVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAAL 360

Query: 361 HLGYHPEILERELGPLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIKDFHTPIGTQHE 420
           HLGYHPEILERELGPLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIKDFHTPIGTQHE
Sbjct: 361 HLGYHPEILERELGPLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIKDFHTPIGTQHE 420

Query: 421 TIILTS 426
           TIILTS
Sbjct: 421 TIILTS 426

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  359 bits (921), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 237/348 (68%), Gaps = 7/348 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+S Y KTPL+R  F + N++ +  P+ ++KYEFFQPSGSFKSRGIGNLI+ ++ +IR++
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
            + QPHVF               +++G+PCTVVVP +TR+R++E+I +TGA +I  G   
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 189 KESDDYLRSELM-----GNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQL 243
            E+D YL+ +LM      N   +K  PIY HPF++PLIW GH+ +V+E++E+L  + +  
Sbjct: 121 AEADSYLK-DLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179

Query: 244 ESVKGIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPK 303
             VKGIVCS              E+H LA++IP++ VETEGCEVLH+SL+ G+ ++    
Sbjct: 180 SRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239

Query: 304 -SVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHL 362
            SVATSL    +T  TL YAQKY+TKS+VL +  V+ TCL F +ESNIVTEPACGA LHL
Sbjct: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299

Query: 363 GYHPEILERELGPLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIKD 410
           GYHP IL +ELGPL+ +D+VI+IACGGS   LADL+E + +  P   D
Sbjct: 300 GYHPAILHKELGPLSSEDIVILIACGGSATTLADLRELKLKYNPVTLD 347

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 223/341 (65%), Gaps = 7/341 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+RH+F  +N+     P++ LKYE FQPSGSFKSRGIGNLI     +I++N
Sbjct: 1   MSQVYNKTPLLRHLFPGKNL-----PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKN 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
           S   P VF               + L LPCTVVVP  T+ RMVE+I++TGA+VI  G+  
Sbjct: 56  SKKSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D YL++ ++ N++ + + PIY HPFDN  IWEGHATM+DE+VE    Q + +E VK 
Sbjct: 116 KEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKA 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              EKH LA  IPVV VET GC V + SL +G+ +      ++AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIAT 235

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ +++ T  YA+KY TKS+V+D L VV+TCL F  +SN+V EPACGAALH+GY+ +
Sbjct: 236 SLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMD 295

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407
           ILE+ LG  L   D+V++IACGGS+  + +L+ S  +L+ K
Sbjct: 296 ILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  332 bits (851), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 172/368 (46%), Positives = 235/368 (63%), Gaps = 12/368 (3%)

Query: 62  RQQTVGSMASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKE 121
            Q    +M S Y KTPL++ +F      +  + ++ +KYE  QPSGSFKSRGIG+LI K 
Sbjct: 40  NQAVFQAMPSIYNKTPLLKQIF-----NHATSAQVFVKYECLQPSGSFKSRGIGHLISKR 94

Query: 122 MQKIRQNSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADV 181
            + I+ +    PHVF               ++L LPCTVV+P TT++RM ++IR  GA+V
Sbjct: 95  AKDIQGDGRKSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANV 154

Query: 182 ISMGSVLKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGV 241
           +  GS  KE+D +L++ L   VN+  + PIY HPFDNP IWEGHA++VDE++ +L  +  
Sbjct: 155 VVQGSHWKEADSHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENT 214

Query: 242 QLESVKGIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMN 301
            L  VKGIVCS              EK+ LA+ IP++AVET+GC VL+ SL +G+ V  N
Sbjct: 215 ALNRVKGIVCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFN 274

Query: 302 P-KSVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAAL 360
              SVATSLCTS ++  TL Y QKY +KS+VL+   V+QTCL +AE  N++TEPACGA+L
Sbjct: 275 KMNSVATSLCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASL 334

Query: 361 HLGYHPEILERELGP-LTPQDVVIVIACGGSTMNLADLKESEDQLQP----KIKDFHTPI 415
           HLGYHP+++ER LG  L   DV+IVIACGGS+  + DL+ES  +L+      I+   TP 
Sbjct: 335 HLGYHPQLIERALGKNLDKDDVIIVIACGGSSNTILDLEESLAKLEEAPHLSIRRNATP- 393

Query: 416 GTQHETII 423
             +HE II
Sbjct: 394 SLEHENII 401

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  328 bits (841), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 226/344 (65%), Gaps = 3/344 (0%)

Query: 69  MASFYCKTPLMRHVFARQNVR-YTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQ 127
           M+  Y KTPL+R  F   + +  T+ P+  LKYE  QPSGSFKSRGIGNLI K   +I++
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 128 NSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSV 187
           + +  P VF               ++L LPCTVVVP  T++RMVE+IR+TGA+VI  G+ 
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 188 LKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247
            KE+D YL+S +M +++L    PIY HPFDNP IWEGH+TMVDE+V+ L+ Q + L  +K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 248 GIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVA 306
           GIVCS              EKH LAD IP+V VET+GC V + SL LG+ +  +   S+A
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366
           TSL T+ ++  T  YA+KY T+SVV++   V++TCL + ++ N+V EPACGA+LHL Y+ 
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 367 EILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIK 409
            ILE  LG  L+  D+++VIACGGS+  + DL+E+  +L+ K K
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAK 344

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  326 bits (836), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 166/341 (48%), Positives = 221/341 (64%), Gaps = 7/341 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+R  F  +N+     P++ LKYE  QPSGSFKSRGIGNLI K   +I++ 
Sbjct: 1   MSLVYNKTPLLRQFFPGKNL-----PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKI 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
              + HVF               ++L LPCTVVVP  T+ RMVE+IR+TGA VI  G+  
Sbjct: 56  GERRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D +L+  +M  ++L+   PIY HPFDNP IWEGHAT+VDE++E L+ Q +Q E+VKG
Sbjct: 116 KEADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKG 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              EKHGLA+ IP+V VET GC VL+ SL L + +      S+AT
Sbjct: 176 IVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIAT 235

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ ++  T   A+KY T+SVV+D   V++TCL +  + N+V EPACGAALHL Y+ +
Sbjct: 236 SLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVD 295

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407
           ILE+ LG  LTP DV++VIACGGS+  L DL+++   L  K
Sbjct: 296 ILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSK 336

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  326 bits (836), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 228/361 (63%), Gaps = 8/361 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M SFY KTPL+R +F    +  +A P+ ++KYE FQPSGSFKSRGIG+LI +   +I   
Sbjct: 1   MTSFYSKTPLLRRIFPSSVL--SATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE 58

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
            +   HVF               R   LPCTVVVP TT  RMV +IR TGADVI  G+  
Sbjct: 59  GNKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHW 118

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
            ++D YL   +M  ++  K  P+YAHPFDNP+IWEGH+T+VDE+VE+L  Q +    VKG
Sbjct: 119 GDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKG 178

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              EKH LA +IP++ VET+GCEV H+SL  G+ +  +   SVAT
Sbjct: 179 IVCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVAT 238

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ +   TL  A KY TKSVVL    VV+TCL+FA+++NIV EPACGA+LH GY+P 
Sbjct: 239 SLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPH 298

Query: 368 ILEREL-GPLTPQDVVIVIACGGSTMNLADLKESEDQL-QPKIKDF---HTPIGTQHETI 422
           +LE  L G L P+D++IVIACGGS+  + DL++ + +L +P    F    TP+  + E +
Sbjct: 299 LLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSFTYETTPVDRKLEPV 358

Query: 423 I 423
           +
Sbjct: 359 V 359

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  322 bits (826), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/341 (46%), Positives = 218/341 (63%), Gaps = 7/341 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+R  F  +     +  +  LKYE  QPSGSFKSRGIGNLI K   +I+++
Sbjct: 1   MSIVYNKTPLLRQFFPGK-----SPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
               P +F               ++L LPCTVVVP  T++RMVE+IR+TGA VI  G+  
Sbjct: 56  GKKSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D +L++++M  ++ + V PIY HPFDNP IWEGH++MVDE+V+ L  Q + +  VKG
Sbjct: 116 KEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKG 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              E++GLAD IP+V VET GC V + SL +G+ V      S+AT
Sbjct: 176 IVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ +++ T  YA+KY T+SVV++   V+ TCL +  + N+V EPACGAALHLGY+ E
Sbjct: 236 SLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTE 295

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407
           ILER LG  L   D+VI+IACGGS+  + DL+E+ D    +
Sbjct: 296 ILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKR 336

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  322 bits (826), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 163/334 (48%), Positives = 218/334 (65%), Gaps = 7/334 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+R  F  +++      +  LKYE  QPSGSFKSRGIGNLI K   +I++N
Sbjct: 1   MSIVYNKTPLLRQFFPGKSL-----AQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKN 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
               P VF               ++L LPCTVVVP  T+ RMVE+IR+TGA VI  G+  
Sbjct: 56  GKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D YL++ +M  ++ + V PIY HPFDNP IWEGH++MVDE+V+ L  Q V +E VKG
Sbjct: 116 KEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKG 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              E+HGLAD IP+V VET+GC V + SL +G+ V      S+AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ +++ T  YA+KY TKSVV++   V++TCL ++ + N+VTEPACGAALHLGYH +
Sbjct: 236 SLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTD 295

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKES 400
           ILE  L   L   D+V++IACGGS+  + DL+E+
Sbjct: 296 ILETALDTKLAADDIVLIIACGGSSNTVQDLEET 329

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  321 bits (822), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 166/364 (45%), Positives = 226/364 (62%), Gaps = 11/364 (3%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+R  F  +     +  +  LKYE  QPSGSFKSRGIGNLI K   +I+++
Sbjct: 1   MSIVYNKTPLLRQFFPSK-----SPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKD 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
               P VF               ++L LPCTVVVP  T++RMVE+IR+TGA VI  G+  
Sbjct: 56  GRRSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D +L++ +M  ++ + V PIY HPFDNP IWEGH++MVDE+V+ L  Q + +  VKG
Sbjct: 116 KEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKG 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              E++ LAD IP+V VET GC V + SL +G+ V      S+AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ +++ T  YA KY TKSVV++   V++TCL +  + N+V EPACGAALHLGYH E
Sbjct: 236 SLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTE 295

Query: 368 ILERELGP-LTPQDVVIVIACGGSTMNLADLKESEDQLQ----PKIKDFHTPIGTQHETI 422
           ILE+ LG  L   D+VI+IACGGS+  + DL+E+ + L+    P I+     I  +  + 
Sbjct: 296 ILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTST 355

Query: 423 ILTS 426
           IL S
Sbjct: 356 ILKS 359

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/341 (46%), Positives = 220/341 (64%), Gaps = 7/341 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+R  F  +     A+ +  LKYE  QPSGSFKSRGIGNLI K   +I+++
Sbjct: 1   MSIVYNKTPLLRQFFPGK-----ASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
               P VF               ++L LPCTVVVP  T++RMV++IR+TGA VI  G+  
Sbjct: 56  GKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D +L++ +M  ++ + + PIY HPFDNP IWEGH++M+DE+V+ L  Q + +  VKG
Sbjct: 116 KEADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKG 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              E++GLAD IP+V VET GC V + SL +G+ V      S+AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIAT 235

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ +++ T  YA+KY T+SVV++   V++TCL +  + N+V EPACGAALHLGY+ +
Sbjct: 236 SLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTK 295

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407
           ILE  LG  L   D+VI+IACGGS+  + DL+E+ D ++ K
Sbjct: 296 ILENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKK 336

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 231/377 (61%), Gaps = 19/377 (5%)

Query: 69  MASFYCKTPLMRHVF------ARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEM 122
           M+  Y KTPL+R  F      +      TA P+  +KYE  QPSGSFKSRGIGNLI K  
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 123 QKIRQNSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVI 182
             I +     P VF               ++L LPCTVVVP  T++RMVE+I+STGA+VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 183 SMGSVLKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQ 242
             G+  KE+D +L++ +M  ++   + PIY HPFDNPLIWEGHATMVDE++++L+ Q + 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 243 LESVKGIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP 302
           +  VKGIVCS              +K+ LAD IP+V VET+GC V + SL L + +  + 
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 303 -KSVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALH 361
             S+ATSL T+ ++  T  YAQKY+T+SVV++   V++TCL + ++ N+V EPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 362 LGYHPEILERELG-PLTPQDVVIVIACGGST----------MNL-ADLKESEDQLQPKIK 409
           L YH +ILE+ LG  L   D+++VIACGGS+          +N+ AD K++ D     I 
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360

Query: 410 DFHTPIGTQHETIILTS 426
           +F     TQH  I +++
Sbjct: 361 NFIDTENTQHFPIDISA 377

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  317 bits (813), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 161/343 (46%), Positives = 221/343 (64%), Gaps = 5/343 (1%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTAN--PEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIR 126
           M + Y KTPL+R  F   N R T++  P++  KYE FQP  SFKSRGIGNLI K  +K+ 
Sbjct: 1   MPTVYNKTPLLRPYFLEAN-RGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVE 59

Query: 127 QNSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGS 186
           +       VF               R+L +PCTVVVP +T+ RMVE+IRSTGA VI  G+
Sbjct: 60  EEGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGN 119

Query: 187 VLKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESV 246
             KE+D+YLR+ ++  V+  KV P+Y HPFD+PLIWEGH+T++DE+VE+L+ + V    V
Sbjct: 120 FWKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKV 179

Query: 247 KGIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSV 305
           KG+VCS              E+H LAD IPV+AVETEGC V +  L LG++V      S+
Sbjct: 180 KGVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSI 239

Query: 306 ATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYH 365
           ATSL +  ++  T  YAQKY +K VVL  + V++TCL ++E+SN++ EPAC A++HL Y+
Sbjct: 240 ATSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYN 299

Query: 366 PEILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407
            +ILE  L   L+  DV+I+IACGGS   L D+K+S  +L+ K
Sbjct: 300 VDILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKIK 342

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  316 bits (810), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/335 (46%), Positives = 215/335 (64%), Gaps = 3/335 (0%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTAN-PEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQ 127
           M+  Y KTPL+R  F     R + + P+  LKYE  QPSGSFKSRGIGNLI K+  +I +
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 128 NSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSV 187
             + +P VF               ++L LPCTVVVP  T++RM+E+I+ TGA+VI  G+ 
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 188 LKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247
            KE+D YL+  +M  +N  ++ PIY HPFDNPLIWEGH+++VDE+++ L  Q VQ  ++K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 248 GIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVA 306
           GIVCS              E+H L D IPVV VETEGC V + SL LG+ V      S+A
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366
           TSL T+ ++  T   A KY T+SV++    V++TCL + ++ N+VTEPACGA++HL Y+ 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 367 EILERELG-PLTPQDVVIVIACGGSTMNLADLKES 400
           +ILE  LG  LT  D V+VIACGGS+  L D++E+
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEET 335

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  309 bits (791), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 159/341 (46%), Positives = 221/341 (64%), Gaps = 7/341 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL++H F  +N+     P+  LKYE  QPSGSFKSRGIGNLI K   +I++ 
Sbjct: 1   MSLVYNKTPLLKHFFPGKNL-----PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKI 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
           +  +P+VF               ++L LPCTVVVP  T+ RMV++IR+TGA+VI  G+  
Sbjct: 56  NVKKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D++L+  +M  +N +K+ PIY HPFDNPLIWEGH+TMVDE++E    Q   ++++K 
Sbjct: 116 KEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKA 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKS-VAT 307
           IVCS              EK+ LAD IPVV VET+GC V + SL L + V     S +AT
Sbjct: 176 IVCSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIAT 235

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ +++    YA+KY TKSVV++   VV+TCL F  + N+V EPACGAA+HLGYH +
Sbjct: 236 SLGTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTD 295

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407
           +LE  LG  LT  D V+++ACGGS+  + +L+ +  +L  K
Sbjct: 296 LLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLK 336

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  302 bits (774), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 208/331 (62%), Gaps = 2/331 (0%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M S + KTPL+ H FA  + R    P+ MLK EF QPSGSFKSRGIG +I K+  KIR  
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
            +  PHVF               R L +PC+VVVPE+T  RMV++I + GA+V   G   
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D +L+  ++   N  +   IYAHPFD+PLIWEGH+++VDE++++L  Q + L+++K 
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSM-NPKSVAT 307
           IVCS               +H L   IP++ VE++GCEV + SL LG+     +  S+AT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           S+ T+ ++  TL  A +Y TKSVVL    ++ TCL FA+E+NI+ EPACGAALHLGY+P+
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 368 ILERELGP-LTPQDVVIVIACGGSTMNLADL 397
           IL + L    TP+DV+I+I CGGS  +  DL
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  301 bits (772), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 161/361 (44%), Positives = 220/361 (60%), Gaps = 20/361 (5%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQ- 127
           M+  Y KTPL+R  F     R +  P+  LKYE  QPSGSFKSRGIGNLI K + KI   
Sbjct: 1   MSIVYNKTPLLRQFF-----RGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSS 55

Query: 128 NSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSV 187
           N + +P VF               R+L +PCTVVVP  T+ RMV +I+ TGA VI  G  
Sbjct: 56  NLNKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGH 115

Query: 188 LKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247
             E+DDYL++ ++  ++L ++ PIY HPFDNPLIWEGH+TM+DE++E+L+ Q + + +VK
Sbjct: 116 WSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVK 175

Query: 248 GIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPK--SV 305
            I CS              EK+ LA  IP++ VET GC+V + SL L + V   PK  ++
Sbjct: 176 AITCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKF-PKINTI 234

Query: 306 ATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYH 365
           ATSL TS ++  T   A KY TKSVV+D + V++TCL +  + N V EPACGAALHL Y+
Sbjct: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294

Query: 366 PEILERELG-PLTPQDVVIVIACGGSTMNLADLKES-----EDQLQPKIKDF-----HTP 414
             ++E  L   LT  D++IVIACGGS+  + +L+E+      D   P+  ++     HTP
Sbjct: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTP 354

Query: 415 I 415
           I
Sbjct: 355 I 355

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  301 bits (770), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 220/340 (64%), Gaps = 3/340 (0%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTAN-PEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQ 127
           M   Y KTPL+   F    +R + + P++++KYE+ QPSGSFKSRGIGNL++++  +I++
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 128 NSSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSV 187
           NS+  P VF               ++L LPCTVVVP  T++RM+E+IRSTGA V   G+ 
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 188 LKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247
            K +D Y+++ ++  +N EKV PIY HP D+PLIWEG++ +VDE++E+L  Q +    VK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 248 GIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKS-VA 306
            IVCS              E++ LAD IP+V VET+G  V +  L  G+++     S VA
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366
           TSL ++ +T  T  YA KYR + V++  + V++TCL + ++ N++TEPACGAA+HL YH 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 367 EILERELGP-LTPQDVVIVIACGGSTMNLADLKESEDQLQ 405
           +ILE+ L   L   DVVI+IACGGS+ +L D++E+  +++
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMK 340

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  295 bits (756), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 158/349 (45%), Positives = 217/349 (62%), Gaps = 12/349 (3%)

Query: 71  SFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNS- 129
           S Y KTPL+R +F        + P++ LK+E FQPSGSFKSRGIG+LI K+ Q+I  N  
Sbjct: 2   SVYNKTPLIRQIFP-------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54

Query: 130 SLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLK 189
             +P VF               + L LPCTVV+P  T++RM ++IR+TGA+VI  G+  K
Sbjct: 55  GKKPMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114

Query: 190 ESDDYLRSELMGNVN-LEK-VAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247
           E+D+YL+  ++  +  L K V PIY HPFDNP IWEGHA+MVDE+VE    + + L  +K
Sbjct: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174

Query: 248 GIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVA 306
            IVCS              EK+ LAD IP+V VET+GC V + SL + + VS     S+A
Sbjct: 175 AIVCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234

Query: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366
           TSL T+ ++     YA++Y TKSVVL    VV+TCL +  + N+V EPACGAA+HL YH 
Sbjct: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294

Query: 367 EILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIKDFHTP 414
           EILE+ELG  L   D+V+V+ACGGS+  + D++    +L  +  + + P
Sbjct: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIP 343

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  294 bits (753), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 149/339 (43%), Positives = 213/339 (62%), Gaps = 9/339 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+R  F    +     P I LKYE  QPSGSFKSRGIG LI + + K++Q+
Sbjct: 1   MSFIYNKTPLLRQTFDSAKI----GPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQD 56

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
            +   HVF               R L +PCTVVVP++T+ RMV +IR TGA V+  G   
Sbjct: 57  GNKTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHW 116

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+DD+LR  +    N ++  PIY HPFD+P+IWEGH+T++DE+V+ L  + + +E VKG
Sbjct: 117 KEADDFLRKSMKEMDNTQE-QPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKG 175

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPK--SVA 306
           I+CS              E+H LA SIPV+AVET+GC+VL++SL  G  V + PK  SVA
Sbjct: 176 IICSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQL-PKITSVA 234

Query: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366
           TSL +++++      A KY ++S+ L+   V++TCL + ++ ++  EPACGA++HL Y+P
Sbjct: 235 TSLGSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNP 294

Query: 367 EILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQL 404
            I+E  LG  L+  D+VIV+ CGGS+  L DL+    +L
Sbjct: 295 GIVESALGTALSNHDIVIVVLCGGSSCTLHDLESLNSKL 333

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  291 bits (745), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 207/336 (61%), Gaps = 6/336 (1%)

Query: 71  SFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSS 130
           SFY KTPL+  V    +      P   LKYEF QP GSFKSRGIG L+ K  +K R++  
Sbjct: 6   SFYNKTPLLPRVLTTTD----GAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGG 61

Query: 131 LQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKE 190
               VF               +   + CTVVVP TT+ RMVE+IR TGA+V+  G     
Sbjct: 62  KSLAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGM 121

Query: 191 SDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIV 250
           +D+YLR  +M  V++ KV P+Y HPFDNP+IW+GH+T+VDEVV  L  + V ++ VK IV
Sbjct: 122 ADEYLREVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIV 181

Query: 251 CSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSL 309
           CS              E H LAD IP++A+ET+GC+VL++SL  G  V +    SVA+SL
Sbjct: 182 CSVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSL 241

Query: 310 CTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPEIL 369
            + ++++     A+KY +KS++L    V++TCLNFA+++ IV EPACGA+L+  YHPE+L
Sbjct: 242 ASPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELL 301

Query: 370 ERELGP-LTPQDVVIVIACGGSTMNLADLKESEDQL 404
              +G  LT  DV++VIACGGS +   DL+  + +L
Sbjct: 302 PLYIGKELTEDDVIVVIACGGSAVTYKDLEYMKKEL 337

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  286 bits (733), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 208/331 (62%), Gaps = 8/331 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M ++Y KTPL+R +   +    T  P+I +KYE  QP GSFKSRGIGNLI  +     +N
Sbjct: 1   MNNWYYKTPLLRQILNWKTT--TELPQIFIKYENLQPGGSFKSRGIGNLISLK----SEN 54

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
             ++ HV                +Q+ LPCTVVVP +T++RMV++I+++GA+VI  GS  
Sbjct: 55  GLVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHW 114

Query: 189 KESDDYLRSELMGNVNLEKVA-PIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247
           KE+D+YL+   + +   +  + P+Y HPFD+P +WEGH+TMV E+++ L  Q + +E+V+
Sbjct: 115 KEADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVR 174

Query: 248 GIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVA 306
           GIVCS              E HGLAD IPV+AVET GC VL+ SL  GR V ++   S+A
Sbjct: 175 GIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLA 234

Query: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366
           TSL ++++       A +Y  KS+VL+   V++TCL +  +   + EPACGA+LH+GYHP
Sbjct: 235 TSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHP 294

Query: 367 EILERELGPLTPQDVVIVIACGGSTMNLADL 397
           E+LE  LG  +  D++++IACGGST    DL
Sbjct: 295 ELLENFLGGFSKDDIIVIIACGGSTTTFKDL 325

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  284 bits (727), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 150/340 (44%), Positives = 211/340 (62%), Gaps = 8/340 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M+  Y KTPL+R VF    ++  + P++ +KYE  QPSGSFKSRGIG+LI K   +++Q 
Sbjct: 1   MSLVYNKTPLLRRVFP-TGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQL 59

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
                HVF               + L LPCTVVVP +T+ RMVE+IR+ G +VI  GS  
Sbjct: 60  GGKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHW 119

Query: 189 KESDDYLRSELMGNVN-LEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247
           KE+D +L++ ++ +V+ +E+  PIY HPFD+P +WEGH+TMVDE+V+    Q V L  VK
Sbjct: 120 KEADSFLKNSVIPSVDRIEE--PIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVK 177

Query: 248 GIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPK--SV 305
            IVCS              EK+ LAD IPV+A+ET+GC   +  L   + V + PK  SV
Sbjct: 178 AIVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVEL-PKITSV 236

Query: 306 ATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYH 365
           ATSL  + V        Q+Y++ SVVL  + VV TCL +A + NI+TEPACGA+LH+ Y+
Sbjct: 237 ATSLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYN 296

Query: 366 PEILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQL 404
            +++E+ LG  L   D++++IACGGS   + DL+ S  QL
Sbjct: 297 TKLIEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQL 336

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  280 bits (717), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 208/339 (61%), Gaps = 9/339 (2%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M + Y KTPL+      +N+     P  + KYE  QP GSFK RG+ +LI K +++I+  
Sbjct: 1   MPALYNKTPLLP-----KNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSE 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
               PHVF                 L +PCTVVVP  T+ RMVE+IR   A+VI  GS  
Sbjct: 56  GKKPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNW 115

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+DDYLR  ++ + N   V PIY +PFD+PL+WEGH+TM+DE++ AL+ + ++L++VKG
Sbjct: 116 KEADDYLRGTVIASNN--AVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKG 173

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              E H LA +IPVVAVET+GC+VL  SL   + V +N   S+AT
Sbjct: 174 IVCSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIAT 233

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL +S+V+      A K++++SVVL    V+ TC  + ++ N + EPACGA +H  YH +
Sbjct: 234 SLGSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYK 293

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQ 405
           ILE+ LG  LTP D++I+I CGGS + + DL+ ++ +L 
Sbjct: 294 ILEKALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKLD 332

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  274 bits (701), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 205/333 (61%), Gaps = 8/333 (2%)

Query: 70  ASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNS 129
           A  + KTPL++H F R     +  P+++LKYEF QPSGSFKSRGIG+LI  ++++I+++S
Sbjct: 22  AQLFSKTPLLKHQFKR-----SKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSS 76

Query: 130 SLQ-PHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
             +  HVF                +L +PCTVVV   TR R++E+IRS GADV+  G+  
Sbjct: 77  PEKIGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHW 136

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D +++  LM  ++  K  PIY+HPFDNPLIWEGH+ MVDE+++ L    + +  +KG
Sbjct: 137 KEADSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKG 196

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              +++ LAD IP+V VET+G +VL  SL +G  V      S AT
Sbjct: 197 IVCSFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCAT 256

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL T+ ++       +++ +KS V+    V+ TCL F+ ++NIV EP CGA L+ GY+ +
Sbjct: 257 SLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNID 316

Query: 368 ILERELGP-LTPQDVVIVIACGGSTMNLADLKE 399
            L+  LG  +   D VI+I CGGS+ +L DLKE
Sbjct: 317 KLQNILGSDIKDDDYVILIGCGGSSTSLEDLKE 349

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  264 bits (675), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 145/338 (42%), Positives = 198/338 (58%), Gaps = 6/338 (1%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           + S Y KTPL+R VF         NP   +K++  QP GSFKSRGIG+LI K+ ++    
Sbjct: 2   LISHYEKTPLIRQVFDNGKT----NPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAE 57

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
            S +  VF               R + L CTVVVP+TT+ RMV++I+S GA VI  G   
Sbjct: 58  GSGKLVVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHW 117

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
            E+D+YL+ E+M          +Y HPFD+ +IWEGH+T+VDE+++ L  + +    VKG
Sbjct: 118 GEADEYLKQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKG 177

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           +VCS              E++ LA  IP+VAVET GC+VL++SL  G  V++    SVAT
Sbjct: 178 LVCSVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVAT 237

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL + ++          Y  KSVVL    V+ TCL +A++ N + EPACGA+LHL YHPE
Sbjct: 238 SLGSPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPE 297

Query: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQL 404
           ILE+ LG  L+  DVVI+IACGGS M   DL ++   L
Sbjct: 298 ILEKALGQKLSEDDVVIIIACGGSCMTYEDLVKASKTL 335

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  254 bits (650), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 142/337 (42%), Positives = 191/337 (56%), Gaps = 7/337 (2%)

Query: 71  SFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSS 130
           ++Y KTPL+R            N    +K+E  QP GSFKSRGIG+LI K  ++     S
Sbjct: 4   TYYEKTPLIRQFLNNGKT----NSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGS 59

Query: 131 LQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKE 190
            +  VF               R + L C+VVVP+TT+ RMV++I+S GA VI  G    E
Sbjct: 60  GKLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGE 119

Query: 191 SDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIV 250
           +D+YLR E M   +      +Y HPFDN  IWEGH+T+VDE++E L    + L  VK +V
Sbjct: 120 ADEYLRHE-MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALV 178

Query: 251 CSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSL 309
           CS              +++ LA+ IPVVAVET GC+VL++SL  G  V++    SVATSL
Sbjct: 179 CSVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSL 238

Query: 310 CTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPEIL 369
            + ++         KY  KSVVL    V+ TCL +A++ N + EPACGA+LHL YHPEIL
Sbjct: 239 ASPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEIL 298

Query: 370 EREL-GPLTPQDVVIVIACGGSTMNLADLKESEDQLQ 405
           E  L   +   D+VI+IACGGS M   DL ++   L 
Sbjct: 299 EDILEQKIYEDDIVIIIACGGSCMTYEDLVKASSTLN 335

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  253 bits (645), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 192/331 (58%), Gaps = 13/331 (3%)

Query: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128
           M     KTPL+     R+ +     P  +LKYE  QP GSFKSRGI +LI   M  I   
Sbjct: 1   MDQLTIKTPLLPF---REPLN--GGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSISDP 55

Query: 129 SSLQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188
            + +  V+                 L +PCTV+VP++T+ RM+++I S GA V+  G   
Sbjct: 56  EN-ELAVYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHW 114

Query: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248
           KE+D YLR  +M   +      +Y HPFDNP+IW+GH+TM+DE++E L      +  VKG
Sbjct: 115 KEADTYLREYVMRQSSYSNT--LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKG 172

Query: 249 IVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307
           IVCS              E+HGLA SIPV A+ET+GC+VL +SL+ G  V ++   S+AT
Sbjct: 173 IVCSVGGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIAT 232

Query: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367
           SL ++ +   +   A K+ +KS+VLD   VV TCL F +E++I+ EPACGA+LH  Y PE
Sbjct: 233 SLGSTEICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPE 292

Query: 368 ILERELGPLTPQDVVIVIACGGSTMNLADLK 398
           +    LGPL P D+V+VI CGGS     DLK
Sbjct: 293 L----LGPLGPDDIVVVILCGGSCNTYDDLK 319

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  247 bits (630), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 135/334 (40%), Positives = 193/334 (57%), Gaps = 6/334 (1%)

Query: 73  YCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQ 132
           Y +TPL+  VF          P + +K+E  QP GSFKSRGIG+LI +  ++   + S +
Sbjct: 6   YERTPLIHQVFNNGQT----GPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGK 61

Query: 133 PHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESD 192
             VF                 + L CTVVVP+TT+ RM+++I++ GA VI  GS   E+D
Sbjct: 62  LAVFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEAD 121

Query: 193 DYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCS 252
           +YLR ELM   +      +Y HPFD+  IWEGH+T+VDEV++ L  + + L  +K +VCS
Sbjct: 122 EYLRQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCS 181

Query: 253 XXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSLCT 311
                         E++ LA  I V+AVET GC+VL++SL+ G  +++    S+ATSL +
Sbjct: 182 VGGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGS 241

Query: 312 SFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPEILER 371
            ++          Y  KSVVL    V+ TCL +A++ N + EPACGA+LHL YH EILE 
Sbjct: 242 PYIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILEN 301

Query: 372 EL-GPLTPQDVVIVIACGGSTMNLADLKESEDQL 404
            L   L+  D+VI+IACGGS M   DL E+  ++
Sbjct: 302 ALEQKLSDDDIVIIIACGGSCMTYEDLVETSRRI 335

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  246 bits (629), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 193/340 (56%), Gaps = 6/340 (1%)

Query: 71  SFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSS 130
           S+  K+PL+   F          P+  LKYE  QPSGSFKSRGIG LI  + ++ R    
Sbjct: 2   SYSHKSPLLNRRFKESE---KDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDG 58

Query: 131 LQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKE 190
              HVF               + L L CTVVVP TT+R M++RI++ G+ VI  G+    
Sbjct: 59  SDVHVFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGM 118

Query: 191 SDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIV 250
           +D YL+  +M  V    V P+Y HPFD+PL+WEGH+ M+DE+VE L  QG  +  VKGI+
Sbjct: 119 ADTYLKEVVMKKVP-SNVEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGII 177

Query: 251 CSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSL 309
           CS              E+HG A  IP++AVET G + L +SL  G+ V +    S+A+SL
Sbjct: 178 CSVGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSL 237

Query: 310 CTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPEIL 369
            + ++   +   A +Y+T+S V      V+T L F +E+NI+ EPAC A++ L YH + L
Sbjct: 238 GSPYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDEL 297

Query: 370 ERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPKI 408
            + L   L+ +D+VIVI CGGS   ++DL+  + +  PK+
Sbjct: 298 NKLLSCKLSSKDIVIVIVCGGSATTISDLEMLQRRYNPKL 337

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  175 bits (444), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 95/223 (42%), Positives = 139/223 (62%), Gaps = 6/223 (2%)

Query: 188 LKESDDYLRSELMGNVNLEK-VAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESV 246
           LKE+D YL++ +   ++L K V PIY +PFD+PLIWEGH+T++DE++  L  + +++ SV
Sbjct: 12  LKEADYYLQNVV---IDLYKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQENIEVGSV 68

Query: 247 KGIVCSXXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSV 305
           KGI+CS              EK+ LA +IPVVAVET+GC+VL+ SL   + V ++   S+
Sbjct: 69  KGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQLDSITSI 128

Query: 306 ATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYH 365
           A SL +S V+        KY +KS+VL+    + TC  + ++   V EPACGA++H  YH
Sbjct: 129 AKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGASVHTAYH 188

Query: 366 PEILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407
             +LE  L   L P DV+I+IACGGS     DL+ ++ QL  K
Sbjct: 189 YNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQLGNK 231

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  172 bits (436), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 90/197 (45%), Positives = 120/197 (60%), Gaps = 2/197 (1%)

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
           +Y HPFDN  IWEGH+T+VDE++E L    + L  VK +VCS              +++ 
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSLCTSFVTDLTLSYAQKYRTKS 329
           LA+ IPVVAVET GC+VL++SL  G  V++    SVATSL + ++         KY  KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 330 VVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPEILEREL-GPLTPQDVVIVIACG 388
           VVL    V+ TCL +A++ N + EPACGA+LHL YHPEILE  L   +   D+VI+IACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 389 GSTMNLADLKESEDQLQ 405
           GS M   DL ++   L 
Sbjct: 192 GSCMTYEDLVKASSTLN 208

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score = 92.4 bits (228), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 71  SFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSS 130
           ++Y KTPL+R            N    +K+E  QP GSFKSRGIG+LI K  ++     S
Sbjct: 4   TYYEKTPLIRQFLNNGKT----NSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGS 59

Query: 131 LQPHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKE 190
            +  VF               R + L C+VVVP+TT+ RMV++I+S GA VI  G    E
Sbjct: 60  GKLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGE 119

Query: 191 SDDYLRSE 198
           +D+YLR E
Sbjct: 120 ADEYLRHE 127

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 105/268 (39%), Gaps = 26/268 (9%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWK--EMQKIRQNSSLQPHVFXXXXXXXXXXXXXX 150
           N  + LK E   P  SFK RG  N+I K  E QK +        V               
Sbjct: 78  NANVQLKREDLLPVFSFKLRGAYNMIAKLDESQKTQG-------VIACSAGNHAQGVAYA 130

Query: 151 XRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKV 208
            + L +P T+V+P +T     + +   G+ V+  G+   E+       +E  G  N+   
Sbjct: 131 SKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEERGLTNIP-- 188

Query: 209 APIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEK 268
                 PFD+P +  G  T+  E++  +H        +K + C+              ++
Sbjct: 189 ------PFDHPYVIAGQGTIAMEILRQVH----NASKIKAVFCAVGGGGLITGVGAYLKR 238

Query: 269 HGLADSIPVVAVETEGCEVLHRSLLLGRNVSM-NPKSVATSLCTSFVTDLTLSYAQKYRT 327
             +A  I V+ VET     LH SL  G+ V + N  + A       + + T   A+    
Sbjct: 239 --IAPHIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVD 296

Query: 328 KSVVLDQLAVVQTCLNFAEESNIVTEPA 355
           + V+++   +     +  E++  + EP+
Sbjct: 297 EVVLVNTDEICAAVKDIFEDTRSIVEPS 324

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 106/268 (39%), Gaps = 32/268 (11%)

Query: 96  IMLKYEFFQPSGSFKSRGIGNLI--WKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXRQ 153
           + LK E   P  SFK RG  N+I    E QK          V                R+
Sbjct: 80  VCLKREDLLPVFSFKLRGAYNMISNLDEYQK-------SAGVIACSAGNHAQGVAFSARE 132

Query: 154 LGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLRSELMGNVNLEKVAPIYA 213
           LG+   +V+P +T       + + GA+V+  G    E+    ++E      L K+  I  
Sbjct: 133 LGIRAMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA----KAECARLAQLHKLTDI-- 186

Query: 214 HPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHGLAD 273
            PFD+P +  G  T+  E++  +H        +  + C               ++  +A 
Sbjct: 187 PPFDHPYVIAGQGTIATEILRQVH----NASQIGAVFCGVGGGGLIAGIGSYLKR--IAP 240

Query: 274 SIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTKSVVLD 333
            I ++ VET     LH +L  GR  +M P       C +  T + +   + +R    V+D
Sbjct: 241 HIKIIGVETHDAPTLHTALKQGRR-TMLP----AVGCFADGTSVRMMGEETFRVARDVVD 295

Query: 334 QLAVVQT---CL---NFAEESNIVTEPA 355
           ++ +V T   C    +  E++  + EP+
Sbjct: 296 EVVLVNTDELCAAIKDIFEDTRAIVEPS 323

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 108/285 (37%), Gaps = 28/285 (9%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N+I K    +R        V                +
Sbjct: 95  NTNVQLKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAK 149

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
           +LG+P T+V+P +T     + +   G+ V+  G+   E+       SE  G  N+     
Sbjct: 150 KLGIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLSEERGLTNIP---- 205

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E++  +H        +  +                 ++  
Sbjct: 206 ----PFDHPYVIAGQGTVAMEILRQVH----NANKINAVFVPVGGGGLIAGVGAYLKR-- 255

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSLCTSFVTDLTLSYAQKYRTKS 329
           +A  I V+ VET     LH SL  G+   +    + A       + + T   AQ+   + 
Sbjct: 256 IAPHIKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEI 315

Query: 330 VVLDQLAVVQTCLNFAEESNIVTEPA-----CGAALHLG-YHPEI 368
           V+++   +     +  E++  + EP+      G   ++   HPEI
Sbjct: 316 VLVNTDELCAAIKDVFEDTRSILEPSGALSVAGMKKYISVLHPEI 360

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 105/285 (36%), Gaps = 28/285 (9%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N+I K       +S     V                +
Sbjct: 85  NTNVQLKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAYAAK 139

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            LG+P T+V+P +T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 140 HLGIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP---- 195

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E++  +H        +  +                 ++  
Sbjct: 196 ----PFDHPYVIAGQGTVAMEILRQVH----NANKIGAVFVPVGGGGFIAGVGAYLKR-- 245

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSM-NPKSVATSLCTSFVTDLTLSYAQKYRTKS 329
           +A  I V+ VET     LH SL   +   +    + A       + + T   AQ+   + 
Sbjct: 246 IAPHIKVIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEV 305

Query: 330 VVLDQLAVVQTCLNFAEESNIVTEPACGAALH------LGYHPEI 368
           V+++   +     +  E++  + EP+   A+          HPEI
Sbjct: 306 VLVNTDEICAAVKDIFEDTRSIVEPSGALAVAGMKKYITNLHPEI 350

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 107/293 (36%), Gaps = 44/293 (15%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N +I LK E   P  SFK RG  N++ K  +  R+       V                +
Sbjct: 86  NSQIQLKREDLLPVFSFKMRGAYNMVAKLDETQRKQG-----VIACSAGNHAQGVAYAAK 140

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLRS--ELMGNVNLEKVAP 210
            LG+P T+V+P +T     E +   G+ V+  G+    S        E  G VN+     
Sbjct: 141 HLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGECERLCEERGLVNIP---- 196

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E++  +        S K                       
Sbjct: 197 ----PFDHPYVIAGQGTVAMEILRQVK------NSAKIGAVFVPVGGGGLVAGIGAYLKR 246

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSLCTSFVTDLTLSYAQKYRTKS 329
           +A  I +V VET     L  SL  G+   +N   + A       + + T      +R   
Sbjct: 247 IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMIGEET------FRVSK 300

Query: 330 VVLDQLAVVQT------CLNFAEESNIVTEPACGAAL--------HLGYHPEI 368
            V+D++ +V T        +  E++  + EP+   ++        HL  HPEI
Sbjct: 301 DVVDEIVLVNTDELCAAVKDIFEDTRSIVEPSGALSVAGLKKYVQHL--HPEI 351

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 111/290 (38%), Gaps = 38/290 (13%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N++ K +   ++N      V                +
Sbjct: 93  NTNVQLKREDLLPVFSFKLRGAYNMMAK-LDDTQKNQG----VIACSAGNHAQGVAFAAK 147

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLRSELMGNVNLEKVAPIY 212
            L +P T+V+P +T     + +   G+ V+  G+   E+     ++L     L  + P  
Sbjct: 148 HLDIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAEC-TKLSKERGLTNIPP-- 204

Query: 213 AHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHGLA 272
              FD+P +  G  T+  E++  +H+        K                       +A
Sbjct: 205 ---FDHPYVIAGQGTVAMEILRQVHIAN------KIGAVFVPVGGGGLVAGVGAYLKRIA 255

Query: 273 DSIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTKSVVL 332
             I ++ VET     L+ SL  GR  S+   SV T       T + L   + +R    V+
Sbjct: 256 PHIKIIGVETFDASTLYTSLQRGRRTSL--PSVGTFADG---TSVKLIGEETFRISQDVV 310

Query: 333 DQLAVVQT------CLNFAEESNIVTEPACGAAL--------HLGYHPEI 368
           D++ +V T        +  E++  + EP+   A+        HL  HPEI
Sbjct: 311 DEVVLVNTDEICAAVKDIFEDTRSIVEPSGALAVAGMKKYITHL--HPEI 358

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 111/287 (38%), Gaps = 32/287 (11%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK +   P  SFK RG  N++ K +   ++N      V                +
Sbjct: 84  NTNVQLKRDDLLPVFSFKLRGAYNMMAK-LDDTQKNQG----VIACSAGNHAQGVAYAAK 138

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P +T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 139 HLKIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTNIP---- 194

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E++  +H+       +  +                 ++  
Sbjct: 195 ----PFDHPYVIAGQGTVAMEILRQVHMS----SKIGAVFVPVGGGGLIAGVGTYLKR-- 244

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSLCTSFVTDLTLSYAQKYRTKS 329
           +A  I ++ VET     L+ SL  G+  ++    S A       + + T   AQ+   + 
Sbjct: 245 IAPHIKIIGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEV 304

Query: 330 VVLDQLAVVQTCLNFAEESNIVTEPACGAAL--------HLGYHPEI 368
           V+++   +     +  E++  + EP+   A+        HL  HPEI
Sbjct: 305 VLVNTDEICAGIKDIFEDTRSIVEPSGALAVAGMKKYVSHL--HPEI 349

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 60/161 (37%), Gaps = 17/161 (10%)

Query: 75  KTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPH 134
           KTP    V   + V      E+  K E FQ  G+FK RG  N + K  Q+ R        
Sbjct: 22  KTP----VLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQEQRAAG----- 72

Query: 135 VFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDY 194
           V                + LG+P T+V+P       V      GA+++         D Y
Sbjct: 73  VVAFSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIVRY-------DRY 125

Query: 195 LRS-ELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVE 234
               E +G    E+       P+D+P +  G  T   E++E
Sbjct: 126 TEDREQIGRALAEEKGLTLVPPYDHPDVIAGQGTAAKELIE 166

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 128/341 (37%), Gaps = 56/341 (16%)

Query: 75  KTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLI--WKEMQKIRQNSSLQ 132
           ++P+ R  F    +    N ++ LK E   P  SFK RG  N+I    ++QK       +
Sbjct: 72  ESPISRSEFLSSRL----NTDVQLKREDLLPVFSFKLRGAYNMISHLDDVQK-------K 120

Query: 133 PHVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESD 192
             V                + LG+P T+V+P +T     + +   GA+V+  G      D
Sbjct: 121 CGVIACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYG------D 174

Query: 193 DYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCS 252
           ++  +++  +   E+       PFD+P +  G  T+  E+     L+ +Q  S  G V  
Sbjct: 175 NFDAAKVECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEI-----LKQIQNSSKIGAVFC 229

Query: 253 XXXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTS 312
                          K   A  I V+ VET     LH S+        N      S    
Sbjct: 230 AVGGGGLIAGVGAYIKRA-APHIKVIGVETYDAATLHTSM-------QNNARTTLSQVGG 281

Query: 313 FV--TDLTLSYAQKYRTKSVVLDQLAVVQT---CL---NFAEESNIVTEPACGAALHLGY 364
           F   T + L   + +R    V+D++ +V T   C    +  E++  V EP+ GA    G 
Sbjct: 282 FADGTSVRLIGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPS-GALAVAGM 340

Query: 365 -------HPEILERELGPLTPQDVVIVIACGGSTMNLADLK 398
                  HPEI   E           V    G+ MN   L+
Sbjct: 341 KKYVNEIHPEIDHSE--------KTYVPVLSGANMNFDRLR 373

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 119/303 (39%), Gaps = 32/303 (10%)

Query: 75  KTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPH 134
           +TP+ R V    ++    N  + LK E   P  SFK RG  N+I K + + ++N+     
Sbjct: 69  ETPISRAV----SLSSRLNTNVKLKREDLLPVFSFKLRGAYNMIAK-LDETQKNAG---- 119

Query: 135 VFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDY 194
           V                  + +P T+V+P +T     + +   GA V+  G      DD+
Sbjct: 120 VIACSAGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYG------DDF 173

Query: 195 LRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLES-VKGIVCSX 253
             ++L      E+       PFD+P +  G  T+  E+     L+ VQ  S +  + C+ 
Sbjct: 174 DEAKLECARLAEERGMTDIPPFDHPYVIAGQGTIAMEI-----LRQVQNGSNIGAVFCAV 228

Query: 254 XXXXXXXXXXXXXEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSM-NPKSVATSLCTS 312
                        ++  +A  I V+ VET     L  SL  G+   + +  + A      
Sbjct: 229 GGGGLISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVR 286

Query: 313 FVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLG-------YH 365
            + + T    Q    + ++++   +     +  E++  + EP+ GA    G        H
Sbjct: 287 LIGEETFRVCQDVVDEVILVNTDEICAAVKDVFEDTRSIVEPS-GALAVAGLKKYVSQLH 345

Query: 366 PEI 368
           PEI
Sbjct: 346 PEI 348

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 109/290 (37%), Gaps = 38/290 (13%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N+I K +   ++N      V                R
Sbjct: 87  NTNVQLKREDLLPVFSFKLRGAYNMIAK-LDDTQRNQG----VIACSAGNHAQGVAYAAR 141

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P +T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 142 HLDIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP---- 197

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E++  ++        +  +                 ++  
Sbjct: 198 ----PFDHPYVIAGQGTVAMEILRQVY----NSNKIGAVFVPVGGGGLIAGVGAYLKR-- 247

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTKSV 330
           +   I ++ VET     LH S  L RN   N  SV T       T + +   + +R    
Sbjct: 248 VTPHIKIIGVETHDAATLHTS--LQRNKRTNLASVGTFADG---TSVRIIGEETFRVARE 302

Query: 331 VLDQLAVVQT------CLNFAEESNIVTEPACGAALH------LGYHPEI 368
           V+D++ +V T        +  E++  + EP+   A+          HPEI
Sbjct: 303 VVDEIVLVNTDEICAAVKDVFEDTRSIVEPSGALAVAGMKKYITQLHPEI 352

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 116/301 (38%), Gaps = 31/301 (10%)

Query: 95  EIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXRQL 154
           +I  K E FQ  G+FK RG  N + K   + R        V                + L
Sbjct: 38  QIYFKGENFQRVGAFKFRGAMNAVSKLSDEKRSKG-----VIAFSSGNHAQAIALSAKLL 92

Query: 155 GLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLRSELMGNVNLEKVAPIYAH 214
            +P T+V+PE      V      GA +I      ++ +   R +L        +      
Sbjct: 93  NVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTEDREQIGR-QLAAEHGFALIP----- 146

Query: 215 PFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHGLADS 274
           P+D+P +  G  T   E++E +     QL+++                        L+  
Sbjct: 147 PYDHPDVIAGQGTSAKELLEEVG----QLDAL-----FVPLGGGGLLSGSALAARSLSPG 197

Query: 275 IPVVAVETEGCEVLHRSLLLGRNVSMN-PKSVATSLCTSFVTDLTLSYAQKYRTKSVVLD 333
             +  VE E      +S   G  V +N PK++A    T  + + T +  ++     + + 
Sbjct: 198 CKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQHLGEYTFAIIRENVDDILTVS 257

Query: 334 QLAVVQTCLNF-AEESNIVTEP-ACGAALHLGYHPEILERELGPLTPQDVVIVIACGGST 391
              +V+ C++F AE   +V EP AC     LG+   +L++E   L  + V I+++ G   
Sbjct: 258 DQELVK-CMHFLAERMKVVVEPTAC-----LGFAGALLKKE--ELVGKKVGIILSGGNVD 309

Query: 392 M 392
           M
Sbjct: 310 M 310

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 104/290 (35%), Gaps = 38/290 (13%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N+I K       +S     V                +
Sbjct: 86  NTNVQLKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAK 140

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P +T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 141 HLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIP---- 196

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E++  +H       + K                       
Sbjct: 197 ----PFDHPYVIAGQGTVAMEILRQVH------NANKIGAVFVPVGGGGLVAGVGAYLKR 246

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTKSV 330
           +A  I ++ VET     L  SL  GR     P SV         T + L   + +R    
Sbjct: 247 IAPHIKIIGVETHDAATLQTSLKHGRR---TPLSVVGPFADG--TSVRLIGEETFRVAQE 301

Query: 331 VLDQLAVVQT------CLNFAEESNIVTEP--ACGAALHLGY----HPEI 368
           V+D++ +V T        +  E++  + EP  A   A    Y    HPEI
Sbjct: 302 VVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSVAGMKKYITTLHPEI 351

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/286 (20%), Positives = 108/286 (37%), Gaps = 30/286 (10%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N++ K       +S     V                +
Sbjct: 82  NTNVQLKREDLLPVFSFKLRGAYNMMAK-----LDDSQKNQGVIACSAGNHAQGIAYAAK 136

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P +T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 137 HLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTNIP---- 192

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E++  +H    +   +  +                 ++  
Sbjct: 193 ----PFDHPYVIAGQGTVAMEILRQVH----KANKIGAVFVPVGGGGLIAGVGAYLKR-- 242

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSLCTSFVTDLTLSYAQKYRTKS 329
           +A  I ++ VET     L+ SL  G+ V ++   + A       + + T    Q+   + 
Sbjct: 243 IAPHIKIIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEV 302

Query: 330 VVLDQLAVVQTCLNFAEESNIVTEPACGAALHLG-------YHPEI 368
           V+++   +     +  E++  + EP+ GA    G        HPEI
Sbjct: 303 VLVNTDEICAAVKDVFEDTRSIVEPS-GALSVAGMKKYVSTLHPEI 347

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 108/286 (37%), Gaps = 30/286 (10%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N+I     K+ +N   Q  V                R
Sbjct: 85  NTNVQLKREDLLPVFSFKLRGAYNMI----AKLDENQKNQG-VIACSAGNHAQGVAYAAR 139

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            + +P T+V+P +T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 140 HMNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP---- 195

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK-GIVCSXXXXXXXXXXXXXXEKH 269
               PFD+P +  G  T+  E++  +H       S+K G V                 K 
Sbjct: 196 ----PFDHPYVIAGQGTVAMEILRQVH------NSLKIGAVFVPVGGGGLIAGIGAYLKR 245

Query: 270 GLADSIPVVAVETEGCEVLHRSLLLG-RNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTK 328
            +A  I +V VET     L  S+  G R +     S A       + + T   +Q+   +
Sbjct: 246 -IAPHIKIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDE 304

Query: 329 SVVLDQLAVVQTCLNFAEESNIVTEP--ACGAALHLGY----HPEI 368
            V+++   +     +  E++  + EP  A   A    Y    HPEI
Sbjct: 305 IVLVNTDEICAAVKDIFEDTRSIIEPSGALSVAGMKKYITQIHPEI 350

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 105/285 (36%), Gaps = 28/285 (9%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N+I K       +S     V                +
Sbjct: 85  NTNVQLKREDLLPVFSFKLRGAYNMIAK-----LDDSQKNQGVIACSAGNHAQGVAFAAK 139

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            + +P T+V+P +T     + +   G+ V+  G+   E+       SE  G  N+     
Sbjct: 140 HMSIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTRLSEERGLTNIP---- 195

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E+     L+ V+  +  G V                 K  
Sbjct: 196 ----PFDHPYVIAGQGTVAMEI-----LRQVRNSAKIGAVFVPCGGGGLVAGIGAYLKR- 245

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSM-NPKSVATSLCTSFVTDLTLSYAQKYRTKS 329
           +A  I ++ VET     LH SL  G+   + +  + A       + + T   AQ    + 
Sbjct: 246 IAPHIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEV 305

Query: 330 VVLDQLAVVQTCLNFAEESNIVTEPACGAALH------LGYHPEI 368
           V++    +     +  E++  + EP+   A+          HPEI
Sbjct: 306 VLVGTDEICAAIKDIFEDTRGIVEPSGALAVAGMKKYVTQLHPEI 350

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 109/290 (37%), Gaps = 38/290 (13%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  ++LK E   P  SFK RG  N+I K       +S     V                +
Sbjct: 92  NTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAK 146

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P  T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 147 HLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP---- 202

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E+     L+ V+  +  G V                 K  
Sbjct: 203 ----PFDHPYVIAGQGTVAMEI-----LRQVRTANKIGAVFVPVGGGGLIAGIGAYLKR- 252

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTKSV 330
           +A  I V+ VET     LH S  L RN    P  V  +      T + +   + +R    
Sbjct: 253 VAPHIKVIGVETYDAATLHNS--LQRN-QRTPLPVVGTFADG--TSVRMIGEETFRVAQQ 307

Query: 331 VLDQLAVVQT------CLNFAEESNIVTEPA-----CGAALHLG-YHPEI 368
           V+D++ +V T        +  E++  + EP+      G   ++   HPEI
Sbjct: 308 VVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSVAGMKKYISTVHPEI 357

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 109/290 (37%), Gaps = 38/290 (13%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  ++LK E   P  SFK RG  N+I K       +S     V                +
Sbjct: 92  NTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAK 146

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P  T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 147 HLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP---- 202

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E+     L+ V+  +  G V                 K  
Sbjct: 203 ----PFDHPYVIAGQGTVAMEI-----LRQVRTANKIGAVFVPVGGGGLIAGIGAYLKR- 252

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTKSV 330
           +A  I V+ VET     LH S  L RN    P  V  S      T + +   + +R    
Sbjct: 253 VAPHIKVIGVETFDAPTLHNS--LQRN-QRTPLPVVGSFADG--TSVRMIGEETFRVAQQ 307

Query: 331 VLDQLAVVQT------CLNFAEESNIVTEPA-----CGAALHLG-YHPEI 368
           V+D++ +V T        +  E++  + EP+      G   ++   HPEI
Sbjct: 308 VVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSVAGMKKYISTVHPEI 357

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 106/285 (37%), Gaps = 28/285 (9%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  ++LK E   P  SFK RG  N+I K       +S     V                +
Sbjct: 92  NTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAK 146

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P  T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 147 HLKIPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTKLAEERGLTNIP---- 202

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E+     L+ V+  +  G V                 K  
Sbjct: 203 ----PFDHPYVIAGQGTVAMEI-----LRQVRTVNKIGAVFVPVGGGGLIAGIGAYLKR- 252

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVATSLCTSFVTDLTLSYAQKYRTKS 329
           +A  I V+ VET     LH SL   +   +    + A       + + T   AQ+   + 
Sbjct: 253 IAPHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEV 312

Query: 330 VVLDQLAVVQTCLNFAEESNIVTEPA-----CGAALHLG-YHPEI 368
           V+++   +     +  E++  + EP+      G   ++   HPEI
Sbjct: 313 VLVNTDEICAAVKDVFEDTRSIVEPSGALSVAGMKKYISTVHPEI 357

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 109/290 (37%), Gaps = 38/290 (13%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  ++LK E   P  SFK RG  N+I K       +S     V                +
Sbjct: 92  NTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAK 146

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P T+V+P  T     + +   G+ V+  G+   E+       +E  G  N+     
Sbjct: 147 HLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIP---- 202

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKGIVCSXXXXXXXXXXXXXXEKHG 270
               PFD+P +  G  T+  E+     L+ V+  +  G V                 K  
Sbjct: 203 ----PFDHPYVIAGQGTVAMEI-----LRQVRTANKIGAVFVPVGGGGLIAGIGAYLKR- 252

Query: 271 LADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKSVATSLCTSFVTDLTLSYAQKYRTKSV 330
           +A  I ++ VET     LH S  L RN    P  V  +      T + +   + +R    
Sbjct: 253 VAPHIKIIGVETYDAATLHNS--LQRN-QRTPLPVVGTFADG--TSVRMIGEETFRVAQQ 307

Query: 331 VLDQLAVVQT------CLNFAEESNIVTEPA-----CGAALHLG-YHPEI 368
           V+D++ +V T        +  E++  + EP+      G   ++   HPEI
Sbjct: 308 VVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSVAGMKKYISTVHPEI 357

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 58/147 (39%), Gaps = 15/147 (10%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N++ K + + ++N      V                R
Sbjct: 89  NTNVQLKREDLLPVFSFKLRGAYNMMAK-LSEAQKNQG----VIACSAGNHAQGVAFASR 143

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDDYLR--SELMGNVNLEKVAP 210
            L +P  +V+P  T     + +   G  V+  G+   E+       SE  G  N+     
Sbjct: 144 HLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKTECTRISEERGLTNIP---- 199

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALH 237
               PFD+P +  G  T+  E++  +H
Sbjct: 200 ----PFDHPYVIAGQGTVAMEILRQVH 222

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 57/147 (38%), Gaps = 15/147 (10%)

Query: 93  NPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQPHVFXXXXXXXXXXXXXXXR 152
           N  + LK E   P  SFK RG  N+    M K+ +       V                R
Sbjct: 78  NTNVQLKREDLLPVFSFKLRGAYNM----MAKLAEGQG-NKGVIACSAGNHAQGVAFASR 132

Query: 153 QLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESD-DYLR-SELMGNVNLEKVAP 210
            L +P  +V+P  T     + +   G  V+  G+   E+  +  R SE  G  N+     
Sbjct: 133 HLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKIECARISEERGLTNIP---- 188

Query: 211 IYAHPFDNPLIWEGHATMVDEVVEALH 237
               PFD+P +  G  T+  E++  +H
Sbjct: 189 ----PFDHPYVIAGQGTVAMEILRQVH 211

>KLTH0H10846g Chr8 (931560..932609) [1050 bp, 349 aa] {ON} similar
           to uniprot|P53206 Saccharomyces cerevisiae YGR012W
           Hypothetical ORF
          Length = 349

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 67/180 (37%), Gaps = 11/180 (6%)

Query: 75  KTPLMR-HVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNSSLQP 133
           KTPL++ +  +++  R      I  K EF  P GS K R    LI +  +  + + S   
Sbjct: 18  KTPLIKLNTLSKELGR-----NIFGKAEFQNPGGSVKDRAALYLIEQAEKSGQIDPSRPA 72

Query: 134 HVFXXXXXXXXXXXXXXXRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLKESDD 193
            +                R  G      +P T     +  ++  GA+V  +  V   SD 
Sbjct: 73  TIVEGSAGNTAIGLAHIARSKGYKSIFYMPNTQSVSKINLLKYLGAEVYPV-PVCPISDP 131

Query: 194 YLRSELMGNVNLEKVAPIYAHPFDNPLIWEGH-ATMVDEVVEALHLQGVQLESVKGIVCS 252
              +    +        I+   FDNP  W+ H AT   E+++ L   G+   S     CS
Sbjct: 132 MNFNNRARDHAKRLDNAIWTDQFDNPANWKSHYATTGPEILQQLQSAGL---SCDAFTCS 188

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,316,532
Number of extensions: 1474982
Number of successful extensions: 3745
Number of sequences better than 10.0: 56
Number of HSP's gapped: 3706
Number of HSP's successfully gapped: 56
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)