Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR746C1.4ON44144122060.0
KLLA0C00462g1.4ON460118800.26
CAGL0D00264g7.7ON403111790.30
KLTH0D01892g7.60ON451165704.6
NOTE: 18 genes in the same pillar as AFR746C were not hit in these BLAST results
LIST: Kpol_2002.7 ZYRO0F18502g Skud_3.2 Smik_3.13 YCL063W NCAS0B09120 TBLA0A07580 KAFR0D00120 Suva_3.151 KLTH0F00462g Kwal_33.13003 TDEL0C06980 Ecym_1007 KNAG0C00190 TPHA0E04020 NDAI0A00130 CAGL0B00308g SAKL0C00440g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR746C
         (441 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR746C Chr6 complement(1806243..1807568) [1326 bp, 441 aa] {ON}...   854   0.0  
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    35   0.26 
CAGL0D00264g Chr4 complement(31657..32868) [1212 bp, 403 aa] {ON...    35   0.30 
KLTH0D01892g Chr4 complement(185319..186674) [1356 bp, 451 aa] {...    32   4.6  

>AFR746C Chr6 complement(1806243..1807568) [1326 bp, 441 aa] {ON}
           NOHBY669; No homolog in Saccharomyces cerevisiae
          Length = 441

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/441 (93%), Positives = 414/441 (93%)

Query: 1   MDELQRTVLALQTRSDELVLQLRSSVVECERVGRAEICGCAVRAALAEGICDGAMCEARR 60
           MDELQRTVLALQTRSDELVLQLRSSVVECERVGRAEICGCAVRAALAEGICDGAMCEARR
Sbjct: 1   MDELQRTVLALQTRSDELVLQLRSSVVECERVGRAEICGCAVRAALAEGICDGAMCEARR 60

Query: 61  WEFYALLMQLTSLRVRVEHISGTVRGMLRRGEWNLQAVRKQFEMLDALSDELDGLVMGST 120
           WEFYALLMQLTSLRVRVEHISGTVRGMLRRGEWNLQAVRKQFEMLDALSDELDGLVMGST
Sbjct: 61  WEFYALLMQLTSLRVRVEHISGTVRGMLRRGEWNLQAVRKQFEMLDALSDELDGLVMGST 120

Query: 121 PCSGLEPQGHQXXXXXXXXXXXXXXSAFSSRSELVSNRGDHQAVLRGETDRARGTRIREI 180
           PCSGLEPQGHQ              SAFSSRSELVSNRGDHQAVLRGETDRARGTRIREI
Sbjct: 121 PCSGLEPQGHQLEYLELKQLELLRLSAFSSRSELVSNRGDHQAVLRGETDRARGTRIREI 180

Query: 181 AGDGRKLQNSRAPELVPGRVIPSNTSYDSSSLFRRSLDGHLSELFDISYHSDEETVVSIN 240
           AGDGRKLQNSRAPELVPGRVIPSNTSYDSSSLFRRSLDGHLSELFDISYHSDEETVVSIN
Sbjct: 181 AGDGRKLQNSRAPELVPGRVIPSNTSYDSSSLFRRSLDGHLSELFDISYHSDEETVVSIN 240

Query: 241 QQHLGDLSSVISPKERNTTYPKTQDLSIGGQNFPPFRDQYPIXXXXXXXXXXXXXVTYCS 300
           QQHLGDLSSVISPKERNTTYPKTQDLSIGGQNFPPFRDQYPI             VTYCS
Sbjct: 241 QQHLGDLSSVISPKERNTTYPKTQDLSIGGQNFPPFRDQYPITTSSAATSNSTAAVTYCS 300

Query: 301 VQSSFGENSRLDKLSVTHGFLKSLAGHAMDDRQKGSARFMNGQFIPNISHFFRRWKIFSH 360
           VQSSFGENSRLDKLSVTHGFLKSLAGHAMDDRQKGSARFMNGQFIPNISHFFRRWKIFSH
Sbjct: 301 VQSSFGENSRLDKLSVTHGFLKSLAGHAMDDRQKGSARFMNGQFIPNISHFFRRWKIFSH 360

Query: 361 QSMNVSEPCTTQPFASVDKSDIRSLHNQDMASQDSTRKFSTVTEDSFCSEDAYSGPSIKV 420
           QSMNVSEPCTTQPFASVDKSDIRSLHNQDMASQDSTRKFSTVTEDSFCSEDAYSGPSIKV
Sbjct: 361 QSMNVSEPCTTQPFASVDKSDIRSLHNQDMASQDSTRKFSTVTEDSFCSEDAYSGPSIKV 420

Query: 421 TMTPVLYEYLKEALETELRFN 441
           TMTPVLYEYLKEALETELRFN
Sbjct: 421 TMTPVLYEYLKEALETELRFN 441

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 55/118 (46%), Gaps = 20/118 (16%)

Query: 1   MDELQRTVLALQTRSDELVLQLRSSVVECERVGRAEICGCAVRAALAEGICDGAMCEARR 60
           M++++     L  R +E V+QL                  +++  + E   + + C  + 
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLE----------------LSIQRKMCEFDPNNSHCFIQV 44

Query: 61  WEFYALLMQLTSLRVRVEHISGTVRGMLRRGEWNLQAVRKQFEMLDALSDELDGLVMG 118
            E+Y+ L +L+SL++R EH+  ++R   +R + N   +  ++E L+ L  E   + M 
Sbjct: 45  QEYYSFLARLSSLKLRAEHVQESLRH--QRKDPNDVCI--EYETLEKLIYEFQDITMS 98

>CAGL0D00264g Chr4 complement(31657..32868) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|P36047 Saccharomyces
           cerevisiae YKL193c SDS22
          Length = 403

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 56/111 (50%), Gaps = 15/111 (13%)

Query: 19  VLQLRSSVVE-CERVGRAEICGCAVRAALAEGICDGAMCEARRWEFYALLMQLTSLRVRV 77
           ++QL+   ++ C+ +   +IC   +       IC+GA+C+  +WE++   +++    +++
Sbjct: 266 LMQLKELHIDACKCLREWKICPPHIEVF---EICNGAICDIPKWEYFPPNLKI----LKI 318

Query: 78  EHISGTVRGMLRRGEWNLQAVRKQFEMLDALSDELDGL--VMGSTPCSGLE 126
            +ISG     LR    NL  +    + LD   ++L  L  ++ + P + L+
Sbjct: 319 SNISG-----LRELPSNLYQIIPTVQRLDLTDNDLHDLKNILRAIPTTQLK 364

>KLTH0D01892g Chr4 complement(185319..186674) [1356 bp, 451 aa] {ON}
           similar to uniprot|P28004 Saccharomyces cerevisiae
           YAL032C PRP45 Ortholog of human transcriptional
           coactivator SKIP can activate transcription of a
           reporter gene interacts with splicing factors Prp22p and
           Prp46p
          Length = 451

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 69/165 (41%), Gaps = 27/165 (16%)

Query: 244 LGDLSSVISPKERNTTYPKTQDLSIGGQNFPPFRDQYPIXXXXXXXXXXXXXVTYCSVQS 303
           +G LS   +P+E   +    Q+ S+  ++F P R +YP              ++   +Q+
Sbjct: 32  VGLLSEAGNPRETLYSVESFQENSVTLESFLPLRHKYP--------DLKIPQISQSDIQN 83

Query: 304 SFGENSRLDKLSVTHGFLKSLAGHAMDDRQKGSARFMNGQFIPNISHFFRRWKIFSHQ-- 361
           ++ E ++     +    L+     A+    KGSA+ +  + +P+ +   R+ KI   Q  
Sbjct: 84  TY-ERTKAVFDKILSQKLQPQGTGAVGTANKGSAKTIEYK-LPDQNSEVRKLKIVDQQVD 141

Query: 362 --------SMNVSEPCTTQPFASVDKSDIRSLHNQDMASQDSTRK 398
                   +  V  P T +PFA V       LH  D  +  ST++
Sbjct: 142 PLQPKLFKTKKVVAPSTDEPFAPV-------LHKSDDITPQSTKE 179

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,251,069
Number of extensions: 1537478
Number of successful extensions: 4259
Number of sequences better than 10.0: 7
Number of HSP's gapped: 4380
Number of HSP's successfully gapped: 7
Length of query: 441
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 328
Effective length of database: 40,524,141
Effective search space: 13291918248
Effective search space used: 13291918248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)