Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR745W1.5ON1018101847530.0
SAKL0C00462g1.5ON11773716926e-75
Ecym_10081.5ON11184376552e-70
KAFR0D001401.5ON104111196523e-70
KLLA0C00484g1.5ON9253146131e-65
Suva_3.1521.5ON11403865961e-62
Skud_3.31.5ON11524225791e-60
Smik_3.141.5ON11134765791e-60
KNAG0C002201.5ON11613325702e-59
YCL061C (MRC1)1.5ON10963845532e-57
CAGL0B00330g1.5ON11363305425e-56
ZYRO0F18480g1.5ON9603185405e-56
NDAI0A001401.5ON10913405203e-53
TPHA0E040101.5ON9653585121e-52
Kpol_2002.81.5ON9853605085e-52
NCAS0B091101.5ON10203485078e-52
TDEL0C069701.5ON9413474915e-50
Kwal_33.130051.5ON9704564578e-46
KLTH0F00484g1.5ON9933074552e-45
TBLA0A075701.5ON12523634143e-40
KLLA0C02783g1.104ON798104860.16
TPHA0B008304.238ON2536119736.4
AER153W4.344ON74870736.4
AER237W5.279ON15235689.1
NCAS0B074801.313ON24557709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR745W
         (1018 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...  1835   0.0  
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   271   6e-75
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   256   2e-70
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   255   3e-70
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   240   1e-65
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   234   1e-62
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   227   1e-60
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   227   1e-60
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   224   2e-59
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   217   2e-57
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   213   5e-56
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   212   5e-56
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   204   3e-53
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   201   1e-52
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   200   5e-52
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   199   8e-52
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   193   5e-50
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   180   8e-46
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   179   2e-45
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   164   3e-40
KLLA0C02783g Chr3 (250633..253029) [2397 bp, 798 aa] {ON} simila...    38   0.16 
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    33   6.4  
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    33   6.4  
AER237W Chr5 (1076625..1077083) [459 bp, 152 aa] {ON} Syntenic h...    31   9.1  
NCAS0B07480 Chr2 (1409664..1410401) [738 bp, 245 aa] {ON} Anc_1....    32   9.5  

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score = 1835 bits (4753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 921/1018 (90%), Positives = 921/1018 (90%)

Query: 1    MELLDGLCVSARKKTTYKKVRLGIAEQSKDEPSSNKPAAVFRSSLLDRVRTRLNVEDGHA 60
            MELLDGLCVSARKKTTYKKVRLGIAEQSKDEPSSNKPAAVFRSSLLDRVRTRLNVEDGHA
Sbjct: 1    MELLDGLCVSARKKTTYKKVRLGIAEQSKDEPSSNKPAAVFRSSLLDRVRTRLNVEDGHA 60

Query: 61   PSSDALEPESGLTDDVYDGENLEVSFDVGDAEDDCLPTQADGKPEQIEVNVGTAPEEPFS 120
            PSSDALEPESGLTDDVYDGENLEVSFDVGDAEDDCLPTQADGKPEQIEVNVGTAPEEPFS
Sbjct: 61   PSSDALEPESGLTDDVYDGENLEVSFDVGDAEDDCLPTQADGKPEQIEVNVGTAPEEPFS 120

Query: 121  RIKIPLKLSDGGIFSPSTQVDDEMAMQLQPTQKLPPESPALQAVDTHTELQDELETGVAV 180
            RIKIPLKLSDGGIFSPSTQVDDEMAMQLQPTQKLPPESPALQAVDTHTELQDELETGVAV
Sbjct: 121  RIKIPLKLSDGGIFSPSTQVDDEMAMQLQPTQKLPPESPALQAVDTHTELQDELETGVAV 180

Query: 181  DGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATI 240
            DGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATI
Sbjct: 181  DGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATI 240

Query: 241  PDAQTLATARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQKLVFTKDNFLDSFD 300
            PDAQTLATARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQKLVFTKDNFLDSFD
Sbjct: 241  PDAQTLATARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQKLVFTKDNFLDSFD 300

Query: 301  DDSETEIHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSLSITSKSY 360
            DDSETEIHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSLSITSKSY
Sbjct: 301  DDSETEIHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSLSITSKSY 360

Query: 361  QEARQIILDESSEDDTDVNXXXXXXXXXXXXXXXRNSKFITPQKIDETKSSKSNELFAKL 420
            QEARQIILDESSEDDTDVN               RNSKFITPQKIDETKSSKSNELFAKL
Sbjct: 361  QEARQIILDESSEDDTDVNLSSAVSKAAVLAIKARNSKFITPQKIDETKSSKSNELFAKL 420

Query: 421  RKANREQLLEQRRNAIERRGINMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
            RKANREQLLEQRRNAIERRGINM                                     
Sbjct: 421  RKANREQLLEQRRNAIERRGINMQNLEQEREQLGNLLEQELERNRRIRIREKKIERERLE 480

Query: 481  XXXXXXTISSDDASSDEDVPESDAGSIADPGASSTEDEDSGLSSEIDSDMGEESDHSVVT 540
                  TISSDDASSDEDVPESDAGSIADPGASSTEDEDSGLSSEIDSDMGEESDHSVVT
Sbjct: 481  NENVELTISSDDASSDEDVPESDAGSIADPGASSTEDEDSGLSSEIDSDMGEESDHSVVT 540

Query: 541  KRRSRRILVQSDDEGTETTENRQAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSP 600
            KRRSRRILVQSDDEGTETTENRQAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSP
Sbjct: 541  KRRSRRILVQSDDEGTETTENRQAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSP 600

Query: 601  VKTTTSTPKGLTDGRAELDHESPDGHSLNTNLQQGLXXXXXXXXXXXXDELDQETRRKIL 660
            VKTTTSTPKGLTDGRAELDHESPDGHSLNTNLQQGL            DELDQETRRKIL
Sbjct: 601  VKTTTSTPKGLTDGRAELDHESPDGHSLNTNLQQGLSKSESSSTKVSEDELDQETRRKIL 660

Query: 661  SDLXXXXXXXXXXXXXXXXXMKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVE 720
            SDL                 MKKKGITKML          WHGIGGSDNELSEDYDSEVE
Sbjct: 661  SDLLARNRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVE 720

Query: 721  KMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENE 780
            KMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENE
Sbjct: 721  KMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENE 780

Query: 781  DQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDE 840
            DQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDE
Sbjct: 781  DQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDE 840

Query: 841  KTDPSAAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQN 900
            KTDPSAAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQN
Sbjct: 841  KTDPSAAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQN 900

Query: 901  SNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRI 960
            SNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRI
Sbjct: 901  SNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRI 960

Query: 961  LKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLFSEGNNRSFDT 1018
            LKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLFSEGNNRSFDT
Sbjct: 961  LKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLFSEGNNRSFDT 1018

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  271 bits (692), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 158/371 (42%), Positives = 233/371 (62%), Gaps = 38/371 (10%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            MK+KG++KM           WHG+GG+D ELS++YDSE+EKM+DDY+  + +   +R +L
Sbjct: 810  MKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQML 869

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
            A  ++++DE IVNKILHDI  GGFRRRGKGALD+E+S++ED ELQ++  KRRELL+QK+L
Sbjct: 870  AAEDKEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQRYHAKRRELLRQKVL 929

Query: 801  ENGDTSKLVSNPKSYAFFQTMVDDVTEA----SFGNTFDAN---IDEK----------TD 843
            ENG+ SKLVSNPKS+AFF++MV+D+ E+    S G T D +   I E           T 
Sbjct: 930  ENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAISENDKVDNASEHGTQ 989

Query: 844  PSAAG-------RKIVISEQFVKETLSFLSSK---SGDSEIPAETKSISSSTV--EREEI 891
            P A G       ++I IS++FV+ +LSFL+SK     + E+         ST+  + +++
Sbjct: 990  PDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDL 1049

Query: 892  QDLHTLKQNSNIKHLKGSLELPAQMAELS-SGDEGDYGFSLDRFRSAAKSFNNGTNVDDK 950
            +DL TLKQNS IK L       ++  +L   G+    GF L    S   SF++  ++++K
Sbjct: 1050 EDLFTLKQNSCIKTLHTPARTSSRTVDLEVDGNSPANGFKLP---SVISSFSSRIDINEK 1106

Query: 951  FKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLN----SSKRARSQ 1006
            FK GTK V++ K+ KTIGGS+A+IT++G+ R+L  PK      +P        +   R+ 
Sbjct: 1107 FKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRHPEAAPKRAG 1166

Query: 1007 LFSEGNNRSFD 1017
            LF++ N+ SF+
Sbjct: 1167 LFAD-NDDSFE 1176

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 180/722 (24%), Positives = 287/722 (39%), Gaps = 135/722 (18%)

Query: 1   MELLDGLC---VSARKKTTY-KKVRLGIAEQSKDE----PSSNKPAAVF-RSSLLDRVRT 51
           M+ LD L       +KKTTY K + +   ++  DE    P  +  + +F  S+++D+V++
Sbjct: 1   MDFLDALGDLKHPKKKKTTYVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKS 60

Query: 52  RLNV---EDGHAPSSDALEPESGLTDDVYDGENLEVSF----------DVGDAED-DC-- 95
           RLN    E+      DAL P++ +  + YDGE+LE  F          + G  +D DC  
Sbjct: 61  RLNGVSNEETDGERGDAL-PQTQVIPNYYDGEDLEQDFVSPPKPRRVSNTGHGQDCDCDS 119

Query: 96  ------LPTQADGKPEQIEVNVGTAPEEPFSRIKIPLKLSDG----GIFSPSTQVDDEMA 145
                 +PTQ  G  E   V V  AP +      IP+ ++DG     +F  S    DE+ 
Sbjct: 120 EEQTQLMPTQETGAYESQVVPV-IAPVQVSE--TIPVSINDGLLGESLFKTSK---DEVK 173

Query: 146 MQ--------LQPTQKLPPESPALQAVDTHTELQDELETGVAVDGRISLSQTQVIVSGTN 197
                      +P   L    P+ Q  ++    Q +LET  A + +  + +TQ I+  T 
Sbjct: 174 GNGGNTTRNLAEPCYGLTQIIPSPQYKNSQ---QMQLETQEAGETQ-EVDKTQRILEATA 229

Query: 198 YGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATIPDAQTLATARHEKLFIH 257
             PT  +++ VA        A     DT   D +   D Q T PD    A    ++L IH
Sbjct: 230 RDPTLSEEDFVAATVADGSEAVTTQLDTCVPDTSALGDVQPTAPDQS--AHRNSQRLLIH 287

Query: 258 QIEEEIATKTQKELPMMTQAKEAPYIPKQKLVFTKDNFLDSFDDDS-------------E 304
           +IE+++  + ++E   +T+AK    +   K  F K+ FL++FD  S             +
Sbjct: 288 EIEKDLDAEEERE-KRITEAKPHDVVLVVKKKFDKEAFLNNFDCSSSEGEEQEQEEQEEQ 346

Query: 305 TEIHGGLDGSDRQV---------SYNDREHTETGPQSSQPA------TGEGQDT-----Q 344
           T +        R++            D E   +G  +S  A      T EG+ T     +
Sbjct: 347 THLESEPASKRRKLFTSVPGNPLDSKDSEAGGSGNFASAIAATIGTTTDEGRSTRKDKEE 406

Query: 345 VLYPALQSLSITSKSYQEARQII-LDESSEDDTDVNXXXXXXXXXXXXXXXRNSKFITPQ 403
             +  L S     K+  ++++ I LD SS++D +                 R SK    Q
Sbjct: 407 AGWVPLNSYKNQLKARLDSKEHIDLDSSSDEDENSVPASKMSKAAVLEIKARTSKR---Q 463

Query: 404 KIDETKSSKS-------NELFAKLRKANREQLLEQRRNAIERRGINMXXXXXXXXXXXXX 456
            I +T+   S        ELF+ L+KAN++Q+L+ RR   E+RG+N+             
Sbjct: 464 GIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENL 523

Query: 457 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTISSDDASSDEDV---PESDAGSIADPGAS 513
                                             D   S+ ++   PES+  S    G+ 
Sbjct: 524 LEQEIERNRKIRLREKQREKKKELDEQQDGGYPGDFDYSENELDGEPESEPAS----GSE 579

Query: 514 STEDEDSGLSSEIDSDMGEES---------DHSVV---TKRRSRRIL------------- 548
              D D+  S  +D D  +ES         D ++V   +K+R++RI              
Sbjct: 580 DVPDSDAPDSDVLDEDSDDESREKDRDDEDDEAIVLPKSKKRAKRIANFGSGPGPDSDSD 639

Query: 549 VQSDDEGTETTENR--QAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSPVKTTTS 606
           + SD+E       R    I LG YG N+   D G       LTSRIK+   +   +T  S
Sbjct: 640 LGSDNEPISRNGPRPGNVIDLGAYGGNLANADAGLGHGVDGLTSRIKQIPGIRTPETLPS 699

Query: 607 TP 608
            P
Sbjct: 700 KP 701

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  256 bits (655), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 167/437 (38%), Positives = 248/437 (56%), Gaps = 22/437 (5%)

Query: 562  RQAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSPVKTTTSTPKGLTDGRAELDHE 621
            +  I LG YG+N+   + G      YLT RIKK++ LSP K+ T+      D +++L  E
Sbjct: 661  KNTIDLGAYGDNLNLGNAGLPNNDEYLTYRIKKFEGLSPSKSATTE----LDVKSDLAAE 716

Query: 622  SPDGHSL-NTNLQQGLXXXXXXXXXXXXDELDQETRRKILSDLXXXXXXXXXXXXXXXXX 680
            S    ++ + N +                E  +E +RKI+ +L                 
Sbjct: 717  SSILETIKDGNWRLKKSGEIETGEEEEPKEEGEEEKRKIVKELMLKLRLQEKIKRQKQKE 776

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            M+K G+ KM+          WHG+GG D E S++YDS+++KMIDDY+ +  +   +R IL
Sbjct: 777  MRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKIL 836

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
            A  + QHD+N+VNKILHDI TGGFR+RG+G LDLE+SE+ED  LQ +R KR    KQK+L
Sbjct: 837  ASEDLQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKML 896

Query: 801  ENGDTSKLVSNPKSYAFFQTMVDDVT---EASFGNTFDANIDEKTD----PSAAGRKIVI 853
            ++   + + SNPKS  FF++MVD+ T   E + G T D+   + T+         +KIVI
Sbjct: 897  DSEHNTSVKSNPKSLPFFESMVDEFTIPVERALG-TPDSPPAQSTNVLELKQNTKQKIVI 955

Query: 854  SEQFVKETLSFLSSKSGDSEIPAET---KSISSSTVEREEIQDLHTLKQNSNIKHLKGSL 910
            SE FVK+TLSFL+S    + + +E    K  + + +   E++DL+TLK+ S IK L    
Sbjct: 956  SEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYS 1015

Query: 911  ELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGS 970
              P    +    D  ++GF   +  S  ++F +  +V+DKFK G K+V+I    KT+G S
Sbjct: 1016 GKPIVNED---EDGAEFGF---KAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSS 1069

Query: 971  KAAITFIGRKRRLIPPK 987
            +AAITF+G+KR+LI PK
Sbjct: 1070 RAAITFLGKKRKLIIPK 1086

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 128/526 (24%), Positives = 222/526 (42%), Gaps = 107/526 (20%)

Query: 1   MELLDGLCVSARKKTTYKKVRLGIAEQSKD---EPSSNKPAAVFRSSLLDRVRTRLNVED 57
           M+LL+ L   AR+KTTYK     +++++     +PS+     VF ++++D+VR RL   +
Sbjct: 1   MDLLNLLPGKARRKTTYKIEHEKLSQEAGYIIIKPSN--AENVFANAIVDKVRNRL---E 55

Query: 58  GHAPSSDALEP-ESGLTDDV---YDGENLEVSFDVG-DAEDDCLPTQADGKPEQIEVNVG 112
           G   S D L+   S L++ V   YDGE LE  FD   D     +    +   E I+    
Sbjct: 56  GTISSPDRLDTLSSKLSETVGNLYDGEALEEDFDPNIDNSFKGMVNSYNVNFEHIKSKGT 115

Query: 113 TAPEEPFSRIKIPLKLSDGGIFSPSTQ-------VDDEMAM------------------- 146
                    I +P+KL +GGIF+  +          D ++                    
Sbjct: 116 MDHNRTIDAIPLPVKLDNGGIFASESNNHSLRDSKTDTISCNSLTSNHTQHARSSSGIHT 175

Query: 147 -QLQPTQKLPPESPALQAVDTHTELQDELETGVAVDGRIS-----------LSQTQVI-- 192
            QLQ TQK+  +  +     +       L+   A   RIS            +QTQ+I  
Sbjct: 176 AQLQETQKVITDVKSALFTSSSISSNSNLQKVKAT--RISAPNFNTNEDRGYTQTQIIKN 233

Query: 193 -------VSGTNYGPTRVDDEVVATQQDSMGTADAQCWDT--QTLDCALADDFQATIPD- 242
                   S T   P   DD+   +  ++ G  D+Q   T   TL+  L++  +AT+P+ 
Sbjct: 234 IQFDEGKYSETQLIPEITDDDDCRSLHNAQG-PDSQTLSTLADTLESKLSEKLRATVPNQ 292

Query: 243 AQTLATARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQKLVFTKDNFLDSFDDD 302
             + +  + E+L IH+ + ++  + + E   +T+     Y+  Q  +FTK+ FLD F   
Sbjct: 293 VISQSNKKKEELAIHKFQRDLG-EAEDENNKVTEHILPSYVALQNHIFTKEAFLDDF--- 348

Query: 303 SETEIHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSL--SITSKSY 360
              E+ G      ++V Y+          S+  ++    +T  +Y  L     +IT  +Y
Sbjct: 349 ---ELSG------QEVDYSSTATRVKETVSNDISSDVSSNTNAVYDNLTDNFGTITRDAY 399

Query: 361 QE----------------ARQIILDESSEDDTDVNXXXXXXXXXXXXXXXRNSKFITPQK 404
            E                 + IILD SS+++   N                N K    + 
Sbjct: 400 AEEAKPPLLPLQSMKNTVGQDIILDSSSDEEHASNQFATSTMVKAALL---NIKAKISKN 456

Query: 405 IDETKSSKSN-------ELFAKLRKANREQLLEQRRNAIERRGINM 443
           ++ +K+++ +       +LF  L+KAN++Q+L+ RR   E+RGI++
Sbjct: 457 MNLSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRGISL 502

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  255 bits (652), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 297/1119 (26%), Positives = 489/1119 (43%), Gaps = 199/1119 (17%)

Query: 4    LDGL-----CVSARKKTTYKKVRLGI----AEQSKDEPSSNKPAAVFRSSLLDRVRTRLN 54
            +DG+      +  +K+TTYKK+   +    +E + D P+      +F +  L+R++ RL+
Sbjct: 1    MDGIFGNLQALKPKKRTTYKKISDDLENDTSESNNDPPALTGEGFLFDNPTLNRIKKRLD 60

Query: 55   VEDGHAPSSDALEPESGLTDDVYDG-ENLEVSFDVGDAEDDCLPTQADGKPEQIEVNVGT 113
             E+           ++ L  ++Y G E+L+   +V   E   L  Q      Q+E+    
Sbjct: 61   GEEKDVVQYTMNFSQTQLISNLYGGGEDLDAP-EVERREKQQLHEQ------QLELTKKR 113

Query: 114  APE-EPFSRIKIPLKLSDGGIFSPSTQV--DDEMAMQLQPTQK-----LPPESPALQAVD 165
            A + +  +  K    ++D  +  P TQV    ++A +  P  +     +P  + + Q + 
Sbjct: 114  ASKGQLHAFTKSSGNINDLRLMQP-TQVIGSTQLAKEFSPVSRTYFKYVPDVNQSTQVI- 171

Query: 166  THTELQDELETGVAVDGRISLSQTQVIVSGTNYG--PTRVDDEVVATQQDSMGTADAQCW 223
             H+  QD+ +   A +     +Q   ++S +  G   T+    +  + Q    ++  Q +
Sbjct: 172  -HSATQDDTQVVSAREADTQATQMTQVLSASTQGIYNTQETQSITDSTQPISYSSSTQDY 230

Query: 224  ------------DTQTLDCALADDFQATIP-------------------DAQTLATARH- 251
                        DTQ +     DD  +T+P                   D+ T  T+   
Sbjct: 231  KTNKFNRHPTPEDTQIIPREFDDD-ASTLPIPEGDKTQKDTSAVLKTQIDSTTEGTSYSA 289

Query: 252  ---EKLFIHQIEEEIA-TKTQKELPMMTQAKEAPYIPKQKLVFTKDNFLDSFD-DDSETE 306
               + L IH+I+ E+  ++  K +P   + K+    PK  +VFTK+++ D FD DD E E
Sbjct: 290  TVSDTLKIHEIQRELEESQKTKTIP---EYKQHVRTPKNVIVFTKESYFDEFDSDDEEKE 346

Query: 307  IHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSLS----ITSKSYQE 362
             +   +G  ++V               +    + + +    P L  L+       +    
Sbjct: 347  ENLESEGDSQKVQLLKNTSPSDKSNDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNS 406

Query: 363  ARQIILDESSEDDTDVNXX------XXXXXXXXXXXXXRNSKFITPQKIDETKSSKSNEL 416
             +QI L+  S+D+  ++                     R SK     KI     +  + L
Sbjct: 407  DQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTL 466

Query: 417  FAKLRKANREQLLEQRRNAIERRGINMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 476
            F KL+KA+R+Q++E ++  IE++G+N+                                 
Sbjct: 467  FNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREK 526

Query: 477  XXXXXXXXXXTISSDDASSDEDVPESDAGSIADPGASSTEDEDSGLSSE---IDSDMGEE 533
                           DA  DE+  + D         S+ E ++S LS E   IDSD  + 
Sbjct: 527  QLA------------DAQDDENDLDFD--------HSANELDESELSGEESAIDSD-NDY 565

Query: 534  SDHSV-VTKRRSRRILVQSDDEGTE-----------------TTENRQAIHLGVYGNNIK 575
             D S+  TKR  ++++V+  D   E                   +NR AI+LG YG+N+ 
Sbjct: 566  DDFSLEKTKRSKKKVIVEDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPYGDNLS 625

Query: 576  PQDTGPEARGSYLTSRIKKYDDLSPVKTTTSTPKGLTDGRAELDHESPDGHSLNTNLQQG 635
                                  L+P++ TT               E   G +   + + G
Sbjct: 626  ----------------------LAPIRITT---------------EKQSGKNFKVSRESG 648

Query: 636  LXXXXXXXXXXXXDELDQETRRKILSDLXXXXXXXXXXXXXXXXXMKKKGITKMLXXXXX 695
                         +E+ ++ R +++ +                  MK KGIT  L     
Sbjct: 649  ---------DERDEEIPEKDRIRLIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAE 699

Query: 696  XXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKI 755
                 WHGIGG D E+S++YDSEVEKMIDDYS  + N D +R +LA   ++ D  +V KI
Sbjct: 700  ESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKI 759

Query: 756  LHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSY 815
            L+DI  GGFR+R KGA+DLE+S+ ED EL+Q+R KRREL++QK LE G+   LV NPKS 
Sbjct: 760  LYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSK 819

Query: 816  AFFQTMVDDVTE-----ASF------------GNTFDANIDEKTDPSAAGRKIVISEQFV 858
            AFF++MVDD+ E     A F            G   +AN +E        +K+++SE+FV
Sbjct: 820  AFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFV 879

Query: 859  KETLSFL-SSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLELPAQMA 917
            + TLSFL SSK  D   PA +    ++    E I+DL  LK+ S+IK  K +    +Q  
Sbjct: 880  QRTLSFLNSSKDMDQFAPARSMRAEAND---ELIEDLTALKKQSSIKSFKTTRASVSQ-- 934

Query: 918  ELSSGD-EGDYGF-----SLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSK 971
            E +  D E D  F     S     S  K+F+   +++DKF+ G K V++ KA K++  SK
Sbjct: 935  EPTDFDKENDDSFDDLLNSRVGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSK 994

Query: 972  AAITFIGRKRRLIPPKNDYKD-SEPKLNSSKRARSQLFS 1009
            A+IT++G+ R+L+ P+    + S   + ++    S+LFS
Sbjct: 995  ASITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFS 1033

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score =  240 bits (613), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 202/314 (64%), Gaps = 29/314 (9%)

Query: 681 MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
           +K  G+ K+L          WHG+GG+D E S+DYDS+++ MIDD+S    +   +R  L
Sbjct: 610 LKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERL 669

Query: 741 AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
           A   ++ DE ++NKILHDI+TGGFR+RG+GALDLE+S++ED+ L+QFR+KRRE++KQK+L
Sbjct: 670 ALENKEMDERMINKILHDINTGGFRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLL 729

Query: 801 ENGDTSKLVSNPKSYAFFQTMVDDVTE------ASFGNTFDANIDEKTDPSAAGRKIVIS 854
           EN D   +V+N KS AFF +MV+D+T        SF NT D             +KIVIS
Sbjct: 730 ENVDG--VVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTRD---------EMGKKKIVIS 778

Query: 855 EQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLELPA 914
           E+FV+ +LSFLS+K  D      T++   +T      +DL +LKQ SNIK    SL+ P 
Sbjct: 779 EEFVQSSLSFLSAKDDDINEFEVTEAAHDAT------EDLESLKQRSNIK----SLDSPQ 828

Query: 915 QMAELSSGDEGDYGFSLD-RFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAA 973
           +    +  D+ D G SLD +  S  KSF++ ++V+DKFK+G K V I K+ +   GS++A
Sbjct: 829 RNRNSAFFDDVD-GTSLDFKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSA 887

Query: 974 ITFIGRKRRLIPPK 987
           ITF+G+KR+L  P+
Sbjct: 888 ITFLGKKRKLKAPQ 901

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 74/328 (22%), Positives = 121/328 (36%), Gaps = 63/328 (19%)

Query: 169 ELQDELET-----GVAVDGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSM---GTADA 220
           EL DE E       V     + + Q +  +S T   PT     +  TQ ++    GT   
Sbjct: 82  ELDDEFEAMRETAAVPKQREVEIQQKKHPISQTQLIPTFSSSWLAKTQVNTQALEGTNRT 141

Query: 221 QCWDTQTLDCALADD-FQATIPDAQTLATARHEKLFIH---------------------- 257
                Q LD  L ++    T PD  TL  A  E   +H                      
Sbjct: 142 IDRQQQDLDTQLNNEEITQTTPDEHTLDKAATESKLLHSKETSFRNTSFTFKLTTNNNEG 201

Query: 258 ---------QIEEE---IATK-----TQKELPMMTQAKEAPYIPKQKLV-----FTKDNF 295
                    QIE E   +AT+      +K +P++    E P++P   L      +  + F
Sbjct: 202 LLATKPNGTQIENEQKVVATQLDVAEKEKAVPLIKDTIEEPHLPVAPLKAVRKKYLPEQF 261

Query: 296 LDSFDDDSETEIHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSLSI 355
           + +FDD   +E     D SD +   ND +  +    + +  T +     V+      ++I
Sbjct: 262 IAAFDD---SESSNAEDLSDEE---NDADELKDMASTQELVTKQ---KSVVTNMNGIIAI 312

Query: 356 TSKSYQEARQIILDESSEDDTDVNXXXXXXXXXXXXXXXRNSKFITPQKIDETKSSKSNE 415
           T K+  +   I L+ SSE + D                   +K    + +  +      E
Sbjct: 313 TMKNSPQ-NVIELNSSSESEDDYKSQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKE 371

Query: 416 LFAKLRKANREQLLEQRRNAIERRGINM 443
           LF  L+  NR+Q+LE RR    ++GI++
Sbjct: 372 LFTSLKTKNRDQILEFRREISGKKGISL 399

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  234 bits (596), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 149/386 (38%), Positives = 222/386 (57%), Gaps = 52/386 (13%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            +K KG+T             WHG+GG+D E S++YDSEVEKMIDDYS +  N+  +R +L
Sbjct: 759  LKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREML 818

Query: 741  AKNERQHDENIVNKILHDISTGGFR-RRGKGALDLEMSENEDQELQQFRQKRRELLKQKI 799
            A   ++ D  ++NKIL+DI  GGFR +R K +L+LE+S++ED  LQQ+R KRREL++++ 
Sbjct: 819  AAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRR 878

Query: 800  LENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDEKTDPSAAG----------- 848
            LE GD +KLV NPKS AFF++MV+D+ E  F N F A  +   D ++             
Sbjct: 879  LEIGDDTKLVKNPKSKAFFESMVEDIME--FKNPFGAEKESDQDVTSTATDLDTQDNDNT 936

Query: 849  -------------------RKIVISEQFVKETLSFLSSKSGDS-EIPAETKSISSSTVER 888
                               +K++ISE FV+++LSFL S + D  E+  E   I     E 
Sbjct: 937  KPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNGEG 996

Query: 889  EEIQDLHTLKQNSNIKHLKGS---------LELPAQMAELSSG-DEGDYGFS--LDRFR- 935
             ++ DL TLKQ+S+IK    S         +     + E + G DEG+ G    +  F+ 
Sbjct: 997  -DVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKH 1055

Query: 936  -SAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSE 994
             S  KSF + T+++DKFK G K V+I K+ KT+G SKA+IT++G+ R+L+ PK   +++ 
Sbjct: 1056 PSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKTEENH 1115

Query: 995  P--KLNSSKRARSQLFSEGNNRSFDT 1018
                +  SK  +S+LF  G + SFD+
Sbjct: 1116 HPNHIKKSKTQKSKLFENGQD-SFDS 1140

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 118/507 (23%), Positives = 199/507 (39%), Gaps = 103/507 (20%)

Query: 8   CVSARKKTTYKKVRLGIAEQSKDEPSS------NKPAA------VFRSSLLDRVRTRLNV 55
             S ++ TTYKKV   I +++ D   +      N P A      +F ++ L+RV+ RL  
Sbjct: 54  LTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRL-- 111

Query: 56  EDGHAPSSDALEPESGLTDDVYDGENLEVSFDVGDAEDDCLPTQADGKPEQIEVNVGTAP 115
           E  +    D  + E+   +DV+  + +   +D G+     L ++++G     +VNV +  
Sbjct: 112 EGRNELGQDGQDKENE-DEDVFSTQLIANLYDGGEE----LESKSNGDKNNQKVNVSSFT 166

Query: 116 EEPFSRIKIPLKLSDGGIFSPSTQVDDEMAMQLQPTQKLPPESPALQAVDTH----TELQ 171
           +    RI + +   +  I  P   +++      +PTQK       +    T     T  Q
Sbjct: 167 QT--QRIPVSITQQNNEINVPIHSINEG-----EPTQKAKNRGSVITTSQTQAIPFTTAQ 219

Query: 172 DELETGVAVDGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQ----T 227
              +T   ++   + SQTQ I       PT+  +    TQ D    A A   DTQ     
Sbjct: 220 ITQKTTQCLNNHGATSQTQQI------PPTKPSE--AQTQAD---VATANDSDTQQKVPM 268

Query: 228 LDCALADDFQATIPD------------------------AQTLATARHEKLFIHQIEEEI 263
           L    +  FQ T+PD                        AQT+       L IH+++ E+
Sbjct: 269 LTTETSPLFQ-TVPDQSPSTQMNTPPPTVHDDRTQMDTVAQTMQDKVPPTLKIHELQSEL 327

Query: 264 ATKTQKELPMMTQAKEAPYIPKQKLV-----FTKDNFLDSFDDDSETE-IHGGLDGSDRQ 317
           A     E     +A+   Y   QK +     F+K++FL  FD+ S  E  +  L+ S  +
Sbjct: 328 AL----EDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFKLESSQPK 383

Query: 318 VSYNDREHTETGPQSSQPATGEG-QDTQVLYPALQSLSITSKSYQEARQII---LDESSE 373
              N  E  +    + QPA  E  +D +V  P L + +   K   ++ + I   LD  S+
Sbjct: 384 QQQNGYEMIDISQSNPQPAEKENKKDKKV--PLLSTYANNLKREIDSSKCITLDLDSGSD 441

Query: 374 DDTDVNX-----------------XXXXXXXXXXXXXXRNSKFITPQKIDETKSSKSNEL 416
            D D +                                +N K       ++   S  N+L
Sbjct: 442 KDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKL 501

Query: 417 FAKLRKANREQLLEQRRNAIERRGINM 443
              LRKA+R+Q+L+ +R  +E +G  +
Sbjct: 502 INTLRKASRKQILDHQREIVETKGFKL 528

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  227 bits (579), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 155/422 (36%), Positives = 227/422 (53%), Gaps = 60/422 (14%)

Query: 649  DELDQETRRKILSDLXXXXXXXXXXXXXXXXXMKKKGITKMLXXXXXXXXXXWHGIGGSD 708
            +E+ +  RR+++                     K KGIT             WHG+GG+D
Sbjct: 739  EEVSEAIRRELIDKKKSQLRQKEKKHVAELKEFKSKGITNFFEMEAEESEDEWHGVGGAD 798

Query: 709  NELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFR-RR 767
             E SE+YDSEVEKMIDDYS +S N+  +R +LA   ++ D  ++N+IL+DI  GGFR +R
Sbjct: 799  GEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKR 858

Query: 768  GKGALDLEMSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTE 827
             K +L+LE+S++ED  LQQ+R KRREL++++ LE GD +KLV NPKS AFF++MV+D+ E
Sbjct: 859  AKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIME 918

Query: 828  ASFGNTFDANIDEKTDPSAAG-----------------------------RKIVISEQFV 858
              F N F A  +   D ++                               +K +ISE FV
Sbjct: 919  --FKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFV 976

Query: 859  KETLSFLSSKSGDS-EIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGS-------- 909
            +++LSFL S + D  E+  E   I    +  E ++DL TLKQ+S+IK    S        
Sbjct: 977  QKSLSFLRSNNYDEFEMDKERARIQHD-IGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSK 1035

Query: 910  -------LELPAQ-MAELSSGDEGDY-GFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRI 960
                   LE P +   E+ + D     GF   +  S  KSF + T+++DKFK G K V+I
Sbjct: 1036 RVNSMIDLEQPTEDNNEVENEDPSLIGGF---KHPSIIKSFASRTDINDKFKEGNKTVKI 1092

Query: 961  LKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRA----RSQLFSEGNNRSF 1016
             K  KT+G SKA+IT++G+ R+L+ PK    D +   N   +A    +S+LF  G + SF
Sbjct: 1093 SKTYKTVGSSKASITYMGKTRKLMAPKKK-ADRDHHHNHHSKAWKTQKSKLFESGQD-SF 1150

Query: 1017 DT 1018
            D+
Sbjct: 1151 DS 1152

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 414 NELFAKLRKANREQLLEQRRNAIERRGINM 443
           N+LF  LRKA+R+Q+L+ +R  IE +G  +
Sbjct: 528 NKLFNILRKASRKQILDHQREVIETKGFKL 557

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  227 bits (579), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 159/476 (33%), Positives = 250/476 (52%), Gaps = 86/476 (18%)

Query: 562  RQAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKYDDLSPVKTTTST-PKGLTDGRAEL-D 619
            R AI+LG YG+NI+ +            ++ ++ +D++  +T   T  + + + +A L D
Sbjct: 642  RIAINLGHYGDNIEEE-----------VNKFQETNDMNTQQTDKITMERNIVENKAILED 690

Query: 620  HESPDGHSLNTNLQQGLXXXXXXXXXXXXDELDQETRRKILSDLXXXXXXXXXXXXXXXX 679
                D  ++N                   +E D+  RR+++                   
Sbjct: 691  TAVVDEDNIN-------------------EEADEAIRRELIDKEKLQLRQKELEKAIKLK 731

Query: 680  XMKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAI 739
             +K KG+T             WHGIGG+D E S++YDS+VEKMIDDYS ++ N+  +R +
Sbjct: 732  ELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREM 791

Query: 740  LAKNERQHDENIVNKILHDISTGGFR-RRGKGALDLEMSENEDQELQQFRQKRRELLKQK 798
            LA   ++ D  ++NKIL+DI  GGFR +R K +L+LE+S++ED  LQQ+R KRREL++++
Sbjct: 792  LAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKR 851

Query: 799  ILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDA---------------------- 836
             LE GD +KLV NPKS AFF++MV+D+ E  + N F A                      
Sbjct: 852  RLEIGDGTKLVKNPKSKAFFESMVEDIME--YKNPFRAEEESNQDITSTATDLDTLDNNS 909

Query: 837  -NIDEKTDPSAAG------RKIVISEQFVKETLSFLSSKS-GDSEIPAETKSISSSTVER 888
             N+ + T  +  G      +KI+ISE FV+++LSFL S +  + E+  E   +     + 
Sbjct: 910  LNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKELAKMQHGN-DD 968

Query: 889  EEIQDLHTLKQNSNIKHLKGS-------------LELPAQMAELSSGDEGDY----GFSL 931
            E I+DL TLKQ+S+IK    S             ++L  +  +    + GD     GF  
Sbjct: 969  EPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGF-- 1026

Query: 932  DRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPK 987
             +  S  KSF + T+++DKFK G K V+I K+ K +G SKA+IT++G+ R+L+ PK
Sbjct: 1027 -KHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPK 1081

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 140/361 (38%), Gaps = 79/361 (21%)

Query: 10  SARKKTTYKKVRLGIAEQSKDE------------PSSNKPAAVFRSSLLDRVRTRLNVED 57
           S ++ TTYKKV + I + + +             P+      +F ++ L+RV+ RL  E 
Sbjct: 13  SKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANATLNRVKNRL--EG 70

Query: 58  GHAPSS--------DALEPESGLTDDVYDG-ENLEVSFDVGDAEDDC-----LPT--QAD 101
           G AP          D     S L  ++Y+G E+LE   +    E+DC     +PT  Q  
Sbjct: 71  GKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLE---ETKSNENDCTGKNCMPTFTQTQ 127

Query: 102 GKPEQIE------VNVGTAPEEPFSRI--------KIPL--KLSDGGIFSPSTQVDDEMA 145
             P  I+      V + +  EE  ++I        KIP   KLS   I   +TQ  D   
Sbjct: 128 RIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVATQRIDSDD 187

Query: 146 MQLQPTQKLPP---ESPALQAVDTHTELQ-DELETGVAVDGRISLSQTQV---------- 191
           +  Q  Q LP    ESP+     T  +L     +  V   G+  L Q  +          
Sbjct: 188 IITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRGPVNQMDT 247

Query: 192 -IVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATIPDAQTLATAR 250
            + S  N   T++D     TQ D+    D     T   D    D        +QTL    
Sbjct: 248 PLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTM------SQTLQDGV 301

Query: 251 HEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQK-----LVFTKDNFLDSFDDDSET 305
              L I +I+ E+A +  +      +A    Y   QK     L F+K++FL  FDD S  
Sbjct: 302 PHTLKIREIQNELALEDSRR----ERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSN 357

Query: 306 E 306
           E
Sbjct: 358 E 358

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 414 NELFAKLRKANREQLLEQRRNAIERRGINM 443
           N+LF  LRKA+R+Q+L+ +R  IE +G  +
Sbjct: 486 NKLFNTLRKASRKQILDHQREVIETKGFKL 515

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  224 bits (570), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 128/332 (38%), Positives = 195/332 (58%), Gaps = 30/332 (9%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            +K+KG++             WHGIGG D E+S++YDSEVEKMIDDYS    + + +R +L
Sbjct: 805  LKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLL 864

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
                ++ D  +VNKIL DI  G FR+RG+  L+LE+S+ ED +L+Q+RQKR EL+KQ++L
Sbjct: 865  VSENKEMDVKMVNKILFDIKNGNFRKRGRDTLELELSDEEDDDLRQYRQKRNELMKQRLL 924

Query: 801  ENGDTSKLVSNPKSYAFFQTMVDDVTEAS--FGNTFD--------------------ANI 838
            + GD  KLV N K+ AFF ++V+D+ E    FG   D                    +N 
Sbjct: 925  DLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRESVSNK 984

Query: 839  DEKTDPSA-AGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTL 897
            +EK  P+   G+K V+SE+FV+ +LSFL+S    +E   E     +     +++ DL+TL
Sbjct: 985  EEK--PTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEF--EQNQDLARLQHDDDVSDLYTL 1040

Query: 898  KQNSNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFR--SAAKSFNNGTNVDDKFKSGT 955
            K+ S++K  K S+    ++  + + D      +   FR  S  KSFN+  NVDDKF++G 
Sbjct: 1041 KKQSSVKSFK-SVGSKNEIINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGK 1099

Query: 956  KAVRILKANKTIGGSKAAITFIGRKRRLIPPK 987
            K V+  K+ K +GGSK ++T++ + R+L  PK
Sbjct: 1100 KTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  217 bits (553), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 145/384 (37%), Positives = 215/384 (55%), Gaps = 49/384 (12%)

Query: 649  DELDQETRRKILSDLXXXXXXXXXXXXXXXXXMKKKGITKMLXXXXXXXXXXWHGIGGSD 708
            +E D+  RR+++                    +KK+G+T             WHGIGG+D
Sbjct: 678  EEADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGAD 737

Query: 709  NELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFR-RR 767
             E S+DYDS++EKMIDDYS ++ N   +R +LA   ++ D  ++NKIL+DI  GGFR +R
Sbjct: 738  GEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKR 797

Query: 768  GKGALDLEMSENEDQE-LQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVT 826
             K +L+LE+S++++ + LQQ+R KRREL++++ LE GD +KLV NPKS AFF++MV+D+ 
Sbjct: 798  AKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDII 857

Query: 827  EAS--FGNTFDANID------------------------EKTDPSAAGRKIVISEQFVKE 860
            E    FG   + N+D                        E+       +K++ISE FV++
Sbjct: 858  EYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFVQK 917

Query: 861  TLSFLSSKSG-DSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGS---------- 909
            +LSFL S +  D E   E   I       E I+DL+TLKQNS+IK    S          
Sbjct: 918  SLSFLKSNNYEDFETDKELSRIQHGN--DEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTV 975

Query: 910  ---LEL---PAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKA 963
               ++L   P    E+ +GD    G    +  S  KSF + T+++DKFK G K V+ILK+
Sbjct: 976  NTIIDLEKRPEDEDEVENGDTSLVGVF--KHPSIIKSFASRTDINDKFKEGNKTVKILKS 1033

Query: 964  NKTIGGSKAAITFIGRKRRLIPPK 987
             KT+G SKA+IT++G+ R+LI PK
Sbjct: 1034 YKTVGSSKASITYMGKTRKLIAPK 1057

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 82/349 (23%), Positives = 140/349 (40%), Gaps = 86/349 (24%)

Query: 8   CVSARKKTT-YKKVRLGIAEQSKDEPSSNKP------------AAVFRSSLLDRVRTRL- 53
            ++A+K+TT YKKV + I +++ D  + N P              +F ++ L+RV+ RL 
Sbjct: 10  SLTAKKRTTTYKKVAVPILDEN-DNTNGNGPNDIDNPPELTGNGFLFANATLNRVKNRLE 68

Query: 54  -------NVEDGHAPSSDALEPE--------------SGLTDDVYDGENLEVSFD----- 87
                  N  +G   S ++L  +              S + D+ Y  +N+  SF      
Sbjct: 69  GKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVSSSFTQTQRI 128

Query: 88  -VGDAEDDC--LPTQA--DGKPEQIEVNVGTAPEEPFSRIKIPLKLSDGGIFSPSTQVDD 142
            V   +D    +P  +  DGKP Q+    G    E    +K PL     G    + ++D 
Sbjct: 129 PVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLV-NETSQALKTPLTTGRPG---ATQRIDS 184

Query: 143 EMAM-QLQPTQKLPPESPALQAVDTHTELQDELETGVAVDGRISLSQTQVI------VSG 195
             A  Q QP + + P+S  +     H+          A+  +I +  T++I       S 
Sbjct: 185 SGATSQTQPIKSIEPQSQIITTSSNHSN---------ALSPKIPIIPTELIGTSPLFQSI 235

Query: 196 TNYGPTRVDDEVVATQQD-----SMGTADAQCWDTQTLDCALADDFQATIPDAQTLATAR 250
            N GP    D    T  D     ++G   A   + +T    +A   Q  +P         
Sbjct: 236 QNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHT------- 288

Query: 251 HEKLFIHQIEEEIAT---KTQKELPMMTQAKEAPYIPKQKLVFTKDNFL 296
              L I +I+ E+A+   K +K   +  +  + P IP +K  F+K++FL
Sbjct: 289 ---LKIREIQSELASEDSKREKARNVEYKKPQKP-IPTKKF-FSKESFL 332

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  213 bits (542), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 131/330 (39%), Positives = 188/330 (56%), Gaps = 37/330 (11%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            +  KG+ +            W GIGG D +   +YDSEVEKMIDDYS    +   LR  +
Sbjct: 798  LANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKI 857

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
                ++ D  +VNKIL+DI  GGFR+RG+  ++LE S++ED ELQ+FR+KRREL+KQ++L
Sbjct: 858  MDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRML 917

Query: 801  ENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFD----------------ANIDEKTDP 844
            EN DT KL  NPKS AFF++M+ D+ E    N FD                 N  E  + 
Sbjct: 918  ENEDTDKLTKNPKSKAFFESMIVDLVEDK--NNFDDLSDQIELKEENITQEDNEKEYNEA 975

Query: 845  SAAGR-KIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREE-IQDLHTLKQNSN 902
             +  R KI ISE FV++TLSFL +     E         S  + +E+ I D++ LK NS 
Sbjct: 976  KSNKRGKIRISEDFVQKTLSFLHNDESTQEFQP------SFIMSKEKGIGDMNALKSNS- 1028

Query: 903  IKHLKGSLELPAQMAELSS--GDEGDYGFSLDRFR--SAAKSFNNGTNVDDKFKSGTKAV 958
                  SL   ++++       DE D     + F+  S  +SF++   +DDKFK G K+V
Sbjct: 1029 ------SLSFCSKLSTSRKIINDEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSV 1082

Query: 959  RILKANKTIGGSKAAITFIGRKRRLIPPKN 988
            ++  + KT+GGSKA+IT++G+ R+L+PPKN
Sbjct: 1083 KVSTSYKTVGGSKASITYLGKTRKLVPPKN 1112

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 413 SNELFAKLRKANREQLLEQRRNAIERRGINM 443
           +N LF  LRKA ++Q++  R+  +E RG+N 
Sbjct: 563 TNLLFNNLRKATKQQIMLHRKELMESRGLNF 593

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score =  212 bits (540), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 124/318 (38%), Positives = 195/318 (61%), Gaps = 17/318 (5%)

Query: 681 MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
           MK KG+ KML          W G+GG D +LS+++DS++E+MIDD++  + N D +R +L
Sbjct: 620 MKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLL 679

Query: 741 AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
           AK  ++ DE +VNKIL+DI  GGFR+RG+ ALDLE+S++ED++L+ +R KRREL+K+  +
Sbjct: 680 AKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDEDEDLRNYRLKRRELMKKSRI 739

Query: 801 ENGDTSKLVSNPKSYAFFQTMVDDVTEAS--FGNT---FDANID---EKTDPSAAGRKIV 852
           E  D  K   N KS AF ++MVDD+ E+   FG+     + N D   ++ D      K  
Sbjct: 740 EGKDKEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNTDVDTQENDYPKNKEKNT 799

Query: 853 ISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLEL 912
           +S++FV+ +LSFLS+ +   E       +       +E QD+ +LK+NS+I  L  S   
Sbjct: 800 LSQEFVQRSLSFLSNNNSSREF-----ELGEQITLGDEEQDVSSLKRNSSIHALHNSSSP 854

Query: 913 PAQMAELSSGDEGDYGFSLDRFR--SAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGS 970
             +  E  + DE D+  +L  F+  S  KS   G + ++KF+SG K V + K+ + +GGS
Sbjct: 855 IKEDLEKENQDE-DF-ITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGS 912

Query: 971 KAAITFIGRKRRLIPPKN 988
           +++IT+ G+ R+L+ PKN
Sbjct: 913 RSSITYFGKMRKLVGPKN 930

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 86/331 (25%), Positives = 142/331 (42%), Gaps = 69/331 (20%)

Query: 1   MELLDGLCVSARKKTTYKKVRLGIAEQSKDEPSSNKPAAV------FRSSLLDRVRTRL- 53
           +E LD L  S++++TTYKKV     E+   + S++ P  +      F++S +D+VR RL 
Sbjct: 5   LEKLDPL--SSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNRLR 62

Query: 54  NVEDGHAPSSDALEP----------ESGLTDDVYDGENLEVSFDVGDAEDDCLPTQADGK 103
           N EDG        +           ++ +  D+Y+G                        
Sbjct: 63  NAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEG------------------------ 98

Query: 104 PEQIEVNVGTAPEEPFSRIKIPLKLSDGGIFSPSTQVDDEMAMQLQPTQKLPPESPALQA 163
            E++E       E+   R+++PL           TQV     +   PT +   E+   Q 
Sbjct: 99  AEELE-------EQNKERVRLPLSKKTSSASQEKTQV-----IPWAPTVE-GVENNVEQG 145

Query: 164 VDTHTELQDELETGVAVDGRI----SLSQTQV-IVSGTNYGPTRVDD--EVVATQQDSMG 216
            D H E   ++   ++ D +     S  QT+V  ++     P R  D     AT +D + 
Sbjct: 146 TDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVEPLTQRISEPERTLDVPTYAATSEDQLD 205

Query: 217 TADAQCWDTQTLDCALADDFQATIPDAQTLATARHEKLFIHQIEEEIATKTQKELPMMTQ 276
           T + Q   TQ LD + +  FQAT  D   +  +  ++L +H IE+E+  K Q+       
Sbjct: 206 TQE-QNPITQ-LDISNSLLFQATDSD---IPKSPPQRLKMHDIEKELEEKRQERDHRRNI 260

Query: 277 AKEAPYIPKQ-KLVFTKDNFLDSFDDDSETE 306
              AP  P   K VF+K+ FL +FD++S +E
Sbjct: 261 EYRAPEKPVNVKRVFSKEAFLKNFDEESSSE 291

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  204 bits (520), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 125/340 (36%), Positives = 195/340 (57%), Gaps = 40/340 (11%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            M KKG+TK            WHGIGG D E+S++YDS+VEKMIDDYS  + + + +R +L
Sbjct: 720  MMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREML 779

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQE-LQQFRQKRRELLKQKI 799
            A   ++ D N++NKIL+DI  GGFR+R +G L+LE+SE+ED + L+++  KR+EL++++ 
Sbjct: 780  AAENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRR 839

Query: 800  LENG-DTSKLVSNPKSYAFFQTMVDDVT-------EASFGNTFDANIDEKTDPSAAGRKI 851
            LE G D  KLV NPKS AFF++MV+D+T       +   G T    I+   D        
Sbjct: 840  LELGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAA 899

Query: 852  VI----------------SEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREE----I 891
            V+                SE+FV+ TLSFL S   D E         +  + +E+    +
Sbjct: 900  VVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAM------NENLAKEQHGTKV 953

Query: 892  QDLHTLKQNSNIKHLKGSLELPAQMAELSSGDEGDYG-----FSLDRFRSAAKSFNNGTN 946
            ++L +LKQ S+IK  +      +++ +L   +  D        +L +  S  KSF + T+
Sbjct: 954  ENLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIALFKVPSILKSFGSKTD 1013

Query: 947  VDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPP 986
            +++KF+ G K V I K+ +T+G SKA+IT++G+ R+L+ P
Sbjct: 1014 INEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAP 1053

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 125/531 (23%), Positives = 213/531 (40%), Gaps = 114/531 (21%)

Query: 3   LLDGLC-VSARKKTTYKKVRL--GIAEQSKD------------EPSSNKPAAVFRSSLLD 47
           L+D L  V+  +KTTY K  L   I EQ +D             P+      +F++S +D
Sbjct: 4   LIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNSTID 63

Query: 48  RVRTRLN----VEDGHAPSSDALEPESGLTDDVY-DGENLEVSF-------------DVG 89
           +VR RL+    +E    P + + E E+ +  ++Y +GE+LE                + G
Sbjct: 64  KVRARLSGKNYIEQEKTPLASS-EQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITNTG 122

Query: 90  -------------DAEDDCLPTQADGKPEQIEVNVGTAPEEPFSRIKIPLKLSDGGIFSP 136
                        D + + +PTQ  G  E+ +    TA       +   L   D    + 
Sbjct: 123 ERTQLEQEIKVTIDNDSNEMPTQVIGSTERDD---ETAERTQIGEVATQLIPGDTYDRTS 179

Query: 137 STQVDDEMAMQLQPTQKLPPES-----------PALQAVD-THTELQDELETGVAV--DG 182
           + Q   E   QL  TQ++P  S            +  +V  T T+     ET +    D 
Sbjct: 180 TMQKTQE---QLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQKIKNFETNITNENDD 236

Query: 183 RISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATIPD 242
             + S++Q ++  TN       D V A   D    A +       +   + DD  ++   
Sbjct: 237 FTNGSKSQTVLISTNV------DNVRAEYVD----ASSSLLQATAIAATVRDDGPSSTAL 286

Query: 243 AQTLA---TARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQKLV----FTKDNF 295
             T+A    +    L IH+ ++E+  + Q  L   ++ KE   I K  L     FTKD+F
Sbjct: 287 VGTVADDKLSSGSNLAIHKFQKELEEEEQ--LANNSKYKEYKGISKPILTNIVKFTKDSF 344

Query: 296 LDSFDDDSETEIHGGLDGSDRQVSYNDREHTETGPQSSQ----PATGEG------QDTQV 345
           L  FD+ S +      D   ++   N +E+T +   S++     A+ +G        +  
Sbjct: 345 LQGFDNSSSSSSEEEGDKV-KETKRNGKENTSSNSYSTKNNNSTASSDGTTIKPKIKSPK 403

Query: 346 LYPALQSLSITSKSYQEARQIIL-----------DESSEDDTDVNXXXXXXXXXXXXXXX 394
            +  L +LS     Y+   + +L           DESS+D  +                 
Sbjct: 404 KFSKLNTLS----RYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKA 459

Query: 395 RNSKFITPQKI--DETKSSKSNELFAKLRKANREQLLEQRRNAIERRGINM 443
           R SK  + + +  D T ++  N+LF  L+K++R+Q+LE +R  IE +G+N 
Sbjct: 460 RLSKQKSKKNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNF 510

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  201 bits (512), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 138/358 (38%), Positives = 202/358 (56%), Gaps = 41/358 (11%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            MK  G++KM           WHGIGG D++ S+ YDSEVEKMIDDYS  + N   +R +L
Sbjct: 611  MKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREML 670

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
            AK  ++ D  +VNKIL+DI  GGFR R +   DLE S+++D +L+ +R KRR L+++K L
Sbjct: 671  AKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDDLKAYRAKRRALMREKRL 730

Query: 801  ENGDTSKLVSNPKSYAFFQTMVDDVTEAS--FGN--------------TFDANIDEK--T 842
            +     K+V NPKS AFF+++VDD+ E    F +              T D + DEK  T
Sbjct: 731  DIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLAT 790

Query: 843  DPSAAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSN 902
            + +   +KIVISE+FV+ +LSFL+S     E   E  +  +   +     DL+TLK+ S+
Sbjct: 791  NVTKKKKKIVISEEFVQRSLSFLNSCREQDEF--EINNQHNGGEKATSTADLYTLKRYSS 848

Query: 903  IKHLKGSL------------ELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDK 950
            IK L+               E P+Q    SSG      F+  R  S   SF++  +++ K
Sbjct: 849  IKTLQSVTSSRSSSIASNLNEQPSQ----SSGS----LFNDLRKTSVLNSFSSDVDINSK 900

Query: 951  FKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLF 1008
            FK GTK+V++  A KT+G ++A+IT++G  RRL+ PK     +  K N S+   S+LF
Sbjct: 901  FKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKAN-SRTTPSRLF 957

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  200 bits (508), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 140/360 (38%), Positives = 209/360 (58%), Gaps = 34/360 (9%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            +K KGIT M           WHGIGG D ELS++YDSEVEKMIDDYS  + NA  +R  L
Sbjct: 636  LKDKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKL 695

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
            A   +  D  +VN+IL+DI  GGFR+R + AL++E+S++ED +L+ +R KRR+L+K+K L
Sbjct: 696  AAENKDMDLKMVNRILNDIKNGGFRKR-RNALEIELSDDEDDDLKAYRAKRRQLMKEKRL 754

Query: 801  ENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDAN----IDEKTDPSAAG-------- 848
            E     KL++N KS+AF ++MVDD+ E    N FD      +D+  +  A G        
Sbjct: 755  ETDHNKKLMTNKKSHAFLESMVDDIVEVK--NPFDERDDNIMDDTPETDAEGDVNSNELL 812

Query: 849  ---RKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKH 905
               +K ++SE FV+++LSFLSS     E   E  +  +         D+  LK + +IK 
Sbjct: 813  NKKKKFILSEAFVQKSLSFLSSSRNLEEF--EMNNNLAKEQHSHAATDMFALKSHCSIKS 870

Query: 906  LKGSLELP-------AQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAV 958
            L+    LP       +   +L   +     FS  +  S  KSF++  ++D KFK G K V
Sbjct: 871  LES---LPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTV 927

Query: 959  RILKANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRAR-SQLFSEGNNRSFD 1017
            ++ K+ +T+G +KA+IT++G+ R+L+PPK   K+ +P  + SK A  S+LF E +N SF+
Sbjct: 928  KVSKSYRTVGSAKASITYLGKARKLVPPKK--KEHKPHSHKSKTASASRLFDEQDN-SFE 984

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 110/470 (23%), Positives = 190/470 (40%), Gaps = 83/470 (17%)

Query: 3   LLDGL-CVSARKKTTYKKVRLGIAEQSKDEPSSNK---------PAAVFRSSLLDRVRTR 52
           + DGL  +  +K+TTYKKV  G  E   DEP  ++          + +F +S L ++R R
Sbjct: 4   VFDGLDALKGKKRTTYKKVTDGDVE---DEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60

Query: 53  L--NVEDGHAPSSDA---LEPESGLTDDVYDG-ENLEVSFDVGDAEDDCLPTQADGKPEQ 106
           L  N  D    SS A   +  ++ +  ++Y+G E+LE                   + E+
Sbjct: 61  LEGNNNDSENDSSQAETQVIADTQIISNLYEGGEDLE-------------------EKEE 101

Query: 107 IEVNVGTAPEEPFSRIKIPLKLSDGGIFSPSTQVDDEMAMQLQPTQKL------PPESPA 160
                 T   E  ++I       D  +   S  ++   + ++  TQK        P    
Sbjct: 102 RRFLQRTQIVEDHTQI------IDASVTYSSKTIE---SNKMDNTQKYINASDSEPTQIQ 152

Query: 161 LQAVDTHTELQDELETGVAV-DGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTAD 219
           +  VD   ++ D L++   V D  +   + +     T YG T+VD     TQ D      
Sbjct: 153 ISKVDKLLKITDNLDSQKKVLDTTLETQELE-----TQYGKTQVD----KTQVDKTQVDK 203

Query: 220 AQCWDTQTLDCALADDFQATIPDAQTLATARHE--KLFIHQIEEEIATKTQ--KELPMMT 275
            Q + T   D    D+ + +    QT+    H   +L I++IE ++  + Q  KE  M T
Sbjct: 204 TQIFPTLVAD----DEIKHSSTAVQTVDDNTHSNSELKINEIERQLDEEDQILKEKSMGT 259

Query: 276 QAKE--APYIPKQKLVFTKDNFLDSFDDDSETEIHGGLDGSDRQVSYNDREHTETGPQSS 333
           + K   AP + K K  F+K++FL+ FD  S  E   G+     ++S  + E      ++S
Sbjct: 260 EYKRNIAPVMSKVK--FSKNDFLEHFDSSSSEEDEEGV----VKLSSTEPETAAMNLENS 313

Query: 334 QPATGEGQDTQVLYPALQSLSITSKSYQEARQIILDESSEDDTDVNXXXXXXXXXXXXXX 393
            P   +    +  +  L +     K     +  I    SED+T+V               
Sbjct: 314 LPQFSK----ESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSRASKATILSI 369

Query: 394 XRNSKFITPQKIDETKSSKSNELFAKLRKANREQLLEQRRNAIERRGINM 443
             N     P +      +    LF+ L+KA + Q+L+ ++  +E++G  M
Sbjct: 370 KANLSRHKPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKM 419

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  199 bits (507), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 206/348 (59%), Gaps = 26/348 (7%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            MKKKG+ K+           WHGIGG+D E+S++YDSEVEKMIDDYS  + N D +R +L
Sbjct: 671  MKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQML 730

Query: 741  AKNERQHDENIVNKILHDIST--GGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQK 798
            A   ++ D N++ KIL+DI       RRRG   L+L   + +D+EL+++ +++REL+K++
Sbjct: 731  ALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKR 790

Query: 799  ILENGDTSKLVSNPKSYAFFQTMVDDVTEA--SFGNT---------FDANIDEKTD--PS 845
            +LE GD  KL+ NPKS AFF++MV+D+ +   +FG+           D   +++ D  P 
Sbjct: 791  MLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPG 850

Query: 846  AAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKH 905
               +K VISE+FV++TLSFL S     E   E           E ++DL +LKQ S IK 
Sbjct: 851  VDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQ--HGENVEDLFSLKQRSTIKE 908

Query: 906  LKGSLELPAQ--MAELSSGDEGDYGFSLDRFR--SAAKSFNNGTNVDDKFKSGTKAVRIL 961
             +     P+Q    +L +  E      L  F+  S  KSF++ T++++KFK G K V I 
Sbjct: 909  FRN----PSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTIS 964

Query: 962  KANKTIGGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLFS 1009
            K  KT+G SKA+IT++G+ R+L+PPK + K+ E   +  K  RS LFS
Sbjct: 965  KVYKTVGSSKASITYLGKSRKLMPPKKN-KNREKIGSKIKPTRSSLFS 1011

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  193 bits (491), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 201/347 (57%), Gaps = 27/347 (7%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            MK+ G+T M           W G+GG D E  +DYDS++EKMIDD+S  +SNAD +R +L
Sbjct: 602  MKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQLL 661

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
                ++ D   VNKILHDI  GGFR+R +  L LE+S++ED EL  +++++ EL++++ L
Sbjct: 662  MAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELMRKRRL 721

Query: 801  ENG-DTSKLVSNPKSYAFFQTMVDDVTEAS--FGNTFDANIDEKTDP----SAAGRKIVI 853
            + G D  KL+ N +S AFF++MV+D+ +    F N  + +  +K       ++  +K  I
Sbjct: 722  QFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAETSEKDKKSEGLVDASNKQKDTI 781

Query: 854  SEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLELP 913
            S +FV+++LSFLSS    SE       ++  + E E   DL++LKQ+S +K L     + 
Sbjct: 782  SHEFVQQSLSFLSSSRDFSEF-----EVARVSQEGERNTDLNSLKQDSTVKTLYAPSNI- 835

Query: 914  AQMAELSSGDEGDYGFSL----DRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGG 969
              ++E    D  ++  S+      + S  KSF    N +DK K G K V + K+ +T+GG
Sbjct: 836  --ISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGG 893

Query: 970  SKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLFSEGNNRSF 1016
            +KA+IT++G+ R+L+ PK        K N+  R  S+L + GN++ F
Sbjct: 894  NKASITYLGKMRKLVAPK--------KSNAEVRTTSKLSTLGNSKIF 932

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score =  180 bits (457), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 221/456 (48%), Gaps = 42/456 (9%)

Query: 537 SVVTKRRSRRI-LVQSDDEGTETTENRQAIHLGVYGNNIKPQDTGPEARGSYLTSRIKKY 595
           +V  K++ RR  L+ SDDE     E +  I LG YG NI   +   E  G+ +       
Sbjct: 514 NVTKKKKVRRWNLIDSDDEALSNDEQKTVIDLGAYGENILGTERIDEGAGAQVVGTSSSM 573

Query: 596 DDLSPVKTTTSTPKGLTDGRAELDHESPDGHSLNTNLQQGLXXXXXXXXXXXXDELDQET 655
            +    + TT +P  +                LN   ++ +               D+ET
Sbjct: 574 CEAKLERNTTKSPVRI----------------LNRPCEEKIDQ-------------DEET 604

Query: 656 RRKILSDLXXXXXXXXXXXXXXXXXMKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDY 715
           R  I+ +L                 + +     M+          W G+GG+D E S+ Y
Sbjct: 605 RNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGY 664

Query: 716 DSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLE 775
           DSE+++MIDDYS   S+ + LR  L + E+ HD+++V++ILHDI  GGFR+RG+ A+DL 
Sbjct: 665 DSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMDLT 724

Query: 776 MSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGN--- 832
           +S++ED +L ++  +R+ELL ++   N + S L +NPKS AFF ++ +D  +    N   
Sbjct: 725 LSDDEDDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIANLKE 784

Query: 833 --TFDANIDEKTDPSAAGRKIVISEQFVKETLSFLSSK---SGDSEIPAETKSISSSTVE 887
             +  + +    D  +  R+  ISEQFV++TLSFL SK    GD+E  +   +  SS+ +
Sbjct: 785 YQSHASPLKAAKDEISGKRETRISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGD 844

Query: 888 REEIQDLHTLKQNSNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNV 947
             E  D + LKQ S IK     L    ++   +     D   S     +  + F    + 
Sbjct: 845 FAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNK----DGVLSGKANTTLVERFVRSVDT 900

Query: 948 DDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRL 983
           ++KF+ G K V+ L + K  G S+A+ITF+G+ R L
Sbjct: 901 NEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSL 936

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 416 LFAKLRKANREQLLEQRRNAIERRGINM 443
           LF+ LRKANR+QL+E R   +  RG+++
Sbjct: 373 LFSSLRKANRDQLVEHRNGLLLLRGVDL 400

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/307 (39%), Positives = 179/307 (58%), Gaps = 29/307 (9%)

Query: 701 WHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDIS 760
           WHGIGG D E  +D+DS++EKMIDDYS    ++  +R    + E   D+++VNKILHDI 
Sbjct: 666 WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725

Query: 761 TGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQT 820
           TGGFR+RG+ ALDLE+S+++D+EL ++  +R+ELL+QK+   G+   L  NPKS AFF+T
Sbjct: 726 TGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET 785

Query: 821 MVDDVTEASF-----------GNTFDANIDEKTDPSAAGRKIVISEQFVKETLSFLSSKS 869
           +V+D+                 ++ +A  ++ +D    G+K V+SE FV++TLSFL+S  
Sbjct: 786 IVEDIRSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGE 845

Query: 870 GDSE---------IPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLELPAQMAELS 920
              E         +P    S ++     EE QD+  LKQNS+IK    SL  P + +   
Sbjct: 846 VGEEKGPENNLGSLPTHVPSFNT-----EETQDIFALKQNSSIK----SLSAPTRNSSNM 896

Query: 921 SGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRK 980
             D+ +   S  R  S    F    + ++KF+ G K VR L + K  G SKA+IT++G+ 
Sbjct: 897 LIDDQEDLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKA 956

Query: 981 RRLIPPK 987
           R+L  PK
Sbjct: 957 RKLNAPK 963

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 416 LFAKLRKANREQLLEQRRNAIERRGINM 443
           LFA LRKAN+ Q+L+ R+   + +GI+ 
Sbjct: 394 LFASLRKANKSQILDYRKEKYQSKGIDY 421

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  164 bits (414), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 185/363 (50%), Gaps = 65/363 (17%)

Query: 681  MKKKGITKMLXXXXXXXXXXWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAIL 740
            +KK G +KM           W GIGG+D E+S++YDSEVEK+IDDYS    N D +R  L
Sbjct: 868  LKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKL 927

Query: 741  AKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKIL 800
                ++ D  +VN+IL+DI  GGFR+R +  +DLE+S++ED EL+++R KRRE++K+K L
Sbjct: 928  MNENKEMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDDEDDELREYRIKRREIMKKKRL 987

Query: 801  ENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTF-------------------------- 834
            E  +T K++   KS AFF +MVDD+ E S  N F                          
Sbjct: 988  EVTNTDKILKTSKSKAFFMSMVDDIVETS--NPFMITQPSDDDSDDNNMDSISNKNHKDA 1045

Query: 835  ----DANIDEKTDPSA-----AGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSST 885
                    D++TD  A     + +K V+SE FV +TLSFL+     +E     +   S  
Sbjct: 1046 NNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQI 1105

Query: 886  VEREEIQDLHTLKQNSNIKHLKGSLELPAQMAE----------------LSSGDEGDYGF 929
                 I D+ +LKQ S+IK    ++ + + M++                +      D  F
Sbjct: 1106 ---GTINDIQSLKQKSSIK----TMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNSF 1158

Query: 930  -----SLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLI 984
                 S+ +  S  K F +  +++DKFK G K V I  + KT+GG K +IT  GR++ + 
Sbjct: 1159 DDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGRRKLVA 1218

Query: 985  PPK 987
            P K
Sbjct: 1219 PVK 1221

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 24/29 (82%)

Query: 415 ELFAKLRKANREQLLEQRRNAIERRGINM 443
           +LF KL+KA+++Q+ + ++NAIE +G+ +
Sbjct: 646 QLFNKLKKASKKQIFDHQKNAIESKGLKL 674

>KLLA0C02783g Chr3 (250633..253029) [2397 bp, 798 aa] {ON} similar to
            uniprot|P53848 Saccharomyces cerevisiae YNL256W FOL1
            Multifunctional enzyme of the folic acid biosynthesis
            pathway has dihydropteroate synthetase
            dihydro-6-hydroxymethylpterin pyrophosphokinase and
            dihydroneopterin aldolase activities
          Length = 798

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 19/104 (18%)

Query: 908  GSLELPAQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTI 967
            G  +LP Q  +L            D ++SA  +F  G+N+ D+FK+  +AV +LKA+K +
Sbjct: 275  GDFDLPVQNIKLDK----------DSWKSAILAF--GSNIGDRFKNVVEAVSLLKAHKDV 322

Query: 968  GGSKAAITFIGRKRRLIPPKNDYKDSEPKLNSSKRARSQLFSEG 1011
                ++  F             +KD +P LN   + +++L  + 
Sbjct: 323  EVVCSSSLFESEPMY-------FKDQQPFLNGCIKIKTRLLPDA 359

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 7/119 (5%)

Query: 802  NGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDEKTDPSAAGRKIVISEQFVKET 861
            N DTSK  S  +     Q+  D     S     D  + EKTD  +A  ++VI  + ++E 
Sbjct: 2334 NLDTSKFKSLNEDILLKQSDND-----SLSKKIDEIVKEKTDLKSANEELVIKSRTLEEE 2388

Query: 862  LSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLELPAQMAELS 920
            +  LS+    + + AE K++S    E+E    L+   +  NI+  K + EL +++AEL+
Sbjct: 2389 MKELSN--SKNALQAELKTLSKLKEEKEIQTSLNEKSKEENIQLSKSNDELQSKIAELN 2445

>AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML076C (WAR1)
          Length = 748

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 854 SEQFVKETLSFLSSKSG-DSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGSLEL 912
           S Q + E+L F +  +G +++I A      SS +E +E +  HT+K NS  KH+ G+   
Sbjct: 638 SAQLLSESLGFANIPTGTNNDIQAGLLRAPSSIIEPDE-KKFHTIKVNSIYKHIAGT--- 693

Query: 913 PAQMAELSSG 922
           P+  AE S G
Sbjct: 694 PS--AEFSGG 701

>AER237W Chr5 (1076625..1077083) [459 bp, 152 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL160W (ELF1)
          Length = 152

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 20/35 (57%)

Query: 520 SGLSSEIDSDMGEESDHSVVTKRRSRRILVQSDDE 554
           S +  E+DSD  E SD   +  RR R  LV SDDE
Sbjct: 118 SRVQEEVDSDEAEYSDSDRIGNRRGRSALVDSDDE 152

>NCAS0B07480 Chr2 (1409664..1410401) [738 bp, 245 aa] {ON} Anc_1.313
           YJL063C
          Length = 245

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 240 IPDAQTLATARHEKLFI---HQIEEEIATKTQKELPMMTQAKEAPYIPKQKLVFTKD 293
           + DA    T  + KL++   + I +EIA+K  KEL +    KEA Y PK++  FTK+
Sbjct: 127 VIDANGGLTRGNLKLWLLASYTINDEIASKAYKELTLQNLFKEAQYKPKEQ--FTKE 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,137,217
Number of extensions: 4567877
Number of successful extensions: 20432
Number of sequences better than 10.0: 208
Number of HSP's gapped: 20990
Number of HSP's successfully gapped: 310
Length of query: 1018
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 898
Effective length of database: 39,721,479
Effective search space: 35669888142
Effective search space used: 35669888142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)