Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR744W1.6ON34333413520.0
Ecym_10091.6ON33627012421e-172
KLLA0C00506g1.6ON33027012271e-170
SAKL0C00484g1.6ON33927212271e-169
CAGL0B00352g1.6ON33727112111e-167
KNAG0C002301.6ON34927112081e-166
NCAS0B091001.6ON32727112041e-166
Kwal_33.130111.6ON33427212041e-166
YCL059C (KRR1)1.6ON31627212021e-166
Smik_3.151.6ON31627211991e-166
Suva_3.1531.6ON31627211981e-166
KLTH0F00506g1.6ON33227212001e-165
KAFR0D001501.6ON34427111961e-165
Skud_3.41.6ON31627211911e-164
TBLA0A049401.6ON31627111901e-164
NDAI0A001501.6ON31727111891e-164
Kpol_2002.91.6ON33827111831e-163
TDEL0C069601.6ON35027111831e-163
TPHA0E040001.6ON31627111751e-162
ZYRO0F18458g1.6ON31427111401e-157
SAKL0G03740g5.482ON2661461156e-06
Suva_8.1975.482ON2741481148e-06
NCAS0A119605.482ON2701761148e-06
Skud_15.3105.482ON2761761112e-05
YOR145C (PNO1)5.482ON2741761103e-05
KLLA0C06446g5.482ON2741461093e-05
Kpol_543.135.482ON2681461094e-05
KAFR0E036005.482ON2761461084e-05
Smik_15.3265.482ON2741761084e-05
ZYRO0D11440g5.482ON2691761085e-05
KNAG0C046105.482ON2771761076e-05
TPHA0J028205.482ON2681461076e-05
Ecym_45525.482ON2711461077e-05
Kwal_47.188645.482ON2711461067e-05
TDEL0A034605.482ON2721461068e-05
KLTH0G02574g5.482ON2711461068e-05
CAGL0K09460g5.482ON2611461051e-04
NDAI0A043105.482ON2741461051e-04
TBLA0D018905.482ON2711461013e-04
AAR002W1.420ON178172790.12
KAFR0B030308.309ON46724712.7
KLLA0D02398g1.290ON120590712.8
KLTH0E14014g8.798ON48699702.9
AGL183C8.309ON50724702.9
KNAG0G023508.309ON49724685.1
SAKL0D08822g1.420ON18383657.1
Kpol_209.15.368ON1303120678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR744W
         (343 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   525   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   483   e-172
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   477   e-170
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   477   e-169
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   471   e-167
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   469   e-166
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   468   e-166
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   468   e-166
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   467   e-166
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   466   e-166
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   466   e-166
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   466   e-165
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   465   e-165
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   463   e-164
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   462   e-164
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   462   e-164
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   460   e-163
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   460   e-163
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   457   e-162
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   443   e-157
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    49   6e-06
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    49   8e-06
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    49   8e-06
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    47   2e-05
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    47   3e-05
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    47   3e-05
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    47   4e-05
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    46   4e-05
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    46   4e-05
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    46   5e-05
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    46   6e-05
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    46   6e-05
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    46   7e-05
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    45   7e-05
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    45   8e-05
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    45   8e-05
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    45   1e-04
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    45   1e-04
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    44   3e-04
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    35   0.12 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.7  
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    32   2.8  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    32   2.9  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.9  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.1  
SAKL0D08822g Chr4 complement(734328..734879) [552 bp, 183 aa] {O...    30   7.1  
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    30   8.4  

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/334 (79%), Positives = 265/334 (79%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXVYTPFPPAQLPRKVDLEIETGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD 300
               VYTPFPPAQLPRKVDLEIETGEYFLS                             D
Sbjct: 241 KEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAKD 300

Query: 301 YIXXXXXXXXXXXXXXXXXXXXXXXDTQDETTHP 334
           YI                       DTQDETTHP
Sbjct: 301 YIAPAEPEYSPEEKKEKKKDAKRKKDTQDETTHP 334

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  483 bits (1242), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 227/270 (84%), Positives = 244/270 (90%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NKDKPWDTPD+DKW IEEF PED+ASGLPFAEESSFMTLFPKYRE YLKS W +V
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KHH+ACELNLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN  ++K+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFKKRNIARKKPKKI 240

Query: 241 XXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
               VYTPFPPAQLPRKVDLEIETGEYFLS
Sbjct: 241 KEKKVYTPFPPAQLPRKVDLEIETGEYFLS 270

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  477 bits (1227), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 225/270 (83%), Positives = 243/270 (90%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NKDKPWDT +VDKW IEEF PED+ SGLPFAEESSFMTLFPKYRE YLKS+WK+V
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TR+L+ HHIACELNLVEGSM+VKTTRKTYDPA+ILKARDLIKLLARSVP PQA+KIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+PELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
               +YTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 KEKKIYTPFPPAQLPRKVDLEIESGEYFLS 270

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  477 bits (1227), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/272 (83%), Positives = 244/272 (89%), Gaps = 2/272 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           M ST NKDKPWDTP++DKW IEEF PED+ASGLPFAEESSFMTLFPKYRE YLKS+W +V
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KHHIAC L+LVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVP PQA+KIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXX--XXXXXXX 238
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                 VYTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  471 bits (1211), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/271 (82%), Positives = 239/271 (88%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NKDKPWDT D+DKW IEEF PED+ SG PFAEESSFMTLFPKYRE YLKSIW +V
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KHHI C L+LVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           IACDVIKIGN VA+K+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVV DCM+N+HPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPPAQLPRKVDL+IE+GEYFLS
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLS 271

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  469 bits (1208), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/271 (82%), Positives = 241/271 (88%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NKDKPWDT D+DKW IEEF PED+ASG PFAEESSFMTLFPKYRETYLKS+WK+V
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           T+AL+ HHIAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGNIV +KERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXX-XXXXXXXX 239
           KE+RRVVEDCM N+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPPAQLPRKVDLEIE+GEYFL+
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLN 271

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  468 bits (1204), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/271 (81%), Positives = 241/271 (88%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N+DKPWDTPDVDKW IEEF PED+ASGLPFAEESSFMTLFPKYRETYLKS+W +V
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL KH++ C L+LVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXX-XXXXXXXX 239
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                +YTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLS 271

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  468 bits (1204), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/272 (81%), Positives = 241/272 (88%), Gaps = 2/272 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           M ST NKDKPWDTPD+DKW IEEF PED+ SGLPF+EESSFMTLFPKYRE YLKS+WK+V
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRALEKH I+C L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRP+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                 VYTPFPP Q PRKVDL+IE+GEYFLS
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLS 272

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  467 bits (1202), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/272 (82%), Positives = 241/272 (88%), Gaps = 2/272 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N+DKPWDT D+DKW IEEF  ED+ASG PFAEESSFMTLFPKYRE+YLK+IW +V
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KH+IAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                 VYTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  466 bits (1199), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/272 (82%), Positives = 241/272 (88%), Gaps = 2/272 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N+DKPWDT D+DKW IEEF  ED+ASG PFAEESSFMTLFPKYRE+YLK+IW +V
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KH+IAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                 VYTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  466 bits (1198), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/272 (82%), Positives = 240/272 (88%), Gaps = 2/272 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N+DKPWDT DVDKW IEEF  ED+ASG PFAEESSFMTLFPKYRE YLK+IW +V
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KH+I+C L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                 VYTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  466 bits (1200), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/272 (81%), Positives = 241/272 (88%), Gaps = 2/272 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           M ST NKDKPWDTPD+DKW IEEF PED+ SG+PFAEESSFMTLFPKYRE YLKS+W +V
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KH+IAC L+LVEGSM+VKTTR+TYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRP+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                 VYTPFPPAQ PRK+DL+IE+GEYFL+
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLT 272

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  465 bits (1196), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/271 (82%), Positives = 242/271 (89%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NK+KPWDT D+DKW  EEF PED+ASGLPFAEESSFMTLFPKYRE+YLKS+WK+V
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           T+ALEKHHIAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQAIKIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXX-XXXXX 239
           KEVRRVVEDCM N+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPP QLPRKVDLEIE+GEYFLS
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLS 271

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  463 bits (1191), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 223/272 (81%), Positives = 239/272 (87%), Gaps = 2/272 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N++KPWDT D+DKW IEEF  ED+ SG PFAEESSFMTLFPKYRE YLK+IW +V
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL+KH+IAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                 VYTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  462 bits (1190), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 219/271 (80%), Positives = 243/271 (89%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N+DKPWDTPD++KW I+EF PED+ASGLPF EESSFMTLFPKYRETYL+ +W +V
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           T++L+K+H+AC L+L+EGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQAI+ILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           IACDVIKIGN+V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXX-XXXXX 239
           KEVRRVVEDCM+N+HPIYHIKELMIKREL+KRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLS 271

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  462 bits (1189), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/271 (81%), Positives = 240/271 (88%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N+DKPWDT +++KW IEEF PED+ASGLPFAEESSFMTLFPKYRETYLKS+W +V
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL  H++AC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXX-XXXXX 239
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                +YTPFPPAQLPRKVDLEIE+GEYFLS
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLS 271

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  460 bits (1183), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/271 (80%), Positives = 238/271 (87%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NKDKPWDT D+DKW +EEF PED+ASGLPFAEESSFMTLFPKYRE YLKS+W +V
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           T+AL+K HIAC L+LVEGSM+VKTTRKT+DP  ILKARDLIKLLARSVP PQAIKIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXX-XXXXXXXX 239
           KE+RRVVEDCM+N+HPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPPAQ PRKVDLEIE+GEYFLS
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLS 271

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  460 bits (1183), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/271 (80%), Positives = 238/271 (87%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST N+DKPWDT D+DKW +EEF PED+ASGLPFAEESSFMTLFPKYRE YLKSIW +V
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           TRAL  HHIAC L+L+EGSM+VKTTRKT+DPAIIL+ARDLIKLLARSVP  QA+KIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN+VA+KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED MRN+HPIY IKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPPAQ PRK+DLEIE+GEYFLS
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLS 271

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  457 bits (1175), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 215/271 (79%), Positives = 238/271 (87%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NK+KPWDT D+DKW +E+F PED+ASG+PF+EESSFMTLFPKYRE YLKS+WK+V
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           T+AL+KHH+AC LNLV+GSM+V TTRKTYDP IILKARDLIKLLARSVP PQA+KIL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXX-XXXXX 239
           KE+RRVVED MRN+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPP+QLPRKVDLEIE+GEYFLS
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLS 271

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  443 bits (1140), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/271 (79%), Positives = 233/271 (85%), Gaps = 1/271 (0%)

Query: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60
           MVST NKDKPWDT ++DKW  +EF  ED+ASGLPFAEESSFMTLFPKYRE YLKSIW +V
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120
           T+AL K+H+AC L+LVEGSM+VKTTRKT DPAIILKARDLIKLLARSVP PQA+KIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN VA+KERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+NIHPIYHIKELMIKRELAKRPELA EDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLS 270
                VYTPFPPAQ PRKVDLEIE+GEYFL+
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLN 271

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 71/146 (48%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
            A    L  AI +L+ DD+  +  ++ ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 73/148 (49%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTTRK-TYDPAIILKARDLI 101
           + P +R T L++ W ++   L +H  +   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELL 159
           K  A    L  +I +L+ DD+  +  ++ ++   + +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKEVRRVV 187
           T+  I++  + +  +G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 81/176 (46%), Gaps = 5/176 (2%)

Query: 16  VDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEVTRALEKH-HIACELN 74
           +D+     F+  + A G     ES  + + P +R T L++ W ++   L  H  +   +N
Sbjct: 69  LDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWTKIYPPLVDHLKLQVRMN 127

Query: 75  LVEGSMSVKTTRK-TYDPAIILKARDLIKLLARSVPLPQAIKILQ-DDIACDVIKIGNI- 131
           L   S+ ++T  K T DP  + K  D IK       L  +I +L+ DD+  +  +I ++ 
Sbjct: 128 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEIKDVK 187

Query: 132 VASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVV 187
             + +   +   R+ G +G T  A+E  T+  I++    +  +G +  ++  R  V
Sbjct: 188 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHILGGFTHIRMAREAV 243

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 81/176 (46%), Gaps = 5/176 (2%)

Query: 16  VDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEVTRALEKH-HIACELN 74
           VD      F+    + G     ES  + + P +R T L++ W ++   L +H  +   +N
Sbjct: 75  VDDQGKPRFSSASRSQGSKIKFESRKI-MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMN 133

Query: 75  LVEGSMSVKTTRK-TYDPAIILKARDLIKLLARSVPLPQAIKILQ-DDIACDVIKIGNI- 131
           L   S+ ++T  K T DP  + K  D IK       L  +I +L+ DD+  +  ++ ++ 
Sbjct: 134 LKTKSVELRTNPKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 193

Query: 132 VASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVV 187
             + +   +   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 194 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 249

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  VDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEVTRALEKH-HIACELN 74
           VD      F       G     ES  + + P +R T L++ W ++   L +H  +   +N
Sbjct: 73  VDDQGKPRFTSASKTQGNKIKFESRKI-MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMN 131

Query: 75  LVEGSMSVKTTRK-TYDPAIILKARDLIKLLARSVPLPQAIKILQ-DDIACDVIKIGNI- 131
           L   S+ ++T  K T DP  + K  D IK       L  +I +L+ DD+  +  ++ ++ 
Sbjct: 132 LKTKSVELRTNPKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 191

Query: 132 VASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVV 187
             + +   +   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 192 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 247

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LK+ W ++   L  H  +   +NL   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNIVASKERFVKRR-QRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  +I ++   +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  +I ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 71/146 (48%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W ++   L +H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  ++ ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 79/176 (44%), Gaps = 5/176 (2%)

Query: 16  VDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEVTRALEKH-HIACELN 74
           VD      F       G     ES  + + P +R T L++ W ++   L +H  +   +N
Sbjct: 73  VDDQGKPRFTSASKTQGNKIKFESRKI-MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMN 131

Query: 75  LVEGSMSVKTTRK-TYDPAIILKARDLIKLLARSVPLPQAIKILQ-DDIACDVIKIGNI- 131
           L   S+ ++T  K T DP  + K  D IK       L  +I +L+ DD+  +  ++ ++ 
Sbjct: 132 LKTKSVELRTNPKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 191

Query: 132 VASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVV 187
             + +   +   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 192 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 247

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 81/176 (46%), Gaps = 5/176 (2%)

Query: 16  VDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEVTRALEKH-HIACELN 74
           +D      F     +SG     ES  + + P +R T L++ W ++   L +H  +   +N
Sbjct: 68  LDDQGKPRFGSAKKSSGERVKIESRKVGV-PPHRMTPLRNNWTKIYPPLVEHLKLQVRMN 126

Query: 75  LVEGSMSVKTT-RKTYDPAIILKARDLIKLLARSVPLPQAIKILQ-DDIACDVIKIGNI- 131
           L   S+ +++  R+T DP  + K  D IK       L  +I +L+ DD+  +  ++ ++ 
Sbjct: 127 LKTKSVELRSHPRQTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 186

Query: 132 VASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVV 187
             + +   +   R+ G +G T  A+E  T+  I++    +  +G +  ++  R  V
Sbjct: 187 TLNGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADAKIHILGGFTHIRMAREAV 242

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 81/176 (46%), Gaps = 5/176 (2%)

Query: 16  VDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEVTRALEKH-HIACELN 74
           +D+     F+  + AS      ES  + + P +R T L++ W ++   L  H  +   +N
Sbjct: 76  LDEQGKPRFSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMN 134

Query: 75  LVEGSMSVKTT-RKTYDPAIILKARDLIKLLARSVPLPQAIKILQ-DDIACDVIKIGNIV 132
           L   S+ ++T  + T DP  + K  D IK       L  +I +L+ DD+  +  ++ ++ 
Sbjct: 135 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 194

Query: 133 ASKERFVKRR-QRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVV 187
                 + R   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 195 TLHGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNIVASKERFVKRR-QRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  +I ++       + R   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++    +  +G +  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  +I ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  AI +L+ DD+  +  +I ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 71/146 (48%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R T L++ W ++   L +H  +   +NL   S+ ++T  + T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  +I ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  AI +L+ DD+  +  +I ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  ++ ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  +I ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++    +  +G +  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 70/146 (47%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLKSIWKEVTRALEKH-HIACELNLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R T L++ W ++   L  H  +   +NL   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPLPQAIKILQ-DDIACDVIKIGNI-VASKERFVKRRQRLVGPNGNTLKALELLTK 161
                 L  +I +L+ DD+  +  ++ ++   + +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 70/172 (40%), Gaps = 37/172 (21%)

Query: 54  KSIWKEVTRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQA 113
           +++W  V RAL +   A    L  GS SV            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --IKILQDDIACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPYKGLKEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRF 223
            + G YK L  +      CM  +  I HI ++  + + A+ P+  E+D S  
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ--EQDLSEL 140

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTL+ L+  +KC I ++G
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG 174

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 110  LPQAIKILQDDIA-CDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILV-- 166
            L +A K+++D IA   ++     V SK+   K+   +VGPNG  ++ +   TK  I V  
Sbjct: 1118 LEKASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPR 1175

Query: 167  ----QGNTVSAMGPYKGLKEVRRVVEDCMR 192
                  N +  +G  +G+K+   ++  C R
Sbjct: 1176 KSDKVNNVIYVLGSEEGVKKAAELI--CKR 1203

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVVEDCMRNIH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        NIH
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKRPELAEEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>SAKL0D08822g Chr4 complement(734328..734879) [552 bp, 183 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 183

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 18/83 (21%)

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVVEDCMRNIHPIYH 199
           K+RQ+L GP    LK +  L KC          + G YK      R    CM  ++ I H
Sbjct: 78  KKRQKLYGPGKKQLKMIHHLNKC---------PSCGHYK------RANTLCMHCVNEIRH 122

Query: 200 IKELMIK---RELAKRPELAEED 219
           I +       +E A+  EL+E D
Sbjct: 123 IWKTQTTENPQEPAQEQELSELD 145

>Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734)
            [3912 nt, 1304 aa]
          Length = 1303

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 33/120 (27%)

Query: 21   IEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEVTRALEKHHIAC--------- 71
            I+E +  D +S +  + ES F   F K R          +TRA++   + C         
Sbjct: 1058 IQEDSEHDKSSNINSSMES-FYDPFTKLR----------LTRAIDIFSLGCVFYYVLSNG 1106

Query: 72   ----------ELNLVEGSMSVKTTRKTY-DPAIILKARDLIKLLARSVPL--PQAIKILQ 118
                      E N+++G+ S+     T  +PA++++A+DLI+ +  + PL  P A  +L+
Sbjct: 1107 QHPFGDRYMREANIIKGNYSLHDLDSTVGNPALVIEAKDLIEKMLDNDPLKRPSASNVLK 1166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,390,524
Number of extensions: 1044471
Number of successful extensions: 2617
Number of sequences better than 10.0: 49
Number of HSP's gapped: 2659
Number of HSP's successfully gapped: 49
Length of query: 343
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 233
Effective length of database: 40,868,139
Effective search space: 9522276387
Effective search space used: 9522276387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)