Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR743W1.8ON82824083e-53
Ecym_10101.8ON82823605e-46
SAKL0C00528g1.8ON110823626e-46
KLTH0F00550g1.8ON82823553e-45
Kwal_33.130161.8ON82823284e-41
ZYRO0F18414g1.8ON87763261e-40
Kpol_2002.111.8ON86793223e-40
CAGL0B00396g1.8ON88873155e-39
TPHA0E039801.8ON86803121e-38
TBLA0A049601.8ON96733095e-38
NCAS0B090801.8ON93703001e-36
KLLA0C00550g1.8ON82822981e-36
YCL057C-A (MOS1)1.8ON97962983e-36
TDEL0C069401.8ON86812921e-35
Skud_3.61.8ON97962931e-35
Smik_3.171.8ON97692922e-35
Suva_3.1551.8ON97962922e-35
NDAI0A001701.8ON96772471e-28
KAFR0D001701.8ON90892443e-28
KNAG0C002501.8ON94802435e-28
Kwal_47.167334.378ON33943670.33
SAKL0C10230g3.119ON97151660.42
SAKL0H19646g8.163ON155125660.45
KLTH0D17358g4.378ON33942660.53
Smik_10.4364.378ON34242621.4
KLLA0B03784g4.378ON34242621.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR743W
         (82 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   161   3e-53
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   143   5e-46
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   144   6e-46
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   141   3e-45
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   130   4e-41
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   130   1e-40
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   128   3e-40
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   125   5e-39
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   124   1e-38
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   123   5e-38
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   120   1e-36
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   119   1e-36
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   119   3e-36
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   117   1e-35
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   117   1e-35
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   117   2e-35
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   117   2e-35
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   100   1e-28
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    99   3e-28
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    98   5e-28
Kwal_47.16733 s47 (87799..88818) [1020 bp, 339 aa] {ON} YJR142W ...    30   0.33 
SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} simila...    30   0.42 
SAKL0H19646g Chr8 complement(1731049..1735704) [4656 bp, 1551 aa...    30   0.45 
KLTH0D17358g Chr4 complement(1440848..1441867) [1020 bp, 339 aa]...    30   0.53 
Smik_10.436 Chr10 (686200..687228) [1029 bp, 342 aa] {ON} YJR142...    28   1.4  
KLLA0B03784g Chr2 complement(341886..342914) [1029 bp, 342 aa] {...    28   1.6  

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  161 bits (408), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60
          MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL
Sbjct: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRAVRA 82
          GRGYAEGDAIFRSHAGLRAVRA
Sbjct: 61 GRGYAEGDAIFRSHAGLRAVRA 82

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  143 bits (360), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%)

Query: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60
          M  +LEV+APSRSILNDKWDVVLSNLVVK GLGF  GV ASVLFFKRRAFPVWLG+GFGL
Sbjct: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRAVRA 82
          GRGYAEGDAIFRSHAGLR ++A
Sbjct: 61 GRGYAEGDAIFRSHAGLRTMKA 82

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  144 bits (362), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%)

Query: 1   MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60
           MS QL+VS P++SILNDKWDVVLSN+VVKTGLGFGAG+ ASVL FKRRAFPVWLGVGFGL
Sbjct: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88

Query: 61  GRGYAEGDAIFRSHAGLRAVRA 82
           GRGYAEGDAIFRS AGLR V A
Sbjct: 89  GRGYAEGDAIFRSSAGLRTVNA 110

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  141 bits (355), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 71/82 (86%), Positives = 75/82 (91%)

Query: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60
          MS QL+VS  SRS+LNDKWDVVLSNLVVKTGLGFGAGV ASVL FKRRAFPVW+GVGFGL
Sbjct: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRAVRA 82
          GRGYAEGDAIFRS AGLR V+A
Sbjct: 61 GRGYAEGDAIFRSSAGLRTVKA 82

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  130 bits (328), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (87%)

Query: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60
          MS Q +++  SRS+LNDKWDVVLSNLVVK GLGFGAGV ASVL FKRRA PVW+GVGFGL
Sbjct: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRAVRA 82
          GRGY+EGDAIFRS AGLR V+A
Sbjct: 61 GRGYSEGDAIFRSSAGLRTVKA 82

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  130 bits (326), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 63/76 (82%), Positives = 70/76 (92%)

Query: 7  VSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAE 66
          V+AP++SILNDKWDVVLSNL+VK+GLGFG GV ASVL FKRRAFPVWLG+GFGLGRGYAE
Sbjct: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71

Query: 67 GDAIFRSHAGLRAVRA 82
          GDAIFRS AGLR  +A
Sbjct: 72 GDAIFRSAAGLRTSKA 87

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  128 bits (322), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (89%), Gaps = 1/79 (1%)

Query: 1  MSGQLEV-SAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFG 59
           S +L++ SAP+RSILNDKWDVVLSN +VKT LGFGAGV ASV+ FKRRAFPVWLG+GFG
Sbjct: 4  QSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFG 63

Query: 60 LGRGYAEGDAIFRSHAGLR 78
          +GRGY+EGDAIFRS AGLR
Sbjct: 64 IGRGYSEGDAIFRSAAGLR 82

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  125 bits (315), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 70/87 (80%), Gaps = 6/87 (6%)

Query: 1  MSGQLEVSA------PSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWL 54
          MS + E  A      P RSILNDKWDVVLSN++VK GLGFG GV  SVLFFKRR+FPVWL
Sbjct: 1  MSNKEETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWL 60

Query: 55 GVGFGLGRGYAEGDAIFRSHAGLRAVR 81
          GVGFG GRGY+EGDAIFRS AGLR+V+
Sbjct: 61 GVGFGAGRGYSEGDAIFRSTAGLRSVK 87

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  124 bits (312), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 71/80 (88%), Gaps = 1/80 (1%)

Query: 2  SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLG 61
          +  LE+++P +SILNDKWDVVLSN++VKTGLGFG GV  S+L FKRRAFPVWLG+GFG+G
Sbjct: 7  NNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVG 65

Query: 62 RGYAEGDAIFRSHAGLRAVR 81
          RGY++GDAIFRS AGLR+ R
Sbjct: 66 RGYSDGDAIFRSAAGLRSTR 85

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  123 bits (309), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%)

Query: 9  APSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGD 68
            +RSILNDKWD+V+SN++VKT  GFGAGV ASV+FFKRRAFPVWLGVGFGLGRGY+EGD
Sbjct: 23 TSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGD 82

Query: 69 AIFRSHAGLRAVR 81
          AIFRS AGLR+ +
Sbjct: 83 AIFRSTAGLRSFQ 95

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 62/70 (88%)

Query: 12 RSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGDAIF 71
          RSILNDKWDVVLSN++VK GLGF  GV ASV+FFKRR FPVWLG+GFG+GRGYAEGDAIF
Sbjct: 23 RSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIF 82

Query: 72 RSHAGLRAVR 81
          RS AGLR  +
Sbjct: 83 RSPAGLRTAK 92

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  119 bits (298), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 68/82 (82%)

Query: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60
          MS Q++ +    SIL+ +WDVVLSN+V KT LG G G+ ASVLFFKRRAFPVW+GVGFGL
Sbjct: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRAVRA 82
          GRGYAEGDAIFR++AGLR V A
Sbjct: 61 GRGYAEGDAIFRTNAGLRKVNA 82

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  119 bits (298), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSGQLEVSAPSRS---------------ILNDKWDVVLSNLVVKTGLGFGAGVFASVLFF 45
          MS Q +   P++S               IL+ KWD+VLSN++VKT +GFG GVF SVLFF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAFPVWLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81
          KRRAFPVWLG+GFG+GRGYAEGDAIFRS AGLR+ +
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  117 bits (292), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 68/81 (83%), Positives = 75/81 (92%)

Query: 2  SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLG 61
            QL+V+APSRSILNDKWDVVLSN++VKTGLGFG GV  SVLFFKRRAFPVWLG+GFGLG
Sbjct: 6  QAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGFGLG 65

Query: 62 RGYAEGDAIFRSHAGLRAVRA 82
          RGYAEGDAIFRS AGLR+V+A
Sbjct: 66 RGYAEGDAIFRSAAGLRSVKA 86

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (73%), Gaps = 15/96 (15%)

Query: 1  MSGQLEVSAPSRS---------------ILNDKWDVVLSNLVVKTGLGFGAGVFASVLFF 45
          MS Q ++  P++S               IL+ KWD+V+SN++VKT +GFG GVF SVLFF
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAFPVWLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81
          KRRAFPVWLG+GFG+GRGYAEGDAIFRS AGLR+ +
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 63/69 (91%)

Query: 13 SILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGDAIFR 72
          ++L+ KWD+VLSN++VKT +GFG GVF SVLFFKRRAFPVWLG+GFG+GRGYAEGDAIFR
Sbjct: 28 TVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 73 SHAGLRAVR 81
          S AGLR+ +
Sbjct: 88 SSAGLRSSK 96

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSGQLEVSAPSRS---------------ILNDKWDVVLSNLVVKTGLGFGAGVFASVLFF 45
          MS Q +  AP++S               +L+ KWD+VLSN++VKT +GFG GVF SVLFF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 46 KRRAFPVWLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81
          KRRAFP WLG+GFG+GRGYAEGDAIFRS AGLR+ +
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 99.8 bits (247), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 65/77 (84%)

Query: 4  QLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRG 63
          Q +++   +SILNDKWD+VLSN +VK GLGFG GV  SV+FFKRR FPVWLG+GFG GRG
Sbjct: 18 QQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVWLGIGFGAGRG 77

Query: 64 YAEGDAIFRSHAGLRAV 80
          YAEGDAIFRS AG+R+V
Sbjct: 78 YAEGDAIFRSSAGIRSV 94

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 98.6 bits (244), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (79%), Gaps = 8/89 (8%)

Query: 1  MSGQLEVSAPS--------RSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPV 52
          MS + +V  P+        RSILNDKWD+VLSN++VK GLGFG GV  SV+FFKRRAFPV
Sbjct: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPV 60

Query: 53 WLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81
          WLG+G+G GR Y+EGDAIFRS+AGLR+V+
Sbjct: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 98.2 bits (243), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 68/80 (85%), Gaps = 1/80 (1%)

Query: 2  SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLG 61
          +GQL  +   RS+LNDKWDVVLSN++VK G+GFG GV  SVL F+RRAFPVWLG+GFG+G
Sbjct: 15 NGQL-ATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVG 73

Query: 62 RGYAEGDAIFRSHAGLRAVR 81
          RGY+EGDAIFRS +G+R V+
Sbjct: 74 RGYSEGDAIFRSTSGIRTVK 93

>Kwal_47.16733 s47 (87799..88818) [1020 bp, 339 aa] {ON} YJR142W -
           Hypothetical ORF [contig 376] FULL
          Length = 339

 Score = 30.4 bits (67), Expect = 0.33,   Method: Composition-based stats.
 Identities = 11/43 (25%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 1   MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVL 43
           ++G++++  P RS     W ++  N ++  GLG  +G++ +V+
Sbjct: 165 LTGEIKIWVPRRSATKPTWPLMFDN-IIAGGLGHPSGIYETVI 206

>SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 971

 Score = 30.0 bits (66), Expect = 0.42,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 34  FGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGDAIFRSHA---GLRAVR 81
           F AG  A+ L+FKRR  P++  V     R YA G+  F   A   GLR ++
Sbjct: 677 FLAGTVAAHLYFKRRFIPLFDAVPLSAIR-YARGEPTFLYPARDQGLREIK 726

>SAKL0H19646g Chr8 complement(1731049..1735704) [4656 bp, 1551 aa]
            {ON} similar to uniprot|P32319 Saccharomyces cerevisiae
            YBL017C PEP1 Type I transmembrane sorting receptor for
            multiple vacuolar hydrolases cycles between the
            late-Golgi and prevacuolar endosome-like compartments
          Length = 1551

 Score = 30.0 bits (66), Expect = 0.45,   Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 25   NLVVKTGLGFGAGVFASVLFFKRRA 49
            N +VK+G+ F +GVFA++  FKR++
Sbjct: 1430 NSIVKSGVIFVSGVFAALQLFKRKS 1454

>KLTH0D17358g Chr4 complement(1440848..1441867) [1020 bp, 339 aa]
           {ON} similar to uniprot|P47173 Saccharomyces cerevisiae
           YJR142W Hypothetical ORF
          Length = 339

 Score = 30.0 bits (66), Expect = 0.53,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 2   SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVL 43
           +G+++   P RS     W + L N +V  GLG+  G+F +V+
Sbjct: 166 TGEIKFWIPRRSASKPTWPLKLDN-IVAGGLGYPNGIFETVI 206

>Smik_10.436 Chr10 (686200..687228) [1029 bp, 342 aa] {ON} YJR142W
           (REAL)
          Length = 342

 Score = 28.5 bits (62), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 2   SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVL 43
           S +++   P RS     W ++L N ++  G+G+  G++ +VL
Sbjct: 169 SKKIQFWVPRRSATKQTWPLMLDN-IIAGGVGYPYGIYETVL 209

>KLLA0B03784g Chr2 complement(341886..342914) [1029 bp, 342 aa] {ON}
           similar to uniprot|P47173 Saccharomyces cerevisiae
           YJR142W
          Length = 342

 Score = 28.5 bits (62), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 2   SGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVL 43
           SG+++   P RS     W  +L N +V  G+G   G++ +VL
Sbjct: 169 SGEIKFWIPRRSATKPTWPSMLDN-IVAGGIGHPHGIYETVL 209

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.142    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,428,713
Number of extensions: 239603
Number of successful extensions: 725
Number of sequences better than 10.0: 26
Number of HSP's gapped: 724
Number of HSP's successfully gapped: 26
Length of query: 82
Length of database: 53,481,399
Length adjustment: 54
Effective length of query: 28
Effective length of database: 47,289,435
Effective search space: 1324104180
Effective search space used: 1324104180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)