Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR743CA1.7ON1011012924e-35
TBLA0A049501.7ON11347710.082
NCAS0B090901.7ON11939670.32
ZYRO0F18436g1.7ON112103670.35
SAKL0C00506g1.7ON10594660.44
Skud_3.51.7ON11318622.0
YCL058W-A (ADF1)1.7ON11318612.2
Smik_3.161.7ON11318585.5
NOTE: 11 genes in the same pillar as AFR743CA were not hit in these BLAST results
LIST: Kpol_2002.10 KAFR0D00160 Suva_3.154 KLTH0F00528g Kwal_YGOB_YCL058W-A TDEL0C06950 KLLA0C00528g KNAG0C00240 TPHA0E03990 NDAI0A00160 CAGL0B00374g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR743CA
         (101 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...   117   4e-35
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    32   0.082
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    30   0.32 
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    30   0.35 
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    30   0.44 
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    28   2.0  
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    28   2.2  
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    27   5.5  

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score =  117 bits (292), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 67/101 (66%)

Query: 1   MAAFQHRAKRSKNGASAKQGKISKADKKRAKLQVEKLDKRGVXXXXXXXXXXXXKTGVXX 60
           MAAFQHRAKRSKNGASAKQGKISKADKKRAKLQVEKLDKRGV            KTGV  
Sbjct: 1   MAAFQHRAKRSKNGASAKQGKISKADKKRAKLQVEKLDKRGVLLAELTAAAPAAKTGVLQ 60

Query: 61  XXXXXXXXXXXXXXXXXXXXERSNVDKKVVQQLEAIAGFSL 101
                               ERSNVDKKVVQQLEAIAGFSL
Sbjct: 61  AASLAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
          YCL058W-A
          Length = 113

 Score = 32.0 bits (71), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 7/47 (14%)

Query: 1  MAAFQHRAKRSKNGASA-------KQGKISKADKKRAKLQVEKLDKR 40
          MA    R+K  K+G +        K  KIS  DKKRAKLQVEK++K+
Sbjct: 1  MAKTTVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQ 47

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa]
          {ON} Anc_1.7 YCL058W-A
          Length = 119

 Score = 30.4 bits (67), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%)

Query: 2  AAFQHRAKRSKNGASAKQGKISKADKKRAKLQVEKLDKR 40
          AA  +R K  KN     +  IS +D+K+AK QVEKL+K+
Sbjct: 11 AATNNRNKTGKNQVKKNKNSISFSDRKKAKHQVEKLNKK 49

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 30.4 bits (67), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 41/103 (39%), Gaps = 8/103 (7%)

Query: 7   RAKRSK--NGASAKQGKISKADKKRAKLQVEKLDKRGVXXXX------XXXXXXXXKTGV 58
           +A RSK  NG    +  IS +DKKR K +VEKLD +G+                   +  
Sbjct: 10  KAVRSKHNNGFKKPKKSISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRSASSKTSNGSSS 69

Query: 59  XXXXXXXXXXXXXXXXXXXXXXERSNVDKKVVQQLEAIAGFSL 101
                                 ++   D  ++QQ+E I+GFSL
Sbjct: 70  LLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 30.0 bits (66), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 37/94 (39%), Gaps = 5/94 (5%)

Query: 13  NGASAKQGKISKADKKRAKLQVEKLDKR-----GVXXXXXXXXXXXXKTGVXXXXXXXXX 67
           NG+    G I K+ KKR ++QVE+L+K+      +            K            
Sbjct: 12  NGSKKPSGGIKKSQKKRTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKPKTLQAKALAQD 71

Query: 68  XXXXXXXXXXXXXERSNVDKKVVQQLEAIAGFSL 101
                        +R + +  ++ QLE I+GFSL
Sbjct: 72  QKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A
          (REAL)
          Length = 113

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 22 ISKADKKRAKLQVEKLDK 39
          IS A++KR KLQVEKL+K
Sbjct: 27 ISTAERKRTKLQVEKLNK 44

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
          ADF1Transcriptional repressor encoded by the antisense
          strand of the FYV5 gene; negatively regulates
          transcription of FYV5 by binding to the promoter on the
          sense strand
          Length = 113

 Score = 28.1 bits (61), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 22 ISKADKKRAKLQVEKLDK 39
          IS A++KR KLQVEKL+K
Sbjct: 27 ISTAERKRTKLQVEKLNK 44

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
          (REAL)
          Length = 113

 Score = 26.9 bits (58), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 22 ISKADKKRAKLQVEKLDK 39
          IS A KKR KLQVEKL+K
Sbjct: 27 ISTAVKKRTKLQVEKLNK 44

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.124    0.315 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,186,997
Number of extensions: 90306
Number of successful extensions: 625
Number of sequences better than 10.0: 21
Number of HSP's gapped: 618
Number of HSP's successfully gapped: 21
Length of query: 101
Length of database: 53,481,399
Length adjustment: 72
Effective length of query: 29
Effective length of database: 45,225,447
Effective search space: 1311537963
Effective search space used: 1311537963
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)