Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR741Wna 1ON40740721790.0
Ecym_1013na 1ON41141111811e-160
KLTH0F00594gna 1ON43340810031e-133
Kwal_33.13025na 1ON4234069981e-132
SAKL0H24838gna 1ON4104069561e-126
ZYRO0D05434gna 1ON4284257287e-92
TDEL0H03670na 1ON4264307061e-88
KNAG0G014608.165ON52672751.1
Kwal_14.21188.165ON52237713.3
NCAS0I027501.195ON58369713.5
NCAS0C010208.735ON1103112695.9
AFR071W1.251ON157770696.5
NCAS0A023604.222ON47844687.2
NDAI0I028903.517ON58280687.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR741W
         (407 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667;...   843   0.0  
Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON} s...   459   e-160
KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON...   390   e-133
Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON...   389   e-132
SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON} cons...   372   e-126
ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...   285   7e-92
TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON}              276   1e-88
KNAG0G01460 Chr7 complement(330137..331717) [1581 bp, 526 aa] {O...    33   1.1  
Kwal_14.2118 s14 (613466..615034) [1569 bp, 522 aa] {ON} YBL019W...    32   3.3  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...    32   3.5  
NCAS0C01020 Chr3 (188484..191795) [3312 bp, 1103 aa] {ON} Anc_8....    31   5.9  
AFR071W Chr6 (547832..552565) [4734 bp, 1577 aa] {ON} Syntenic h...    31   6.5  
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     31   7.2  
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    31   7.2  

>AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667; No
           homolog in Saccharomyces cerevisiae
          Length = 407

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/407 (100%), Positives = 407/407 (100%)

Query: 1   MEKSETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLK 60
           MEKSETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLK
Sbjct: 1   MEKSETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLK 60

Query: 61  KPRLQTQQSLSRYFGLKKSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLPAALAERLL 120
           KPRLQTQQSLSRYFGLKKSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLPAALAERLL
Sbjct: 61  KPRLQTQQSLSRYFGLKKSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLPAALAERLL 120

Query: 121 EVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNGRISTLTSYNADLCEA 180
           EVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNGRISTLTSYNADLCEA
Sbjct: 121 EVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNGRISTLTSYNADLCEA 180

Query: 181 QRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYIGPHAIVA 240
           QRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYIGPHAIVA
Sbjct: 181 QRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYIGPHAIVA 240

Query: 241 SLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKKVSAAE 300
           SLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKKVSAAE
Sbjct: 241 SLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKKVSAAE 300

Query: 301 LHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWICSRGYSSG 360
           LHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWICSRGYSSG
Sbjct: 301 LHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWICSRGYSSG 360

Query: 361 NDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEALNFRKS 407
           NDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEALNFRKS
Sbjct: 361 NDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEALNFRKS 407

>Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AFR741W
          Length = 411

 Score =  459 bits (1181), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/411 (52%), Positives = 293/411 (71%), Gaps = 10/411 (2%)

Query: 1   MEKSETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPA--DEKDARP 58
           M   +TTDEKLA L+ + PSA+ E LLD+LV C G++ +A  LL    +    +E+ + P
Sbjct: 1   MNVDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSPP 60

Query: 59  LKKPRLQTQQSLSRYFGLK----KSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLPAA 114
            K  +++ QQSLS +  L+    +   P+  G+PI+L+GK+DIE  L+YCTYHT+VLP  
Sbjct: 61  RKVAKVKGQQSLSSFLPLQSLYNRQSRPS--GKPIILYGKKDIELELKYCTYHTDVLPEE 118

Query: 115 LAERLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNG-RISTLTSY 173
           LA RLL+  M ++ +KPNEFYLFG++CV+NCR+ +Y NL  A+    +YNG R+ T+  +
Sbjct: 119 LANRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLS-AEEDDYYYNGMRVQTVNRF 177

Query: 174 NADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYI 233
           N D+   + I+E LVN +L KR  LPFQ   G W+ PV ++NIY KDSDLQWHSDR+TYI
Sbjct: 178 NDDMVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYI 237

Query: 234 GPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKR 293
           GPH+++A+L+LGF R  R RRVYP++SQIY++   HNSVLIMHAGCQEEFKHCVPPL K 
Sbjct: 238 GPHSVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKN 297

Query: 294 KKVSAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWIC 353
            ++S + ++PIS + RVSLTFR YKV+      C +CGYPMDLRR YKTP KRGHYIW+C
Sbjct: 298 HQISKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLC 357

Query: 354 SRGYSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEALNF 404
           ++ Y++GN  + +  C G+K+A  +   P T  ESEG+ W+ADDDFEAL F
Sbjct: 358 TKSYTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEALKF 408

>KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON}
           conserved hypothetical protein
          Length = 433

 Score =  390 bits (1003), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 190/408 (46%), Positives = 268/408 (65%), Gaps = 22/408 (5%)

Query: 4   SETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLKKPR 63
           + +T+EK+A+L+ + P    + LLDVLV CGG+L+ +A LL +   P         K+ +
Sbjct: 30  ARSTEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPESSS-----KRFK 84

Query: 64  LQTQQSLSRYFGLKKSPVPAL------GGRPIVLHGKRDIEGALRYCTYHTNVLPAALAE 117
            + QQ+L+R+  ++  P  A+        RPI LH K D+E  L+YCTYH NVLP  LA 
Sbjct: 85  SRQQQTLNRFLDVRLLPKAAIKTNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLELAN 144

Query: 118 RLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLY---GNLDPADAGRVFYNG-RISTLTSY 173
           +LLE +  D   KPNEFYLFG++C++NC++ ++     ++P      +YNG R+ + ++Y
Sbjct: 145 KLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEP-----FYYNGKRVESYSTY 199

Query: 174 NADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYI 233
           + ++  AQ +VE LVN  L++R  LPFQV AG W     ++N Y +DS+L WHSDRLT I
Sbjct: 200 SDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNI 259

Query: 234 GPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKR 293
           GPHAI+ASL+LGF REFR+RRV+P++S  YS+   HNS++IMHAG QEE+KHCVP L K 
Sbjct: 260 GPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKN 319

Query: 294 KKVSAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWIC 353
             + A ++HPIS  VRV+LTFR+Y +       C  CG+PMDLRR++K PSKRG YI+ C
Sbjct: 320 CNIPAEDVHPISNDVRVNLTFRNYALT--TKVFCKLCGFPMDLRRSFKDPSKRGLYIFQC 377

Query: 354 SRGYSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEA 401
           S+ Y+  N       CKG  +AC    PP T+ E++G+ W+ADDD EA
Sbjct: 378 SKSYTEENSFKEGRECKGFAFACFKKKPPFTEFETDGSRWIADDDLEA 425

>Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON}
           [contig 123] FULL
          Length = 423

 Score =  389 bits (998), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 189/406 (46%), Positives = 268/406 (66%), Gaps = 13/406 (3%)

Query: 4   SETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLKKPR 63
           +++TDEKL  LK + P  DT+ LLDVLV C G+L+ +A  L   +   D  D  P K+ +
Sbjct: 2   AQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHP-KRLK 60

Query: 64  LQTQQSLSRYFGLK-------KSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLPAALA 116
            ++QQSLSRY  +        K P      RP+ LHGK  IE  + YCTYHT+VLP+ +A
Sbjct: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120

Query: 117 ERLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNGR-ISTLTSYNA 175
           ++LL+ ++ D   KPN+FYLFG+ C +NC + L+  +  A     FYNG+ +    +Y  
Sbjct: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLF--VPEAREKPFFYNGKEVKNPGNYTD 178

Query: 176 DLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYIGP 235
           ++  AQ ++E++VN  ++KR  LPFQV A  W     ++N+Y+KDS+L WHSDRLT IGP
Sbjct: 179 EMMLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGP 238

Query: 236 HAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKK 295
            AI+ASL+LGF REFR+R+ YP++SQ++S+   HNS++IMHAG QEE+KHCVP LGK  +
Sbjct: 239 QAIIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSR 298

Query: 296 VSAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWICSR 355
           +   +LHPISG+ RV+LT+R+Y +    +  C  CG PM+LRRT+K P KRG YI+ CSR
Sbjct: 299 IPKEDLHPISGTTRVNLTYRNYVMT--ENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSR 356

Query: 356 GYSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEA 401
            Y++ N       CKG  +A    +PP+  ++SEG+ WLA+DD EA
Sbjct: 357 SYTAANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEA 402

>SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON}
           conserved hypothetical protein
          Length = 410

 Score =  372 bits (956), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/406 (45%), Positives = 260/406 (64%), Gaps = 11/406 (2%)

Query: 2   EKSETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLKK 61
           E   TT+EK+ KL  + P AD E LL+VL  C G++ +A +L+   +    ++     K+
Sbjct: 5   EMESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQ-LYSTKR 63

Query: 62  PRLQTQQSLSRYFG--LKKSPV---PALGGRPIVLHGKRDIEGALRYCTYHTNVLPAALA 116
            + +TQ +L++     L K  +   P     PI LH K ++E  L YCTYH ++LP+ +A
Sbjct: 64  LKAKTQSTLTKLLSDSLTKPGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPSEVA 123

Query: 117 ERLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNGR-ISTLTSYNA 175
            ++LE+VM D+ A+ NEFYLFG++C +N +T +Y   +   A  + YNGR I  +  Y  
Sbjct: 124 NKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKA--LTYNGRVIDDVGEYTD 181

Query: 176 DLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYIGP 235
           ++  A  ++E  VN  L  R  LP+QV  G W   +AVAN+Y+ DS+LQWHSDRLT IGP
Sbjct: 182 EMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGP 241

Query: 236 HAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKK 295
            AIVASL+LGF REFR+R +YP+DSQ+YSI   HNS+LIMHAG QEE+KHCVPP+ K  +
Sbjct: 242 QAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSR 301

Query: 296 VSAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWICSR 355
           V   E HPISG+ RV++T+R+  +   +   C +CGYPM+LRRT+K P  RG Y+W CS+
Sbjct: 302 VPKDEFHPISGTTRVNMTYRNRIM--KKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSK 359

Query: 356 GYSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEA 401
            Y+  ND      CKG++YA  +    VTD ES  + WLADDD +A
Sbjct: 360 SYTEENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQA 405

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score =  285 bits (728), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 171/425 (40%), Positives = 246/425 (57%), Gaps = 37/425 (8%)

Query: 4   SETTDEKLAKL-KAIIP-SADTEAL-LDVLVCCGGNLEEAAALLRN--GIDPADEKDARP 58
           +E   E+L+KL + I+P S +TE+  L++LV C GNLE A  L+ +  G+    E D   
Sbjct: 7   TEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETDILC 66

Query: 59  LK--------KPRLQTQQSLSRYF--------GLKKSPVPALGGRPIVLHGKRDIEGALR 102
            K         P  + Q+SL+ +          + +  +  +  R I L  K DIE  ++
Sbjct: 67  AKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKEDIETNIK 126

Query: 103 YCTYHTNVLPAALAERLLEVVMTDERA-KPNEFYLFGSRCVTNCRTLLYGNLDPADAG-- 159
           Y + H NVLP  LA  LL+ +  D  +  PN+FYLFG +C +N  T ++ + +   AG  
Sbjct: 127 YVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISAGNI 186

Query: 160 RVFYNG-RISTLTSYNADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYE 218
           R++YN   +S +  Y+ DL  AQ ++E LVN  +A+R  LP+Q+ + +W+  V + N Y 
Sbjct: 187 RIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVNRYY 246

Query: 219 KDSDLQWHSDRLTYIGPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAG 278
           K+S+L WHSD++T IGP  I+ASL+LG  REFR+R+ YP++SQIY I   HN+++IMHAG
Sbjct: 247 KESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIMHAG 306

Query: 279 CQEEFKHCVPPLGKRKKVSAAELHPISGSVRVSLTFRHYKVDF-PRDALCPECGYPMDLR 337
            QEE++HCV       K S  + HPISG VR++LT+R Y   F  R   C +CG PMDLR
Sbjct: 307 FQEEYRHCV---HGHSKNSPLKPHPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPMDLR 363

Query: 338 RTYKTPSKRGHYIWICSRGYSSGNDKSVESFCKGIKYACVDA-SPPVTDIESEGNVWLAD 396
           R +K P  RG YIW CS+ Y+          C G+  A  D  S  V + + EG+ WLA 
Sbjct: 364 RAFKDPKTRGQYIWQCSKSYTGQE-------CGGVIRAKFDNDSLTVQNFDEEGSRWLAP 416

Query: 397 DDFEA 401
           DD EA
Sbjct: 417 DDQEA 421

>TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score =  276 bits (706), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 171/430 (39%), Positives = 242/430 (56%), Gaps = 40/430 (9%)

Query: 7   TDEKLAKL----KAIIP-SADTEA-LLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLK 60
           T+EK+A L    + +IP S DTE+ LL++L  C G+++ A+ +L   +  A + D    K
Sbjct: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61

Query: 61  KPR---------LQTQQSLSRYF---GLKKSPVPA-----LGGRPIVLHGKRDIEGALRY 103
           + R          + Q+SL+++      K  P+ +        R I L  K D+E  + Y
Sbjct: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIGY 121

Query: 104 CTYHTNVLPAALAERLLEVVMTD-ERAKPNEFYLFGSRCVTNCRTLLYGNLDPA---DAG 159
            T H   LP   A  LL  +M D E   P EF+LFG++C +N  +  Y + DPA      
Sbjct: 122 VTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSS-DPAILDGRD 180

Query: 160 RVFYNGRISTLTSYNADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEK 219
           +++YN R  T+  YN  L   Q ++E +VN  + K   LPFQ+ + +W+  V + N Y K
Sbjct: 181 KIYYNNRRGTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240

Query: 220 DSDLQWHSDRLTYIGPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGC 279
              L WHSDRLT IGP  IVASL+LG  REFR+RR YP+DSQIY +   HNS++IMHAG 
Sbjct: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300

Query: 280 QEEFKHCVPPLGKRKKVSAAELHPISGSVRVSLTFRHYKVDFPRDA-LCPECGYPMDLRR 338
           QEE++H V    ++    A  LHPIS  VR +LT+R Y   +  +A  CP+C  PMDLRR
Sbjct: 301 QEEYRHSV---HQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRR 357

Query: 339 TYKTPSKRGHYIWICSRGYSSGNDKSVESFCKGIKYACVDASPPVTDIES-EGNVWLADD 397
            +K P +RG YIW CS  YS      VE  C G++ A  + +  V +  + EG+ WLADD
Sbjct: 358 AFKDPERRGQYIWQCSSHYS-----GVE--CGGVRLADFNCNSLVVEKNAGEGSRWLADD 410

Query: 398 DFEALNFRKS 407
           D+EA   +K+
Sbjct: 411 DWEAKEAQKN 420

>KNAG0G01460 Chr7 complement(330137..331717) [1581 bp, 526 aa] {ON}
           Anc_8.165 YBL019W
          Length = 526

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 307 SVRVSLTFRHYKVDFPRDALC--PECGYPMDLR-RTYKTPSKRGHYIWICSRGYSSGNDK 363
           ++ V  T +   V F ++A    P C +  +   +T KT S  G   WIC R  S G+D+
Sbjct: 457 TITVPKTLKKATVPFFKNAFGDPPLCDHGEEATLKTSKTSSNPGKKFWICRR--SRGDDR 514

Query: 364 SVESFCKGIKYA 375
           + E+ CK  ++A
Sbjct: 515 NKEASCKFFQWA 526

>Kwal_14.2118 s14 (613466..615034) [1569 bp, 522 aa] {ON} YBL019W
           (APN2) - AP endonuclease [contig 229] FULL
          Length = 522

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 338 RTYKTPSKRGHYIWICSRGYSSGNDKSVESFCKGIKY 374
           RT KT S RG   WIC+R    GN+   E+ C+  ++
Sbjct: 486 RTSKTESNRGRKFWICARPKGDGNN--TEASCEFFEW 520

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 263 YSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKKVSAAELHPISGSVRVSLTFRHYKVDFP 322
           YS+P    +V++    CQ   K  V     + K S  + +   GS++VSL  + YK  F 
Sbjct: 54  YSLPQHKENVVLATGKCQYSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYK--FK 111

Query: 323 RDALCPECG 331
            D   P+ G
Sbjct: 112 IDLKVPKVG 120

>NCAS0C01020 Chr3 (188484..191795) [3312 bp, 1103 aa] {ON} Anc_8.735
           YMR218C
          Length = 1103

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 48/112 (42%), Gaps = 20/112 (17%)

Query: 112 PAALAERLLEVVMTDERAKPNEFYLFGSR-----------------CVTNCRTLLYGNLD 154
           P AL+    E      + +P E YLF S+                 C+     L+ G++D
Sbjct: 821 PVALSSDASESCFNCYKIRPKEGYLFDSQDKLSLKVKYNTLKEKFDCLITDAVLIQGDVD 880

Query: 155 ---PADAGRVFYNGRISTLTSYNADLCEAQRIVEHLVNAELAKRAKLPFQVP 203
                +  ++F+  ++ T  SY+  + E Q I++   +  ++K  KL  ++P
Sbjct: 881 CFRQFEKWKLFWETKLLTQLSYDYKIFEEQSILKFTESTNISKFCKLLKEIP 932

>AFR071W Chr6 (547832..552565) [4734 bp, 1577 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR031C (SPO14)
          Length = 1577

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 67   QQSLSRYFGLKKSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLPAALAERLLEVVMTD 126
            +Q LS     KK+P+P+  GR    HG+R      +Y +++     A +  R  + + TD
Sbjct: 1166 EQFLSNNSNHKKTPLPSKKGRQ---HGRRRYNSKPKYHSFNNRAGEANVGIRDKKPISTD 1222

Query: 127  ERAKPNEFYL 136
             R   NE ++
Sbjct: 1223 SRLVGNETHM 1232

>NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222
          Length = 478

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 323 RDALCPEC-GYPMDL---RRTYKTPSKRGHYIWICSRGYSSGND 362
           R   CP C  Y  +L   + T+ TP  R H   IC RG++  ND
Sbjct: 285 RKKQCPTCLNYYANLSTHKSTHLTPEDRPHKCPICERGFARNND 328

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 32/80 (40%), Gaps = 9/80 (11%)

Query: 296 VSAAELHPISGSVRVSLTFRHYKVDF---------PRDALCPECGYPMDLRRTYKTPSKR 346
           VS  +  P+S   R++L  R+   DF         P + L  +  Y  D+   +  P   
Sbjct: 409 VSGTDDEPMSARSRIALEIRNDPEDFGDGYSRFHEPGEELKKKYEYTQDIPSVFTDPKVM 468

Query: 347 GHYIWICSRGYSSGNDKSVE 366
             Y     R  SSGN  S++
Sbjct: 469 EEYYLTLDRKKSSGNSHSLQ 488

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,061,286
Number of extensions: 1798695
Number of successful extensions: 3553
Number of sequences better than 10.0: 15
Number of HSP's gapped: 3588
Number of HSP's successfully gapped: 15
Length of query: 407
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 295
Effective length of database: 40,638,807
Effective search space: 11988448065
Effective search space used: 11988448065
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)