Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR696C1.52ON1142114252120.0
Ecym_10581.52ON116455223380.0
NCAS0B086001.52ON1117119723130.0
Suva_2.6871.52ON1128122222900.0
Skud_4.7831.52ON1135102121670.0
KLLA0C01650g1.52ON111255520670.0
KLTH0F01672g1.52ON116456320190.0
SAKL0C01716g1.52ON121558819970.0
KAFR0D041001.52ON111756118960.0
Kpol_2002.461.52ON112358818930.0
TDEL0C064901.52ON115357418950.0
ZYRO0F17402g1.52ON118957018360.0
NDAI0A006601.52ON102257017990.0
KNAG0F002901.52ON112556818000.0
Smik_4.7891.52ON113657217900.0
CAGL0K05709g1.52ON110356317850.0
YDR507C (GIN4)1.52ON114257417820.0
TPHA0E036401.52ON113759517780.0
TBLA0A071501.52ON139142816530.0
Skud_3.391.52ON101754215240.0
Smik_3.541.52ON103254515100.0
YCL024W (KCC4)1.52ON103735213761e-171
Suva_3.1901.52ON102435213551e-168
Kwal_33.132251.52ON96436710761e-128
Ecym_73922.479ON143435010541e-122
KLLA0F13552g2.479ON126736110451e-121
YKL101W (HSL1)2.479ON151838910491e-120
Skud_11.1262.479ON151838910411e-119
KLTH0D05566g2.479ON112835810201e-119
Suva_11.1232.479ON152638910321e-118
Smik_11.1392.479ON153438910301e-118
TBLA0I011502.479ON174538910341e-118
SAKL0E02860g2.479ON137735110191e-117
TDEL0A025502.479ON136939210151e-117
Kwal_26.77882.479ON126735410101e-117
ABL034W2.479ON142535110161e-116
KNAG0A065402.479ON14323779961e-114
NCAS0A057702.479ON14613899951e-113
KAFR0D032002.479ON14483839911e-113
ZYRO0G03366g2.479ON16163989821e-111
CAGL0K08514g2.479ON14894009771e-111
Kpol_431.92.479ON15524109721e-110
NDAI0D027502.479ON15152988391e-92
TPHA0G032002.479ON15343168108e-89
Kwal_33.13222singletonOFF1481206188e-74
CAGL0M08910g5.611ON6122826414e-71
Kpol_1018.655.611ON6012736291e-69
Suva_2.6515.611ON6332826311e-69
YDR477W (SNF1)5.611ON6332826292e-69
Smik_4.7545.611ON6322826293e-69
Skud_4.7515.611ON6342826275e-69
AEL230W5.611ON6083456202e-68
Kpol_495.145.611ON6242736203e-68
NCAS0A080805.611ON6232736185e-68
Ecym_55885.611ON6132736176e-68
KAFR0C058605.611ON6442736197e-68
TDEL0A047805.611ON6212736169e-68
KLLA0A03806g5.611ON6022746151e-67
TPHA0C004705.611ON6312786161e-67
Kwal_47.182335.611ON5982716131e-67
SAKL0G06952g5.611ON5992716105e-67
TPHA0D028405.611ON6342726117e-67
TBLA0E033605.611ON6542736128e-67
NDAI0H009405.611ON6852926131e-66
KLTH0G05698g5.611ON5972716071e-66
KNAG0B032305.611ON6412786047e-66
ZYRO0A05544g5.611ON6312735931e-64
NDAI0J012508.279ON11763095341e-54
KNAG0J015908.654ON8053205101e-52
NCAS0B050908.279ON12103145152e-52
CAGL0M11396g8.279ON11922885134e-52
NCAS0B037408.279ON10492895115e-52
SAKL0H07084g8.654ON9192865085e-52
Kpol_1066.468.279ON12252835126e-52
NDAI0E023208.654ON9323035061e-51
NDAI0E012908.654ON7292934991e-51
Suva_16.1698.654ON8582945031e-51
Smik_4.3678.279ON10662835043e-51
CAGL0M02299g8.668ON8932795014e-51
NDAI0B020708.279ON12582885054e-51
Kwal_26.87098.654ON8292934984e-51
TDEL0A060008.654ON7902864974e-51
TPHA0J008208.279ON12183155045e-51
TPHA0G017108.654ON8052884975e-51
ZYRO0F06842g8.654ON8432874986e-51
Skud_16.1408.654ON8652944979e-51
Kpol_1012.68.654ON6282894889e-51
Suva_2.2838.279ON10892835011e-50
Smik_12.1558.279ON11622885011e-50
Suva_10.1808.279ON11592885001e-50
YLR096W (KIN2)8.279ON11472885001e-50
NCAS0C015908.654ON8642914952e-50
Skud_12.1648.279ON11602884992e-50
KLTH0D10714g8.654ON8722874942e-50
CAGL0M02519g8.654ON7562964912e-50
Skud_4.3838.279ON10652834972e-50
KAFR0B028008.279ON10952864973e-50
Kpol_1072.298.654ON8932854933e-50
Smik_15.4178.654ON8062864913e-50
YDR122W (KIN1)8.279ON10642834964e-50
KNAG0G021108.279ON11923364964e-50
YPL141C (FRK1)8.654ON8652944915e-50
SAKL0H16632g8.279ON10622884945e-50
Smik_6.3398.654ON8652944906e-50
NCAS0B014708.654ON7272884849e-50
TPHA0D011408.654ON6222904791e-49
TDEL0F040608.279ON11262834931e-49
TBLA0B039708.654ON12082844921e-49
TBLA0C046008.279ON13152834922e-49
Ecym_83398.654ON9202844863e-49
CAGL0J03872g8.654ON6613034756e-49
Ecym_42918.279ON11452954876e-49
KAFR0A037308.654ON7882894771e-48
KLLA0F19536g8.279ON11042884812e-48
AGR058W8.279ON10712924812e-48
KLTH0G13288g8.279ON11422884813e-48
NCAS0C016708.668ON8962764773e-48
SAKL0H06754g8.668ON8842764764e-48
ACR119W8.654ON9312904774e-48
Skud_15.3998.654ON8072864726e-48
KNAG0D010906.222ON3722764471e-47
ZYRO0D06776g8.279ON12042834761e-47
Suva_8.2848.654ON8082864701e-47
KNAG0H031408.279ON9362834712e-47
YOR233W (KIN4)8.654ON8002864673e-47
TBLA0C017508.654ON9812884713e-47
CAGL0B01925g8.279ON9442854703e-47
TDEL0A061408.668ON8612744631e-46
KNAG0A030408.654ON6442894542e-46
ACR133C8.668ON8512794603e-46
KAFR0H025408.654ON8173324584e-46
Kwal_26.87518.668ON8482744576e-46
TBLA0B038608.668ON9882794581e-45
NDAI0E023908.668ON8833134542e-45
ZYRO0F07194g8.668ON9382894543e-45
KLTH0D11044g8.668ON8492864497e-45
KLLA0D07348g8.654ON9092844472e-44
KLTH0H11396g1.374ON4372744272e-44
TPHA0G016308.668ON8712744443e-44
Ecym_24058.668ON8552794426e-44
KLLA0F11319g8.668ON8432824409e-44
KNAG0J016708.668ON10092814429e-44
Kpol_1072.198.668ON8962764419e-44
SAKL0D07656g1.374ON4323004211e-43
TPHA0O011201.374ON4293004183e-43
YPL150W8.668ON9012774363e-43
NDAI0G053001.374ON4372724166e-43
Kpol_1065.36.222ON3762774108e-43
YFR014C (CMK1)1.374ON4462744141e-42
Skud_16.1328.668ON9242774312e-42
Smik_6.3508.676ON8222874292e-42
Smik_6.3478.668ON9172774293e-42
Kpol_1069.131.374ON4272764103e-42
Suva_16.1608.668ON9182954284e-42
YPL153C (RAD53)8.676ON8213104264e-42
Skud_16.1298.676ON8272874255e-42
Smik_7.3191.374ON4462764087e-42
Suva_6.781.374ON4452744062e-41
KLTH0D11242g8.676ON7952774212e-41
KNAG0I014801.374ON4402764052e-41
NCAS0A088801.374ON4222744032e-41
KLLA0B02332g6.222ON3612743982e-41
Kwal_0.961.374ON4272704032e-41
KNAG0J017008.676ON8202844184e-41
Kwal_26.87968.676ON7962774174e-41
NCAS0D021006.31ON7262674155e-41
Suva_16.1578.676ON8322924176e-41
Skud_6.891.374ON4462744016e-41
Kwal_56.224766.31ON6972854137e-41
CAGL0F04741g1.374ON4423003991e-40
NDAI0E021108.676ON9032854151e-40
KLLA0F23155g1.374ON4272623971e-40
CAGL0L07326g2.352ON5063094012e-40
KLTH0C10912g6.31ON6972854074e-40
KAFR0H024308.676ON7842804094e-40
AFL101C6.222ON3672923894e-40
CAGL0K10604g1.374ON4462763945e-40
TPHA0E028206.222ON3842603905e-40
TDEL0B063201.374ON4442843936e-40
SAKL0H06534g8.676ON8042794087e-40
Kwal_56.240916.222ON3812603888e-40
TBLA0A020506.222ON4342873911e-39
ACL006W6.31ON7082654041e-39
Ecym_30356.31ON7402654041e-39
TDEL0A062208.676ON7942794051e-39
KLLA0F11143g8.676ON8132754042e-39
CAGL0M02233g8.676ON7672944022e-39
TPHA0J004206.31ON7073064003e-39
SAKL0E01584g6.31ON6952874003e-39
TBLA0A020306.214ON4032733853e-39
TBLA0D050101.374ON4342753874e-39
SAKL0E05984g2.352ON5052933914e-39
Suva_13.1636.31ON7053123994e-39
TBLA0B004906.31ON7872964014e-39
NCAS0D006301.374ON4272763855e-39
KAFR0F018001.182ON4242683856e-39
AAR009W1.374ON4532693857e-39
Kpol_1037.206.31ON7043023978e-39
NDAI0H035201.374ON4582703859e-39
KLTH0H03982g6.222ON3982603811e-38
KAFR0C044801.374ON4352723831e-38
YPL203W (TPK2)6.214ON3802733791e-38
YMR001C (CDC5)6.31ON7053153941e-38
Skud_16.766.214ON3822733781e-38
Ecym_12751.374ON4512703832e-38
TPHA0G016008.676ON8452793972e-38
YDL101C (DUN1)2.352ON5132943862e-38
NDAI0F016006.222ON4122603802e-38
ACR142W8.676ON8372843962e-38
KAFR0H025108.668ON8792803972e-38
Smik_6.4086.214ON3812733772e-38
NCAS0B044906.222ON3492583752e-38
Skud_13.1546.31ON7052793923e-38
KAFR0G026906.31ON7132793923e-38
Ecym_21946.222ON3662853753e-38
Smik_13.1596.31ON7053153913e-38
NCAS0C013708.676ON7992913934e-38
Kpol_1072.168.676ON7952803934e-38
KLLA0E01585g2.352ON5122913834e-38
KAFR0I020101.374ON4322783784e-38
KNAG0E008506.31ON7112983914e-38
TDEL0G043806.31ON7222653915e-38
Suva_4.1452.352ON5143033826e-38
ZYRO0E05588g1.374ON4712763806e-38
Suva_16.1046.214ON3832733746e-38
NDAI0C026806.31ON7502533907e-38
Kwal_56.237178.279ON8581863927e-38
ZYRO0F07370g8.676ON7622773907e-38
TBLA0B038408.676ON8582793927e-38
KLTH0H04180g6.214ON3532683718e-38
Smik_15.1531.374ON4423003751e-37
Kwal_56.240596.214ON3532683691e-37
KAFR0K002806.222ON3602603692e-37
KNAG0D011406.214ON3952733712e-37
Suva_15.1551.374ON4523003752e-37
CAGL0J11638g6.31ON7462673862e-37
NCAS0A011006.214ON3542683673e-37
YJL164C (TPK1)1.182ON3972703703e-37
SAKL0C05368g1.182ON4183023713e-37
Smik_4.1352.352ON5132953763e-37
KAFR0K024502.352ON5112943764e-37
Ecym_23978.676ON8722783864e-37
Smik_10.661.182ON3972703684e-37
Skud_15.1441.374ON4492743725e-37
KAFR0K003306.214ON3732733665e-37
KLLA0B07205g1.182ON4552683715e-37
Skud_10.501.182ON3972703677e-37
Skud_4.1542.352ON5132953747e-37
Kpol_1033.506.214ON3842583658e-37
NDAI0A009601.182ON4082103679e-37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR696C
         (1142 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...  2012   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   905   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   895   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   886   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...   839   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   800   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   782   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   773   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   734   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   733   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   734   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   711   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    697   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   697   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   694   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   692   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   691   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   689   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   641   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   591   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   586   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   534   e-171
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   526   e-168
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   419   e-128
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   410   e-122
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   407   e-121
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   408   e-120
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   405   e-119
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   397   e-119
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   402   e-118
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   401   e-118
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   402   e-118
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   397   e-117
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   395   e-117
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   393   e-117
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   395   e-116
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   388   e-114
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   387   e-113
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   386   e-113
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   382   e-111
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   380   e-111
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   379   e-110
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   327   1e-92
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   316   8e-89
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   242   8e-74
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   251   4e-71
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   246   1e-69
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   247   1e-69
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   246   2e-69
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   246   3e-69
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   246   5e-69
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   243   2e-68
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   243   3e-68
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   242   5e-68
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   242   6e-68
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   243   7e-68
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   241   9e-68
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   241   1e-67
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   241   1e-67
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   240   1e-67
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   239   5e-67
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              239   7e-67
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   240   8e-67
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   240   1e-66
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   238   1e-66
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   237   7e-66
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   233   1e-64
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   210   1e-54
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   201   1e-52
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             202   2e-52
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   202   4e-52
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   201   5e-52
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   200   5e-52
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   201   6e-52
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              199   1e-51
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   196   1e-51
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   198   1e-51
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   198   3e-51
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   197   4e-51
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             199   4e-51
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   196   4e-51
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   196   4e-51
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   198   5e-51
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   196   5e-51
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   196   6e-51
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   196   9e-51
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   192   9e-51
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   197   1e-50
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   197   1e-50
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   197   1e-50
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   197   1e-50
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    195   2e-50
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   196   2e-50
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   194   2e-50
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   193   2e-50
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   196   2e-50
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   196   3e-50
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   194   3e-50
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   193   3e-50
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   195   4e-50
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   195   4e-50
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   193   5e-50
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   194   5e-50
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   193   6e-50
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    191   9e-50
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   189   1e-49
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   194   1e-49
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   194   1e-49
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   194   2e-49
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   191   3e-49
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   187   6e-49
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   192   6e-49
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   188   1e-48
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   189   2e-48
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   189   2e-48
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   189   3e-48
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   188   3e-48
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   187   4e-48
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   188   4e-48
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   186   6e-48
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   176   1e-47
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   187   1e-47
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   185   1e-47
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   186   2e-47
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   184   3e-47
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   186   3e-47
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   185   3e-47
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   182   1e-46
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   179   2e-46
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   181   3e-46
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   181   4e-46
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   180   6e-46
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   181   1e-45
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   179   2e-45
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   179   3e-45
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   177   7e-45
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   176   2e-44
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   169   2e-44
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   175   3e-44
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   174   6e-44
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   174   9e-44
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   174   9e-44
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   174   9e-44
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   166   1e-43
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   165   3e-43
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   172   3e-43
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   164   6e-43
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   162   8e-43
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   164   1e-42
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   170   2e-42
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   169   2e-42
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   169   3e-42
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   162   3e-42
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   169   4e-42
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   168   4e-42
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   168   5e-42
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   161   7e-42
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   160   2e-41
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   166   2e-41
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   160   2e-41
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   159   2e-41
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   157   2e-41
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   159   2e-41
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             165   4e-41
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   165   4e-41
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     164   5e-41
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   165   6e-41
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   159   6e-41
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   163   7e-41
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   158   1e-40
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   164   1e-40
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   157   1e-40
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   159   2e-40
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   161   4e-40
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   162   4e-40
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   154   4e-40
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   156   5e-40
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   154   5e-40
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   155   6e-40
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   161   7e-40
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   154   8e-40
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              155   1e-39
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   160   1e-39
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   160   1e-39
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   160   1e-39
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   160   2e-39
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   159   2e-39
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   158   3e-39
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   158   3e-39
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   152   3e-39
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   153   4e-39
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   155   4e-39
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   158   4e-39
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   159   4e-39
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   152   5e-39
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   152   6e-39
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   152   7e-39
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   157   8e-39
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              152   9e-39
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   151   1e-38
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   152   1e-38
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   150   1e-38
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   156   1e-38
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   150   1e-38
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   152   2e-38
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   157   2e-38
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   153   2e-38
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   150   2e-38
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   157   2e-38
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   157   2e-38
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   149   2e-38
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    149   2e-38
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   155   3e-38
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   155   3e-38
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   149   3e-38
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   155   3e-38
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   155   4e-38
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   155   4e-38
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   152   4e-38
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   150   4e-38
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   155   4e-38
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   155   5e-38
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   151   6e-38
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   150   6e-38
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   148   6e-38
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   154   7e-38
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   155   7e-38
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   154   7e-38
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   155   7e-38
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   147   8e-38
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   149   1e-37
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   146   1e-37
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   146   2e-37
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              147   2e-37
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   149   2e-37
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   153   2e-37
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              145   3e-37
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   147   3e-37
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   147   3e-37
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   149   3e-37
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   149   4e-37
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   153   4e-37
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   146   4e-37
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   147   5e-37
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   145   5e-37
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   147   5e-37
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   145   7e-37
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   148   7e-37
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   145   8e-37
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   145   9e-37
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   145   9e-37
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   147   1e-36
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   145   1e-36
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   146   1e-36
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   144   2e-36
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   150   2e-36
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   143   2e-36
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    143   2e-36
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   144   2e-36
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   150   2e-36
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   150   2e-36
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   143   2e-36
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   142   3e-36
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   146   3e-36
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   144   4e-36
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   142   5e-36
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      143   5e-36
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   143   5e-36
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   142   6e-36
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   142   7e-36
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   144   9e-36
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   141   1e-35
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   145   1e-35
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   142   1e-35
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   140   2e-35
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   148   2e-35
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   142   2e-35
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   144   2e-35
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   140   2e-35
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   148   3e-35
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   147   4e-35
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   140   4e-35
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   140   4e-35
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   140   4e-35
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   145   5e-35
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   139   5e-35
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   140   6e-35
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   142   6e-35
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   142   7e-35
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   142   7e-35
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   139   7e-35
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   141   8e-35
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   146   9e-35
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   139   9e-35
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   138   1e-34
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   139   1e-34
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   138   1e-34
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   138   2e-34
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   140   2e-34
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    144   2e-34
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   139   2e-34
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   139   2e-34
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   143   2e-34
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   138   3e-34
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   137   3e-34
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   140   3e-34
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   140   4e-34
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   140   4e-34
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   138   4e-34
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   144   4e-34
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   139   6e-34
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   139   7e-34
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   143   8e-34
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   143   8e-34
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   142   1e-33
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   140   2e-33
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   140   2e-33
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   142   2e-33
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   142   2e-33
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   137   3e-33
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   135   3e-33
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   140   3e-33
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   140   3e-33
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   140   3e-33
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   141   4e-33
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   141   4e-33
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   139   4e-33
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   139   6e-33
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              137   6e-33
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   139   6e-33
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   136   7e-33
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   138   8e-33
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   138   9e-33
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   139   9e-33
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   139   9e-33
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   138   9e-33
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   138   1e-32
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             138   1e-32
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   138   1e-32
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   139   1e-32
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   138   1e-32
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   132   2e-32
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   137   2e-32
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   137   2e-32
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   138   2e-32
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   138   3e-32
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   135   3e-32
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   135   3e-32
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   138   3e-32
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   136   3e-32
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   136   3e-32
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   134   4e-32
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   136   4e-32
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   136   4e-32
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   136   4e-32
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   133   4e-32
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   136   5e-32
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   135   5e-32
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   135   5e-32
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   135   6e-32
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   135   6e-32
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   135   6e-32
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   135   7e-32
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   130   8e-32
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   134   9e-32
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   135   9e-32
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   132   1e-31
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   135   1e-31
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   133   1e-31
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   136   1e-31
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   136   1e-31
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   135   1e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   131   1e-31
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   135   1e-31
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   134   2e-31
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   135   2e-31
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   135   2e-31
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   132   2e-31
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   135   2e-31
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   135   2e-31
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   135   2e-31
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   134   2e-31
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   133   2e-31
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   133   3e-31
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   135   3e-31
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   135   3e-31
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   135   3e-31
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   131   3e-31
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   132   3e-31
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   133   3e-31
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   134   3e-31
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             133   4e-31
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   132   4e-31
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   133   5e-31
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   132   5e-31
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   130   6e-31
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   134   7e-31
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   133   7e-31
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   133   8e-31
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   130   9e-31
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   133   9e-31
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   131   1e-30
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   132   1e-30
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   130   1e-30
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   130   1e-30
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   129   1e-30
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   130   1e-30
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   130   1e-30
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   132   1e-30
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   130   1e-30
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   129   1e-30
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     133   2e-30
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              132   2e-30
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   130   2e-30
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   132   2e-30
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   131   3e-30
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   130   3e-30
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   131   3e-30
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   131   3e-30
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    130   3e-30
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   128   3e-30
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   129   3e-30
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   129   3e-30
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   128   4e-30
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   131   5e-30
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   130   5e-30
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   128   5e-30
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   131   5e-30
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   131   5e-30
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   129   5e-30
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   127   5e-30
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   129   5e-30
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   131   6e-30
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   131   6e-30
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   127   6e-30
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   130   6e-30
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   130   7e-30
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   130   7e-30
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   127   7e-30
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   125   7e-30
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   130   9e-30
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   125   9e-30
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   127   1e-29
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   130   1e-29
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   130   1e-29
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   129   1e-29
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   129   1e-29
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   128   1e-29
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   129   1e-29
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   128   1e-29
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   127   2e-29
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   129   2e-29
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   126   2e-29
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   125   2e-29
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   129   2e-29
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   129   2e-29
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   129   2e-29
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   127   2e-29
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   124   2e-29
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   127   2e-29
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   125   2e-29
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   128   2e-29
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   127   3e-29
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   127   4e-29
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   126   4e-29
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   123   4e-29
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   125   4e-29
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   127   4e-29
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   128   5e-29
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   125   5e-29
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   127   5e-29
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   127   5e-29
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   127   5e-29
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   124   5e-29
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   127   6e-29
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   126   6e-29
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   124   7e-29
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   127   7e-29
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   127   7e-29
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   127   7e-29
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   126   7e-29
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   127   8e-29
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   126   8e-29
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   124   9e-29
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   124   9e-29
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   127   9e-29
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   125   9e-29
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   127   9e-29
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   122   1e-28
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   127   1e-28
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   125   1e-28
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   123   1e-28
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   126   1e-28
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                122   1e-28
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   127   1e-28
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   124   1e-28
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   122   1e-28
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   126   1e-28
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   126   1e-28
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   125   2e-28
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   125   2e-28
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   125   2e-28
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   126   2e-28
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   125   2e-28
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   122   2e-28
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   126   2e-28
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   122   2e-28
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   122   2e-28
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   125   2e-28
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   125   2e-28
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   123   2e-28
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   125   2e-28
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   122   2e-28
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   123   2e-28
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   124   3e-28
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   125   3e-28
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   124   3e-28
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   124   3e-28
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   124   3e-28
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   123   3e-28
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   119   4e-28
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   124   4e-28
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   124   4e-28
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   124   4e-28
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   125   4e-28
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   124   4e-28
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   125   4e-28
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   120   4e-28
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   120   5e-28
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   124   5e-28
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   124   5e-28
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   124   5e-28
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   120   5e-28
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   124   5e-28
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   123   6e-28
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   124   6e-28
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   120   6e-28
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   124   6e-28
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   120   7e-28
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   124   7e-28
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   124   7e-28
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   123   7e-28
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   124   8e-28
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   120   8e-28
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   123   8e-28
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   124   9e-28
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   124   9e-28
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   122   9e-28
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   123   9e-28
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   124   9e-28
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   116   1e-27
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   121   1e-27
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   122   1e-27
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   122   1e-27
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   119   1e-27
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   123   1e-27
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   123   1e-27
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   123   1e-27
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   123   2e-27
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   122   2e-27
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   123   2e-27
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   122   2e-27
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   122   2e-27
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   118   2e-27
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   120   2e-27
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   121   2e-27
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   122   2e-27
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   119   2e-27
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   122   2e-27
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   121   2e-27
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   122   2e-27
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   119   3e-27
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   122   3e-27
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   122   3e-27
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   122   3e-27
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   122   3e-27
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   119   3e-27
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   121   3e-27
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   118   3e-27
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   120   3e-27
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   119   3e-27
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   118   3e-27
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   122   3e-27
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   120   3e-27
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    121   4e-27
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   120   4e-27
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   122   4e-27
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   122   4e-27
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   121   4e-27
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   119   4e-27
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   120   5e-27
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   120   5e-27
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   121   5e-27
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   119   5e-27
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   121   5e-27
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   120   5e-27
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   118   5e-27
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   120   6e-27
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   120   6e-27
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    115   7e-27
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   117   7e-27
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   119   7e-27
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   119   7e-27
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   117   7e-27
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   120   8e-27
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   119   8e-27
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   120   8e-27
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   120   8e-27
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   118   9e-27
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    120   9e-27
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   120   9e-27
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   120   9e-27
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   113   1e-26
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   119   1e-26
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   118   1e-26
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   120   1e-26
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   120   1e-26
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   118   1e-26
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   120   1e-26
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   120   1e-26
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   119   1e-26
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   118   1e-26
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   119   1e-26
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   117   2e-26
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   115   2e-26
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   117   2e-26
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   119   2e-26
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   118   2e-26
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   116   2e-26
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   119   2e-26
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   119   2e-26
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   119   2e-26
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   119   2e-26
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   119   2e-26
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   117   2e-26
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   115   2e-26
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   118   2e-26
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   119   2e-26
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   118   2e-26
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   116   2e-26
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   116   2e-26
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   119   2e-26
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   115   2e-26
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   115   2e-26
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   118   2e-26
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   116   3e-26
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   119   3e-26
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   116   3e-26
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   118   3e-26
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   118   3e-26
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   115   3e-26
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   118   3e-26
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             119   3e-26
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   115   3e-26
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   112   3e-26
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   117   3e-26
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   117   3e-26
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   117   3e-26
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   119   3e-26
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   118   3e-26
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   118   4e-26
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   117   4e-26
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   117   4e-26
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   118   4e-26
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   115   4e-26
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   117   4e-26
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   111   4e-26
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   118   4e-26
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   116   5e-26
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   115   5e-26
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   114   5e-26
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   115   5e-26
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   112   5e-26
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   111   5e-26
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   116   5e-26
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   115   5e-26
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   117   6e-26
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   111   6e-26
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   111   6e-26
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   117   6e-26
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   117   7e-26
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   115   7e-26
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   117   7e-26
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   114   7e-26
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   117   7e-26
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   117   7e-26
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   117   7e-26
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   110   7e-26
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   117   7e-26
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   110   7e-26
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   117   8e-26
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   117   8e-26
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   115   8e-26
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   114   8e-26
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   117   8e-26
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   117   8e-26
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   115   8e-26
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   115   9e-26
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   117   9e-26
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   116   1e-25
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   115   1e-25
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   117   1e-25
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   115   1e-25
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   117   1e-25
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   115   1e-25
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   114   1e-25
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   116   1e-25
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   116   1e-25
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    116   1e-25
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   116   1e-25
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   116   1e-25
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   116   1e-25
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            115   1e-25
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   115   1e-25
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   114   1e-25
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   115   2e-25
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   115   2e-25
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   116   2e-25
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   115   2e-25
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   111   2e-25
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   116   2e-25
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   115   2e-25
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   115   2e-25
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   114   2e-25
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   115   2e-25
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   115   2e-25
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   114   2e-25
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   113   2e-25
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   112   2e-25
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   115   2e-25
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   115   3e-25
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   113   3e-25
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   115   3e-25
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   115   3e-25
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   115   3e-25
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   113   3e-25
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   115   3e-25
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   113   3e-25
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   112   3e-25
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   115   4e-25
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      115   4e-25
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   113   4e-25
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   108   4e-25
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   114   5e-25
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   114   5e-25
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   114   5e-25
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   110   5e-25
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   114   6e-25
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   108   6e-25
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   114   6e-25
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   112   6e-25
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   113   6e-25
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   114   7e-25
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   113   7e-25
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   114   7e-25
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   114   8e-25
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   114   8e-25
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   111   9e-25
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   111   9e-25
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   113   9e-25
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   113   1e-24
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   113   1e-24
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   113   1e-24
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   113   1e-24
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   113   1e-24
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   113   1e-24
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   107   1e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   112   1e-24
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   113   1e-24
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   113   1e-24
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   112   1e-24
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   113   1e-24
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   112   1e-24
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   107   1e-24
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   113   2e-24
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   112   2e-24
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   112   2e-24
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   110   2e-24
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   112   2e-24
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   107   2e-24
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   112   2e-24
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   112   2e-24
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   110   2e-24
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   110   2e-24
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   112   2e-24
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    107   3e-24
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   112   3e-24
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   107   3e-24
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   110   3e-24
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...   109   3e-24
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   110   3e-24
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   112   3e-24
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   112   3e-24
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   110   3e-24
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   112   3e-24
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   112   4e-24
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   109   4e-24
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   105   4e-24
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   111   4e-24
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   111   4e-24
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   111   4e-24
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   111   4e-24
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   110   5e-24
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   111   5e-24
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   110   5e-24
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   109   6e-24
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   107   6e-24
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   109   6e-24
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   110   6e-24
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   105   6e-24
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   110   6e-24
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   111   6e-24
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   111   7e-24
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   110   7e-24
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   107   8e-24
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...   108   8e-24
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   105   8e-24
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}             105   8e-24
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   110   8e-24
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   106   9e-24
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   110   9e-24
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   107   9e-24
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   104   1e-23
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   110   1e-23
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   110   1e-23
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   108   1e-23
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   110   1e-23
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   107   1e-23
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   110   1e-23
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...   104   1e-23
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   109   1e-23
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   110   1e-23
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   110   1e-23
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   110   1e-23
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   110   1e-23
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   105   2e-23
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   109   2e-23
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   109   2e-23
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   109   2e-23
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   108   2e-23
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   109   2e-23
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   109   2e-23
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   106   2e-23
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   109   2e-23
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   108   2e-23
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   108   2e-23
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   108   2e-23
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   108   3e-23
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   108   3e-23
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...   106   3e-23
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   106   3e-23
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   108   3e-23
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   106   3e-23
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   106   3e-23
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...   104   3e-23
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   108   3e-23
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   107   3e-23
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   108   3e-23
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   106   4e-23
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   108   4e-23
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   103   4e-23
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   106   4e-23
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   108   4e-23
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   106   4e-23
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...   102   5e-23
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   106   5e-23
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   106   5e-23
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   103   5e-23
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   106   6e-23
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   108   6e-23
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...   104   6e-23
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   108   6e-23
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              107   6e-23
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...   107   7e-23
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...   103   7e-23
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   105   7e-23
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              106   8e-23
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   107   8e-23
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...   106   8e-23
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   104   9e-23
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   107   1e-22
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   105   1e-22
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   102   1e-22
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   105   1e-22
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   105   1e-22
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   103   1e-22
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...   101   1e-22
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              105   1e-22
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   104   1e-22
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...   105   1e-22
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   102   1e-22
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...   104   2e-22
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   106   2e-22
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...   104   2e-22
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   104   2e-22
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...   105   2e-22
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    99   2e-22
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   105   2e-22
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   104   2e-22
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   100   2e-22
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   104   2e-22
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...   104   3e-22
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   103   3e-22
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...   105   3e-22
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...   100   3e-22
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...   104   3e-22
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    98   3e-22
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   103   3e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   105   3e-22
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...   100   3e-22
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...   104   3e-22
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...   104   4e-22
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   100   4e-22
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   101   4e-22
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...   103   4e-22
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   103   4e-22
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...   100   4e-22
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...   100   5e-22
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   104   5e-22
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...   100   5e-22
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   103   5e-22
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...   103   6e-22
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    102   6e-22
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   104   6e-22
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    99   7e-22
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   104   7e-22
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...   103   7e-22
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...   102   7e-22
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...   103   7e-22
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...   103   7e-22
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    99   8e-22
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   100   8e-22
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   103   9e-22
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   101   9e-22
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...   100   9e-22
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    99   9e-22
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...   101   1e-21
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    103   1e-21
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...   102   1e-21
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   102   1e-21
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   103   1e-21
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   102   1e-21
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   103   1e-21
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   103   1e-21
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...   102   1e-21
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...   101   1e-21
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...   100   1e-21
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...   100   1e-21
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    98   2e-21
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...   102   2e-21
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....   101   2e-21
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...   102   2e-21
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   100   2e-21
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...   101   2e-21
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...   101   2e-21
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    99   2e-21
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    99   2e-21
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...   101   2e-21
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   101   2e-21
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   102   2e-21
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    98   2e-21
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    99   2e-21
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   102   2e-21
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    97   2e-21
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    99   2e-21
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...   100   2e-21
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...   100   2e-21
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...   101   2e-21
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...   102   3e-21
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...   101   3e-21
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   101   3e-21
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    97   3e-21
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...   100   3e-21
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   100   3e-21
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    97   3e-21
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    98   3e-21
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...   100   4e-21
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652    100   4e-21
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...   100   4e-21
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...   100   4e-21
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...   100   5e-21
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   100   5e-21
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...   100   5e-21
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...   100   5e-21
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...   100   5e-21
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...   102   5e-21
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    97   5e-21
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    99   5e-21
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   100   6e-21
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...   100   6e-21
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    97   6e-21
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41     100   6e-21
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...   100   7e-21
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    99   7e-21
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...   100   7e-21
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    99   7e-21
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    99   7e-21
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....   100   8e-21
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...   101   8e-21
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....   100   8e-21
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    97   8e-21
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    97   8e-21
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   100   9e-21
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...   101   9e-21
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   100   9e-21
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...   101   9e-21
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    96   9e-21
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    97   9e-21
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   100   9e-21
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    96   1e-20
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    99   1e-20
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...   100   1e-20
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    99   1e-20
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    96   1e-20
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    96   1e-20
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    99   1e-20
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    96   2e-20
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    99   2e-20
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    99   2e-20
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    96   2e-20
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    95   2e-20
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   100   2e-20
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     99   2e-20
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    96   2e-20
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   100   2e-20
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    98   2e-20
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    98   2e-20
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...   100   2e-20
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    99   2e-20
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    96   2e-20
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    98   3e-20
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    98   3e-20
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    99   3e-20
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    95   3e-20
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    98   3e-20
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    98   3e-20
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    94   3e-20
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    96   3e-20
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    99   4e-20
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    98   4e-20
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    99   4e-20
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    98   4e-20
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    98   4e-20
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    99   4e-20
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    96   4e-20
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    98   4e-20
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    99   5e-20
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    96   5e-20
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    95   5e-20
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    99   5e-20
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    98   5e-20
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    99   5e-20
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    97   5e-20
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    97   5e-20
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    97   5e-20
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    98   6e-20
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    98   6e-20
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    98   6e-20
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    97   6e-20
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    96   6e-20
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    98   6e-20
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    96   7e-20
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    97   7e-20
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    98   7e-20
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    94   8e-20
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    97   8e-20
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    96   8e-20
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     96   8e-20
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    98   9e-20
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    97   9e-20
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    95   9e-20
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    96   9e-20
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    96   9e-20
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    96   1e-19
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    92   1e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    96   1e-19
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    98   1e-19
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    98   1e-19
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     95   1e-19
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    97   1e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    96   1e-19
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    97   1e-19
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    97   1e-19
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    97   1e-19
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    96   1e-19
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    97   1e-19
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    96   1e-19
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    94   1e-19
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    97   1e-19
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    96   1e-19
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    96   1e-19
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    93   1e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    95   1e-19
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    97   2e-19
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    97   2e-19
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    95   2e-19
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    96   2e-19
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    96   2e-19
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    94   2e-19
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    96   2e-19
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    96   2e-19
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    92   2e-19
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    94   2e-19
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    97   2e-19
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    94   2e-19
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    96   2e-19
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    95   2e-19
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    92   2e-19
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    96   2e-19
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    96   2e-19
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    96   2e-19
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    95   2e-19
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    97   2e-19
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    96   2e-19
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    95   2e-19
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    95   2e-19
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    93   3e-19
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    96   3e-19
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    96   3e-19
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    95   3e-19
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    92   3e-19
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    92   3e-19
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     96   3e-19
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    96   3e-19
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    96   3e-19
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    94   3e-19
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    96   4e-19
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    92   4e-19
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    94   4e-19
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    93   4e-19
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    94   4e-19
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    95   5e-19
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    94   5e-19
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    94   5e-19
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    91   5e-19
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    93   6e-19
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    94   6e-19
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    93   6e-19
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    93   6e-19
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    94   6e-19
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    93   7e-19
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    93   7e-19
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    91   7e-19
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    95   8e-19
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    94   8e-19
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    93   8e-19
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    94   8e-19
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    93   8e-19
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    94   9e-19
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    93   9e-19
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               94   9e-19
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    94   9e-19
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    95   1e-18
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    93   1e-18
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    91   1e-18
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    93   1e-18
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    94   1e-18
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    92   1e-18
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    92   1e-18
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    92   1e-18
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    94   1e-18
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    93   1e-18
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    94   1e-18
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    93   1e-18
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    92   1e-18
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    92   1e-18
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    91   1e-18
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    93   2e-18
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    93   2e-18
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    93   2e-18
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    92   2e-18
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    91   2e-18
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    92   2e-18
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    91   2e-18
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    93   2e-18
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    91   2e-18
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    92   2e-18
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    92   2e-18
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    90   2e-18
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    93   2e-18
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    93   2e-18
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    93   3e-18
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    91   3e-18
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    92   3e-18
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    91   3e-18
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    92   3e-18
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    92   3e-18
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    91   3e-18
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    92   3e-18
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    92   3e-18
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    93   3e-18
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    90   3e-18
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    92   3e-18
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    92   3e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    92   3e-18
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    91   3e-18
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    90   4e-18
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    92   4e-18
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        91   4e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    92   4e-18
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    91   4e-18
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              91   4e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    92   5e-18
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    92   5e-18
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    91   5e-18
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    90   5e-18
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    91   5e-18
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    92   5e-18
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    91   5e-18
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    89   5e-18
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    88   5e-18
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    89   5e-18
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    92   6e-18
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    91   6e-18
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    89   6e-18
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    89   6e-18
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    89   7e-18
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    91   7e-18
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    91   7e-18
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    91   7e-18
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    90   7e-18
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    91   7e-18
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    91   7e-18
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    92   7e-18
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    90   8e-18
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    91   8e-18
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       91   9e-18
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    90   9e-18
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    87   9e-18
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    89   9e-18
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    89   1e-17
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    89   1e-17
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    89   1e-17
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    91   1e-17
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    88   1e-17
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    89   1e-17
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    89   1e-17
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    87   1e-17
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    90   1e-17
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    88   1e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    91   1e-17
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    88   1e-17
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    90   1e-17
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    90   1e-17
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    90   1e-17
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    87   1e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    90   1e-17
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    88   1e-17
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    88   1e-17
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    91   2e-17
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    90   2e-17
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    90   2e-17
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    90   2e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    89   2e-17
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    90   2e-17
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    90   2e-17
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    87   2e-17
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    89   2e-17
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    86   2e-17
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    90   2e-17
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     87   2e-17
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    89   2e-17
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    87   2e-17
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    90   2e-17
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    89   2e-17
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    90   2e-17
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    89   2e-17
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    89   2e-17
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    88   2e-17
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    88   3e-17
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    87   3e-17
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    89   3e-17
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    89   3e-17
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    89   3e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               89   3e-17
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    89   3e-17
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    89   3e-17
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    88   3e-17
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    88   3e-17
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    89   3e-17
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    87   3e-17
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    89   3e-17
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    87   3e-17
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    89   3e-17
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    88   3e-17
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    89   3e-17
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    89   3e-17
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    87   3e-17
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    88   3e-17
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    89   4e-17
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    89   4e-17
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    87   4e-17
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    88   4e-17
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    89   4e-17
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               89   4e-17
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    89   4e-17
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    89   4e-17
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    89   5e-17
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    88   5e-17
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    89   5e-17
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    89   5e-17
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    88   5e-17
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    86   5e-17
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    88   5e-17
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    88   5e-17
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    89   5e-17
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    88   6e-17
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    85   6e-17
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    85   7e-17
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    88   7e-17
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    88   7e-17
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    87   7e-17
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    86   7e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    88   7e-17
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    87   8e-17
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    87   8e-17
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    88   8e-17
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    87   8e-17
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    88   8e-17
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    88   8e-17
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    87   8e-17
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    87   9e-17
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    87   9e-17
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    86   9e-17
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    87   9e-17
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    87   9e-17
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    87   1e-16
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    87   1e-16
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      87   1e-16
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    87   1e-16
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    87   1e-16
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    85   1e-16
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    87   1e-16
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    88   1e-16
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    87   1e-16
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              88   1e-16
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    85   1e-16
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    86   1e-16
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    85   1e-16
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    85   1e-16
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    86   1e-16
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    87   1e-16
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    87   1e-16
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    87   1e-16
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    88   1e-16
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    87   1e-16
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    87   1e-16
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    86   1e-16
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    86   1e-16
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             87   1e-16
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    87   1e-16
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    85   1e-16
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    87   1e-16
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    87   1e-16
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    84   1e-16
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    87   1e-16
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    86   1e-16
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    86   2e-16
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    87   2e-16
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    85   2e-16
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    87   2e-16
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    86   2e-16
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    86   2e-16
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    87   2e-16
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    84   2e-16
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     84   2e-16
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    86   2e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    86   2e-16
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    86   2e-16
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    86   2e-16
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    86   2e-16
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    86   2e-16
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    84   3e-16
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    86   3e-16
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    84   3e-16
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    84   3e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    84   3e-16
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    86   3e-16
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    83   3e-16
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    84   3e-16
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    82   3e-16
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    86   3e-16
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    85   3e-16
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    86   3e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    85   3e-16
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    86   4e-16
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    86   4e-16
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    84   4e-16
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    84   4e-16
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    83   4e-16
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    85   4e-16
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    83   4e-16
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    83   4e-16
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    83   4e-16
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    85   5e-16
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    83   5e-16
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    83   5e-16
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    85   5e-16
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    85   5e-16
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    85   5e-16
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    84   6e-16
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     85   6e-16
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    85   6e-16
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    85   6e-16
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    84   6e-16
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    86   6e-16
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     84   6e-16
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    84   6e-16
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    84   7e-16
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    85   7e-16
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    85   7e-16
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    85   7e-16
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      84   8e-16
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    82   8e-16
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    84   9e-16
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    82   9e-16
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    82   1e-15
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    82   1e-15
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    83   1e-15
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    85   1e-15
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    82   1e-15
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    85   1e-15
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    84   1e-15
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    85   1e-15
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    84   1e-15
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    84   1e-15
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      84   1e-15
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    84   1e-15
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    82   1e-15
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    81   1e-15
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    82   1e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    82   1e-15
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    82   2e-15
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     84   2e-15
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    83   2e-15
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    84   2e-15
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    84   2e-15
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    84   2e-15
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    83   2e-15
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    83   2e-15
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    80   2e-15
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    81   2e-15
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    83   2e-15
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    82   2e-15
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    82   2e-15
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    83   2e-15
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    81   2e-15
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    82   2e-15
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    83   2e-15
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    81   3e-15
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    83   3e-15
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    82   3e-15
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    81   3e-15
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    83   3e-15
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    80   3e-15
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    80   3e-15
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    80   3e-15
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    83   3e-15
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    82   3e-15
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    83   3e-15
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    82   3e-15
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    82   3e-15
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    80   4e-15
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    82   4e-15
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    82   4e-15
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    82   4e-15
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    81   4e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    81   4e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    80   4e-15
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    80   4e-15
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    82   4e-15
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    82   5e-15
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    82   5e-15
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    80   5e-15
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    82   6e-15
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    82   6e-15
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    81   6e-15
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    81   7e-15
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    81   7e-15
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    79   7e-15
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     81   7e-15
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    81   8e-15
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    82   8e-15
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      81   8e-15
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    81   9e-15
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    81   9e-15
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    79   1e-14
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    82   1e-14
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    81   1e-14
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    79   1e-14
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    80   1e-14
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    79   1e-14
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    80   1e-14
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    80   1e-14
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    80   1e-14
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    80   1e-14
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    78   1e-14
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    78   1e-14
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    79   1e-14
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    80   2e-14
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    79   2e-14
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    79   2e-14
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    80   2e-14
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    80   2e-14
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    79   2e-14
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    80   2e-14
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    80   2e-14
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    80   2e-14
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    80   2e-14
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    80   2e-14
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    79   2e-14
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    80   2e-14
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    78   2e-14
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    80   3e-14
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    78   3e-14
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    78   3e-14
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     79   3e-14
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              80   3e-14
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             78   3e-14
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    78   3e-14
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    78   3e-14
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    79   3e-14
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    79   3e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   3e-14
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    80   3e-14
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    79   3e-14
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    79   4e-14
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    78   4e-14
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     79   4e-14
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    78   4e-14
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    79   4e-14
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    79   4e-14
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    77   5e-14
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    78   5e-14
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    79   5e-14
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    79   5e-14
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    79   6e-14
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    78   6e-14
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    79   6e-14
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    79   6e-14
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    79   6e-14
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    79   7e-14
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    77   7e-14
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    78   8e-14
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    78   8e-14
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    77   8e-14
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               76   9e-14
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    77   9e-14
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    77   1e-13
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    77   1e-13
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    78   1e-13
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    76   1e-13
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    77   1e-13
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    77   1e-13
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    77   1e-13
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    77   1e-13
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    75   1e-13
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    74   1e-13
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    77   1e-13
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    77   1e-13
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    77   2e-13
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    75   2e-13
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    77   2e-13
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    77   2e-13
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    77   2e-13
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    77   2e-13
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    77   2e-13
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    75   2e-13
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    76   3e-13
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    75   3e-13
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    77   3e-13
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    74   3e-13
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    76   3e-13
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    76   3e-13
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    76   3e-13
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    74   4e-13
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               76   4e-13
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    75   4e-13
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    75   4e-13
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    75   4e-13
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    76   4e-13
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    75   4e-13
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    75   5e-13
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    75   5e-13
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    74   5e-13
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    74   5e-13
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    74   5e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    74   5e-13
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    76   5e-13
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    75   5e-13
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    75   5e-13
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    76   5e-13
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    75   5e-13
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    75   5e-13
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    75   5e-13
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    74   6e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    74   6e-13
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    75   6e-13
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    74   6e-13
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    75   6e-13
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    74   7e-13
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    75   7e-13
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    75   8e-13
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    75   8e-13
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    74   8e-13
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    74   8e-13
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     74   8e-13
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    75   8e-13
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    74   9e-13
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    75   9e-13
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    74   1e-12
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    74   1e-12
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    74   1e-12
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    74   1e-12
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    75   1e-12
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    74   1e-12
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    74   1e-12
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    74   1e-12
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    74   1e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    72   1e-12
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    73   1e-12
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    74   2e-12
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    74   2e-12
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    74   2e-12
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    74   2e-12
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    74   2e-12
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    73   2e-12
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    73   2e-12
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    73   2e-12
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    73   2e-12
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    74   3e-12
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    72   3e-12
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     73   3e-12
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    73   3e-12
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    73   3e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    73   3e-12
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    73   3e-12
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    73   4e-12
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    72   4e-12
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    72   4e-12
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    73   4e-12
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    73   4e-12
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    72   4e-12
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    72   4e-12
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    72   5e-12
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    72   5e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    71   5e-12
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    72   5e-12
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    72   5e-12
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    72   5e-12
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     72   6e-12
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    72   6e-12
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    72   6e-12
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    72   6e-12
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    72   6e-12
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    72   6e-12
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    71   6e-12
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    72   7e-12
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    71   7e-12
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    72   8e-12
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    71   9e-12
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    71   9e-12
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    71   1e-11
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    71   1e-11
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    71   1e-11
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    71   1e-11
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    71   1e-11
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    71   1e-11
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    71   1e-11
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    71   1e-11
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    70   1e-11
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               70   2e-11
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              70   2e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    70   2e-11
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    70   2e-11
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    70   2e-11
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    70   2e-11
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    70   2e-11
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    70   2e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    69   2e-11
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    70   2e-11
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    70   2e-11
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    70   3e-11
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    69   3e-11
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    69   3e-11
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    69   3e-11
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    69   3e-11
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    69   4e-11
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    68   4e-11
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    69   4e-11
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    69   4e-11
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    70   4e-11
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    69   4e-11
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    70   4e-11
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    69   4e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    69   4e-11
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    69   4e-11
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    69   6e-11
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    68   6e-11
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    68   6e-11
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    69   6e-11
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    69   7e-11
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    69   7e-11
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    68   7e-11
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    69   8e-11
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    69   8e-11
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    67   8e-11
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    68   8e-11
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    68   8e-11
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    67   1e-10
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    68   1e-10
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    68   1e-10
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       67   1e-10
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    67   1e-10
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    67   1e-10
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    67   2e-10
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    67   2e-10
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    66   2e-10
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    67   2e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    67   2e-10
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    67   2e-10
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    67   2e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    66   2e-10
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    66   3e-10
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    67   3e-10
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    67   3e-10
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    66   3e-10
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    65   3e-10
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    66   3e-10
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    66   3e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    66   4e-10
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    66   4e-10
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    66   4e-10
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    66   4e-10
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    66   5e-10
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    66   5e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    66   5e-10
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    66   5e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    65   5e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    65   6e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    65   6e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    64   7e-10
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    65   7e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    64   7e-10
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    65   8e-10
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    65   8e-10
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    65   8e-10
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    64   9e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    64   9e-10
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    65   1e-09
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    65   1e-09
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    65   1e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    64   1e-09
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    64   1e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    64   1e-09
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    64   1e-09
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    64   1e-09
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    63   1e-09
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    63   2e-09
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    64   2e-09
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    64   2e-09
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    64   2e-09
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               63   2e-09
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    64   2e-09
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    63   3e-09
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               63   3e-09
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    63   4e-09
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    63   5e-09
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    62   5e-09
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    62   5e-09
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    62   5e-09
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    62   6e-09
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    62   6e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    61   7e-09
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    62   7e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    62   8e-09
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    62   8e-09
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    61   1e-08
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    61   1e-08
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    61   1e-08
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    61   1e-08
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    61   1e-08
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    60   2e-08
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    60   2e-08
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    60   2e-08
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    60   2e-08
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    60   2e-08
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    60   2e-08
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    60   2e-08
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    60   3e-08
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    60   3e-08
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    60   3e-08
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    59   3e-08
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    60   3e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    59   3e-08
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    60   4e-08
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    60   4e-08
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    59   4e-08
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    59   4e-08
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    59   5e-08
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    59   5e-08
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    59   5e-08
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    59   5e-08
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    58   5e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    59   6e-08
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    59   6e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    58   7e-08
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    59   7e-08
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    59   8e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    57   8e-08
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    57   9e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    59   9e-08
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    59   1e-07
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    58   1e-07
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    58   1e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    57   1e-07
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    57   1e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    58   1e-07
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    58   1e-07
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    58   1e-07
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    57   2e-07
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    57   3e-07
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    56   3e-07
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    56   3e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    56   4e-07
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    55   4e-07
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    56   4e-07
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    56   5e-07
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    56   6e-07
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    55   6e-07
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    55   7e-07
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    55   8e-07
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    55   8e-07
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    55   8e-07
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    55   9e-07
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    55   9e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    54   1e-06
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    55   1e-06
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    55   1e-06
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    54   1e-06
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    55   1e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    54   1e-06
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    54   2e-06
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    54   2e-06
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    54   3e-06
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    53   3e-06
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    53   4e-06
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    52   5e-06
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    52   7e-06
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    52   8e-06
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    52   8e-06
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    52   1e-05
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    52   1e-05
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    51   1e-05
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    50   2e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    50   2e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    50   2e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    50   2e-05
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    50   2e-05
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    50   3e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    50   3e-05
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    50   3e-05
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    50   3e-05
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    50   4e-05
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    49   4e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   5e-05
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    50   5e-05
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    50   5e-05
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    49   5e-05
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    49   6e-05
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    49   6e-05
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    49   7e-05
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    49   8e-05
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    49   8e-05
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    48   8e-05
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    49   9e-05
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    49   9e-05
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    46   1e-04
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    48   1e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    48   1e-04
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    48   1e-04
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    48   2e-04
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    48   2e-04
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    47   2e-04
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    47   2e-04
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    47   2e-04
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    47   3e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    46   3e-04
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    47   3e-04
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    47   4e-04
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    45   4e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    47   4e-04
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    46   5e-04
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    46   6e-04
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    46   6e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    46   6e-04
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    46   7e-04
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    45   0.001
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    45   0.001
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    45   0.001
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    45   0.001
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    45   0.001
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    45   0.001
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     45   0.001
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    45   0.001
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    45   0.001
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     44   0.002
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    44   0.002
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    44   0.002
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    44   0.002
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    45   0.002
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    44   0.002
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    44   0.002
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    44   0.002
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    44   0.002
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    44   0.003
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     44   0.003
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    44   0.003
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    44   0.003
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    44   0.003
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    43   0.004
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    43   0.004
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    44   0.004
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    43   0.004
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    43   0.004
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    43   0.006
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    42   0.007
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    42   0.007
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    42   0.007
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    42   0.008
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    42   0.009
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    42   0.009
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    42   0.009
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    42   0.010
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    42   0.010
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    42   0.012
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    42   0.012
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    41   0.014
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    41   0.015
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    41   0.017
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    41   0.018
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    39   0.018
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    41   0.019
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    41   0.019
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    41   0.019
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    41   0.020
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    41   0.020
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    40   0.021
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    41   0.022
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    41   0.023
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    40   0.023
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    40   0.024
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    40   0.025
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    40   0.026
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    40   0.026
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    40   0.027
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    40   0.027
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    40   0.028
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    40   0.030
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    40   0.033
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    40   0.034
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    40   0.037
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    40   0.038
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    40   0.038
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    40   0.039
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    40   0.043
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    40   0.043
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    40   0.046
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    40   0.046
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    40   0.046
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    40   0.048
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    39   0.055
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    39   0.057
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    39   0.057
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    39   0.068
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    39   0.070
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    39   0.077
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    39   0.077
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    39   0.082
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    39   0.093
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.098
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    38   0.15 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    38   0.16 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     38   0.18 
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    38   0.19 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    38   0.20 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    38   0.20 
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    37   0.21 
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    37   0.22 
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    37   0.24 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    37   0.25 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    37   0.27 
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    37   0.29 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    37   0.30 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    37   0.35 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    36   0.47 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    36   0.57 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    36   0.76 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   0.80 
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    35   1.00 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    35   1.00 
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    35   1.1  
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   1.1  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    35   1.3  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    35   1.3  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    35   1.3  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    35   1.8  
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    34   1.8  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    34   2.1  
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    34   2.5  
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    33   3.7  
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    33   3.9  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    33   4.4  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    33   4.8  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    32   8.1  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    33   8.2  
Suva_3.128 Chr3 (192094..193266) [1173 bp, 390 aa] {ON} YCR091W ...    32   9.5  

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR507C
            (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 2012 bits (5212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1007/1142 (88%), Positives = 1007/1142 (88%)

Query: 1    MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGS 60
            MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGS
Sbjct: 1    MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGS 60

Query: 61   TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
            TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV
Sbjct: 61   TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120

Query: 121  QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
            QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK
Sbjct: 121  QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180

Query: 181  DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL
Sbjct: 181  DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240

Query: 241  KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRN 300
            KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRN
Sbjct: 241  KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRN 300

Query: 301  LPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRF 360
            LPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRF
Sbjct: 301  LPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRF 360

Query: 361  KFENEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHK 420
            KFENE        IAKRISSTSSSPQQNIVK          LSTPKKKRSSAINVSSAHK
Sbjct: 361  KFENEQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTPKKKRSSAINVSSAHK 420

Query: 421  RPVSIQKLNDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPPVPTAV 480
            RPVSIQKLNDCGTLNPT              AVLAG            VGQDAPPVPTAV
Sbjct: 421  RPVSIQKLNDCGTLNPTSPSKKRSLSNRKLSAVLAGSNSSSPSRKRMSVGQDAPPVPTAV 480

Query: 481  LRDYNKRASRASKRLSFLPSKRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLI 540
            LRDYNKRASRASKRLSFLPSKRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLI
Sbjct: 481  LRDYNKRASRASKRLSFLPSKRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLI 540

Query: 541  DNIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            DNIFEHEKY                                                   
Sbjct: 541  DNIFEHEKYEQIRREKEELERKVREAKEREERERRARAEAERRKREEEERRRRREVEELI 600

Query: 601  XXXXLQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLAL 660
                LQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLAL
Sbjct: 601  RQRELQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLAL 660

Query: 661  QNNINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRVEKNILETIRRS 720
            QNNINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRVEKNILETIRRS
Sbjct: 661  QNNINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRVEKNILETIRRS 720

Query: 721  KFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDS 780
            KFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDS
Sbjct: 721  KFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDS 780

Query: 781  ESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYT 840
            ESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYT
Sbjct: 781  ESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYT 840

Query: 841  NLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVE 900
            NLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVE
Sbjct: 841  NLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVE 900

Query: 901  GDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGLGIYQAPAPPKE 960
            GDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGLGIYQAPAPPKE
Sbjct: 901  GDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGLGIYQAPAPPKE 960

Query: 961  PLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIAAEXXXXXXXXX 1020
            PLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIAAE         
Sbjct: 961  PLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIAAETFPPPNTKK 1020

Query: 1021 XXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITG 1080
                     REKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITG
Sbjct: 1021 KPSFFKKFSREKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITG 1080

Query: 1081 KLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVLVL 1140
            KLSSDNILSLRSTAFEIVILSVAD                  RLVNEIEKILEKESVLVL
Sbjct: 1081 KLSSDNILSLRSTAFEIVILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVLVL 1140

Query: 1141 AS 1142
            AS
Sbjct: 1141 AS 1142

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/552 (79%), Positives = 470/552 (85%), Gaps = 3/552 (0%)

Query: 1   MGDKNN-NVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQG 59
           MG K+N NVTSL+G RIGPW LGETLG GSTGKVL+AQN +TGQIAAVK+ISKS+FNAQG
Sbjct: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60

Query: 60  STFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLL 119
           STFVGSNDPDVLPYGIEREI IMKLLNHPNVLRLYDVWET+ DLYMVLEYVEKGELFNLL
Sbjct: 61  STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLL 120

Query: 120 VQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 179
           ++RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES
Sbjct: 121 IERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 180

Query: 180 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239
           KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE+DGNIR LL
Sbjct: 181 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL 240

Query: 240 LKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIR 299
           LKVQSG++E+P +DEIS EA+DLI +ILTV+P  RIKTREILKHPLL+KYPSIKDSKSIR
Sbjct: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIR 300

Query: 300 NLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHR 359
           NLPREDTYLNPLDHNDGT+D+ IL+NLVVLWHGRD+NEI MKL E G NLEKTFYALLHR
Sbjct: 301 NLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR 360

Query: 360 FKFENEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAH 419
           FK+ENE        IAKRISS SSSPQ+NIVK          L TPKKKRSS INVSSAH
Sbjct: 361 FKYENEQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAH 420

Query: 420 KRPVSIQKLNDCGTLNPTXXX-XXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPPVPT 478
           KRPVSIQK  + G  N                 + +              + QDAPP+PT
Sbjct: 421 KRPVSIQKWGEIGGGNNGLISPSKKRSLSNRKLSAILNTPSSSPSRKRMSIAQDAPPMPT 480

Query: 479 AVLRDYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFA 537
           +VLRDYNKRASR SKR SFLPS KR SIT+KIIATYAKLSEDNDWEYID+EAKRTSSDFA
Sbjct: 481 SVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFA 540

Query: 538 TLIDNIFEHEKY 549
           TLIDNIFEHEKY
Sbjct: 541 TLIDNIFEHEKY 552

 Score =  414 bits (1063), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 267/550 (48%), Positives = 359/550 (65%), Gaps = 34/550 (6%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHV--RSISEPMERKGTRPSKRDSFLALQN 662
            LQ+SLE++VA+L+AE+  T+ E++++   +  V  RS+SEP +R  +  SKRDS LALQ 
Sbjct: 631  LQRSLEDEVAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSS-TSKRDSLLALQY 689

Query: 663  NINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLE--CNEDRLRVEKNILETIRRS 720
            +IN++L +R +S++TRPISRLDPGI   E    L+ D E   +E  LR EK ILETIRRS
Sbjct: 690  SINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRS 749

Query: 721  KFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDS 780
             FLGSQ+DI KEL+  ++EK+EK   RK  +RKL P   S  +QRFVSDGTT+TS+H+  
Sbjct: 750  NFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKL-PDRISYHDQRFVSDGTTITSAHDGY 808

Query: 781  ESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYT 840
            ++  L ++ T +GVL+D+ESEP+KLSEV+IP+ TRRS+H SASSKR SVLSMYST  SYT
Sbjct: 809  DTTSLTRHTT-VGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYT 867

Query: 841  NLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFES--------AGQENRYQAA--APTDT 890
            NLAD++ +DVQLK L  +A  S K+ Q+PEFMFES        +  +N + ++  AP +T
Sbjct: 868  NLADFMKSDVQLKPLNDTA--SSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNT 925

Query: 891  YLERPKVGVEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNK-PNGL 949
             ++     +       +PVE+IELDD+ D ++  +EEDI KVKLP LPPL+ LNK PNGL
Sbjct: 926  VIK-----LNYADRFYKPVEVIELDDT-DNTQPDTEEDITKVKLPALPPLEKLNKSPNGL 979

Query: 950  GIYQAPAPPKEPLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIA 1009
            GIYQ  + P+E     V +S+ P++ K         P     ++AP   + K +  R   
Sbjct: 980  GIYQH-SSPREDFKHAV-RSVTPNENK-----ENEDPAGTTQQKAPLTSVGKELGIREPL 1032

Query: 1010 AEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEV 1069
             +                  +EK+  + D QLDTTV ++KMFRAL+KLLNGWTSYGLK+V
Sbjct: 1033 TDLAQQGVPKKRPSFFRKFSKEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQV 1092

Query: 1070 RSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIE 1129
            RS P+   ITGKLSSDNILSLRSTAF++V+   ++                  RLVNEIE
Sbjct: 1093 RSSPSVSMITGKLSSDNILSLRSTAFQVVVAG-SNHGSSVRFTKKSGSKKTFARLVNEIE 1151

Query: 1130 KILEKESVLV 1139
            KILEKE VL+
Sbjct: 1152 KILEKEKVLI 1161

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1197 (46%), Positives = 697/1197 (58%), Gaps = 158/1197 (13%)

Query: 8    VTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQ---GSTFVG 64
            + +++GD IGPWKLGETLG GSTGKV LA N  T Q AA+K+ISKS+FN +     T + 
Sbjct: 11   IPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV 70

Query: 65   SNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGP 124
            +N PD LPYGIEREIIIMKLL H NVL LYDVWET  +LYM+LEY EKGELFNLLV++GP
Sbjct: 71   ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130

Query: 125  LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 184
            LPE EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALE++DKLL
Sbjct: 131  LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLL 190

Query: 185  ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
            ETSCGSPHYAAPEIVSG+PYHGFESDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQS
Sbjct: 191  ETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 250

Query: 245  GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304
            G++E+P +DE+S +A+DLI +ILTV+P +RIKTREILKHPLLQKYPSIKDSKSI+NLPRE
Sbjct: 251  GQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310

Query: 305  DTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFEN 364
            DTYL PL  N+  ID +ILQNLVVLWHGRDK +I  KLKE GAN EKT YALL+RFK E 
Sbjct: 311  DTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370

Query: 365  EXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTP--KKKRSSAINVSSAHKRP 422
            E        + ++         Q+I+K          +STP  KK R S ++VSS+ KRP
Sbjct: 371  ENLSAKQEQVKRK---------QSIIK-----KSTANVSTPPRKKNRISTMSVSSSRKRP 416

Query: 423  VSIQKL-----NDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXV-----GQD 472
            VS  +L          + P                 L+             V     G  
Sbjct: 417  VSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSNGNS 476

Query: 473  APPVPT--------------------AVLRDY-----NKRASRASKRLSFLPS-KRGSIT 506
              P P+                     VL+DY     + +  RASKRL+FL + KRGSIT
Sbjct: 477  NSPTPSRSKRISLINLDNSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNGKRGSIT 536

Query: 507  TKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKYXXXXXXXXXXXXXXXXX 566
            TK+++TYAKLSED++WEYI++E KRTSSDFATLID IFEHEKY                 
Sbjct: 537  TKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKY-------EQIRKEKEEL 589

Query: 567  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQKSLEEQVARLKAEVAATKQE 626
                                                  LQ  ++++++ LKA++A   + 
Sbjct: 590  ARKVREAKEGEARERREQESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETK- 648

Query: 627  KRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPG 686
                    ++ RS+S P+ER+     +RD        IN L  RR +SL+TRP SRLDPG
Sbjct: 649  ---GAEPYENPRSVSAPLERENPEAIERD--------INDLFARRNVSLQTRPKSRLDPG 697

Query: 687  IRLSEENTILEDDLECNEDR-LRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVN 745
            I  S     + + L  + D+ +  EK ILETIRRS+FLGS Y+I+KEL+  ++  L +  
Sbjct: 698  ILYSAPAETVSNPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTALAET- 756

Query: 746  MRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGV--LKDEESEPR 803
                          S++E+R          S   S++I+  K   AIGV  L D E+  R
Sbjct: 757  --------------SKKEKR----------SKVTSQNIVADK--AAIGVIPLNDTEAGLR 790

Query: 804  KLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLN-NDVQLKSLQPSAPTS 862
            K+SE+K+PQFTR+S+HFS S++RLSVLSMYSTK SYTNL D L    V L S + +  T+
Sbjct: 791  KISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLAS-EANNTTT 849

Query: 863  IKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRSK 922
             K   EPEF FES  +                           G   +L EL +  + + 
Sbjct: 850  SKASTEPEFQFESVNE---------------------------GTANKLYELQEEPEYTD 882

Query: 923  QYSEEDIAK--VKLPILPPL-DHLNKPNGLGIYQAPA----PPKEPLGQPVMKSMIP--- 972
               E+   K  VKLP LPPL +  N+ NGL IYQ+ +     P EP  QP  +SMIP   
Sbjct: 883  VNKEDGKPKKNVKLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEP--QPKSQSMIPERQ 940

Query: 973  ----DDIKIKCVPNQLSPRRRATER--APEKKLTKTVPERVIAAEXXXXXXXXXXXXXXX 1026
                +   +K  P  + P  +AT++   P+++  K   ER    E               
Sbjct: 941  DSINNSASVKKTP-VVEPESQATKKINKPKQRQPKKEEERKPLNEMPPNVEKKRNVSFFR 999

Query: 1027 XXXREKMHSDC-----DVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGK 1081
               +    S       D ++   V   ++++ L +LL GW+ YGLK+V+S      +TGK
Sbjct: 1000 KFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTGK 1059

Query: 1082 LSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVL 1138
            LS+DNILSLRST FE+++ S                     RL  EIEK+L +E VL
Sbjct: 1060 LSNDNILSLRSTVFEMIVESKG-KQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1222 (44%), Positives = 705/1222 (57%), Gaps = 180/1222 (14%)

Query: 1    MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNA--- 57
            M    N++ +++ + IGPWKLGETLG GSTGKV LA+N  TGQ AAVKVISK+VFN+   
Sbjct: 1    MAVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNV 60

Query: 58   QGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFN 117
             G++ VGSN PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  DLY+VLEY EKGELFN
Sbjct: 61   SGTSIVGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 118  LLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL 177
            LLV+RGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 178  ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN 237
            E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR 
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRA 240

Query: 238  LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKS 297
            LLLKVQ G++E+P +DEIS EA+DLI +ILTV+PE+RIK R+ILKHPLLQKYPSI+DSKS
Sbjct: 241  LLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKS 300

Query: 298  IRNLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALL 357
            IR+LPREDTYL PL  ++ +ID  ILQNLV+LWHGRD + I  KL+EPGAN EKT YALL
Sbjct: 301  IRDLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALL 360

Query: 358  HRFKFENEXXXXXXXXIAKR--ISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRS--SAI 413
            +RFK + +        I KR  I S S SP +               +TP+++R+  S I
Sbjct: 361  YRFKCDTQKELIKQQQIRKRQSIGSVSISPPKRTS------------TTPQRRRNRESII 408

Query: 414  NVSSAHKRPVSIQKLNDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDA 473
            +VSS+ K+P+S  K         T              +                V Q +
Sbjct: 409  SVSSSRKKPISFNKF--------TASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSS 460

Query: 474  PPVPTAVLR-------------------DYNKRASRASKRLSFLPS-KRGSITTKIIATY 513
            P   +   R                     NKRAS++++R+S +PS KR S+TTK+++TY
Sbjct: 461  PTPSSRNKRTSIANVDKNQKRASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTY 520

Query: 514  AKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXX 573
            AKL+ED+DWEYI++E KRTSS+FATLID IFE+EKY                        
Sbjct: 521  AKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY----DQIRKEKEELERKVKEAKAL 576

Query: 574  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQKSLEEQVARLKAEVAATKQEKRISLAQ 633
                                           L+K ++  ++ L+ E+   ++EK      
Sbjct: 577  EELERRKRKQEEKERARKLLEKEELKRKQEELKKQIDIDISDLEHELINHREEKF----- 631

Query: 634  EQHVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLSEEN 693
            E ++RSIS PME      ++ ++   L+ +I+++L+RR  SL+TRP+SRLDPGI  S   
Sbjct: 632  EGNIRSISAPME------NEENNINHLEADIDNILRRRNFSLQTRPVSRLDPGIIFSSP- 684

Query: 694  TILEDDLE---CNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQ 750
               ED +E      +RL  EK ILETIRRSKFLGS ++IDKEL+  + E           
Sbjct: 685  IETEDPVEPKKAENERLTTEKKILETIRRSKFLGSSFNIDKELKLSQMEY---------- 734

Query: 751  DRKLEPGLHSRQ---EQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDEES------- 800
                 PG+ + Q   E+R VSD      S+   ES++LPK+   +  LKD  +       
Sbjct: 735  -----PGMAAPQRLSEERIVSD------SNGKYESLVLPKDAKGVAHLKDNTAPTTTELL 783

Query: 801  ---EPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYL-NNDVQLKSLQ 856
               E RK+S++++PQFTR+S+HFS S+KRLSVLSMYSTK S+TNL D L N ++ +   Q
Sbjct: 784  SNGELRKISDIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDINPQQ 843

Query: 857  PSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPV----ELI 912
                 + +   + EF+FE+  +E  Y   +  D  L          ++ G+        +
Sbjct: 844  NQRVPTPRSADDSEFLFETVNEEAEYTGNSSNDERL----------YDVGDSCIKDKNTL 893

Query: 913  ELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGLGIYQAPAPPKEPLG-QPVMKSMI 971
            +L+ ++  +   +E++   + LP LPPL+  ++    G  Q     KE L  QP +KSMI
Sbjct: 894  KLNFADRFNGSTNEKETKNLHLPTLPPLNGKDEAGKQGEEQE----KEDLHEQPKVKSMI 949

Query: 972  PDDIKIKCVPNQLSPR--RRATERAPEKKLTKTVPERVIAAEXXXXXXXXXXXXXXXXXX 1029
            P+   +     +   R  ++   +  E  L K+V                          
Sbjct: 950  PESDSLSHAEKEQKEREDQQRGGKDLEPPLNKSV-----------------------QKT 986

Query: 1030 REKMHSDCDVQLDTT--------VGDSKMFRAL------------------NKLLNG--- 1060
            REK ++D   +  +T         G+   FR                     +L NG   
Sbjct: 987  REK-NNDTQAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKSTELYAKVSAKQLFNGLEK 1045

Query: 1061 ----WTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXX 1116
                W  YGLK V+S P + T+TGKLSS+N+ SLRST FE+ I                 
Sbjct: 1046 LLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKG-KVSVVEFKKISG 1104

Query: 1117 XXXXXXRLVNEIEKILEKESVL 1138
                  +LV E+E +L KE VL
Sbjct: 1105 SFKTVKKLVKEVENVLNKEGVL 1126

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1021 (47%), Positives = 627/1021 (61%), Gaps = 123/1021 (12%)

Query: 1   MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNA--- 57
           M    N+V +++ + IGPWKLGETLG GSTGKV LA+N  TGQ AAVKVISK+VFNA   
Sbjct: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60

Query: 58  QGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFN 117
            G++ VGS  PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  DLY+VLEY EKGELFN
Sbjct: 61  SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 118 LLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL 177
           LLV+RGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAAL
Sbjct: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 178 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN 237
           E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR 
Sbjct: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 238 LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKS 297
           LLLKVQ G++E+P +DE+S EA+DLI +ILTV+P++RIK R+ILKHPLLQKYPSI+DSKS
Sbjct: 241 LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300

Query: 298 IRNLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALL 357
           IR LPREDTYL PL  ++ +ID  ILQNLV+LWHGRD + I  KLKEPGAN EKT YALL
Sbjct: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360

Query: 358 HRFKFENEXXXXXXXXIAKRI----------SSTSSSPQQNIVKXXXXXXXXXXLSTPKK 407
           +RFK + +        I KR           +  S++PQ+                  +K
Sbjct: 361 YRFKCDTQKELIRQQQIKKRQSISSVSTSSPNKISTTPQR------------------RK 402

Query: 408 KRSSAINVSSAHKRPVSIQKL-------NDCGTLNPTXXXXXXXXXXXXXXAVL--AGXX 458
            R S I+V+S+ K+P+S  K        ++  T   +               ++  A   
Sbjct: 403 NRESIISVTSSRKKPISFNKFTASSASSSNLTTPGSSKRLSKNFSSKKRLSTIVNQASPT 462

Query: 459 XXXXXXXXXXVGQDAPPVPTAVLR--DYNKRASRASKRLSFLPS-KRGSITTKIIATYAK 515
                     +  D      +V      NK+ SR++K+LS +PS KR S+TTK+++TYAK
Sbjct: 463 PASRNKRTSIINVDKNQRRASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAK 522

Query: 516 LSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKYXXXXXXXXXXXXXXXXXXXXXXXXXX 575
           L+ D+DWEYI++E KRTSS+FATLID IFE+EKY                          
Sbjct: 523 LAADDDWEYIEKETKRTSSNFATLIDEIFEYEKY----EKIRKEKKELELKVREAKAREE 578

Query: 576 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQKSLEEQVARLKAEVAATKQEKRISLAQEQ 635
                                        L+K +E  ++ L+ E++  K+EK      + 
Sbjct: 579 LERRKRKQEEKEHSRKVLEKEELKRKQQELKKQIEIDISDLEHELSKHKEEK-----PDG 633

Query: 636 HVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLS---EE 692
           ++RSIS PME      S+  +   L+ +I+++L+RR  SL+TRP+SRLDPGI  S   E+
Sbjct: 634 NIRSISAPME------SEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEK 687

Query: 693 NTILEDDLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDR 752
            + +E     NE RL  EK ILETIRRSKFLGS ++I+KEL   +  K+E  +M   Q  
Sbjct: 688 ESAVEPKRTENE-RLTTEKKILETIRRSKFLGSSFNIEKEL---KLSKMEYPSMVPPQ-- 741

Query: 753 KLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDE----------ESEP 802
                     E+R VSD +      +D  S++LPK+      L+D             E 
Sbjct: 742 -------RLSEERIVSDPS------DDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGEL 788

Query: 803 RKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYL-NNDVQLKSLQPSAPT 861
           RK+SEV++PQFTR+S+HFS S+KRLSVLSMYS+K S+TNL D L N ++ +   Q     
Sbjct: 789 RKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIP 848

Query: 862 SIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPV----ELIELDDS 917
           + K   + EF+FE+  +E  Y   +  D  L          ++ G+        ++L+ +
Sbjct: 849 TPKSADDSEFLFETVNEEAEYTGNSSNDERL----------YDVGDSTIKDKSALKLNFA 898

Query: 918 EDRSKQYSEEDIAKVKLPILPPL---DHLNKPNG---LGIYQAPAPPKEPLGQPVMKSMI 971
           +  +   +E++   + LP LPPL   D +NK      LGI            QP +KSMI
Sbjct: 899 DRFNASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGI------------QPKVKSMI 946

Query: 972 P 972
           P
Sbjct: 947 P 947

 Score = 85.1 bits (209), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 1035 SDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTA 1094
            SD  V+L   V   ++F  L KLL GWT YGLK ++S P + T+TGKLSS+NI SLRST 
Sbjct: 1031 SDKSVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTL 1090

Query: 1095 FEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVL 1138
            FEI I                       +LVNE+E +L KE VL
Sbjct: 1091 FEISIYPRG-KMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/555 (70%), Positives = 440/555 (79%), Gaps = 12/555 (2%)

Query: 6   NNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGS 65
           N +T+L+GD IGPWKLG TLG GSTGKV++A N   GQ AAVK+ISKS+FNAQGST +G 
Sbjct: 4   NGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGG 63

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
           NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWET++DLYMVLEYVEKGELFNLLV+RGPL
Sbjct: 64  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPL 123

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 185
           PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN+KLADFGMAALESKDKLLE
Sbjct: 124 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLE 183

Query: 186 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG 245
           TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG
Sbjct: 184 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG 243

Query: 246 KYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRED 305
           K+E+PG+DEIS EA+DLI +ILTV+PEQRIKTREILKHPLL+KYPSIKDSKSIRNLPRED
Sbjct: 244 KFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPRED 303

Query: 306 TYLNPLDHNDGT--IDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363
           TYLNPL    G   +D+ ILQNLVVLWHGR+K +I  KL EPGANLEKTFYALLHRFK +
Sbjct: 304 TYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKHD 363

Query: 364 NEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHKRPV 423
           N         + K+  S SS+    +            ++TPKKKR+S I  SS+HKRPV
Sbjct: 364 NYQDQLKQQELQKK-QSVSSNSLMYVGSLPSPNKSDSPVTTPKKKRTSIIVASSSHKRPV 422

Query: 424 SIQKLND-------CGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQD-APP 475
           S+QKL+         G++                    +             +    APP
Sbjct: 423 SMQKLSSQHSSPVKNGSIGKRLSKTFPSNKRISQLVSNSSSPTPAAHKRVSRINDSAAPP 482

Query: 476 VPTAVLRDYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSS 534
           VP  +LRDY +++ R SKR S LP+ KRGSITTK+IATYAKLSED++WEYI++E KRTS 
Sbjct: 483 VPKEMLRDYKRQSKRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIEKETKRTSQ 542

Query: 535 DFATLIDNIFEHEKY 549
           DFATL+D IFEHEKY
Sbjct: 543 DFATLMDQIFEHEKY 557

 Score =  292 bits (747), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 213/559 (38%), Positives = 300/559 (53%), Gaps = 79/559 (14%)

Query: 605  LQKSLEEQVARLKAE---VAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQ 661
            LQ  +E+++A+LKAE   V  +  E+  +     + RS+S P+E   T  +KRDS   ++
Sbjct: 610  LQDQMEDEIAKLKAEYEAVQGSSDERNTA-----NGRSVSAPIETDRT-ANKRDSTFGIK 663

Query: 662  NNINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRVEKNILETIRRSK 721
            N+IN L+  R  SL+TRP+SRLDPGI  +E    L  +LE  +D+   EK ILETIRRSK
Sbjct: 664  NDINELINTRNFSLQTRPVSRLDPGIIAAESR--LSANLE--DDQASKEKTILETIRRSK 719

Query: 722  FLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSE 781
            FLGSQ++++ EL++ +++ + K   R+ Q RK     +S Q  ++              E
Sbjct: 720  FLGSQFNLNVELEKAQKDLVSK--ERQEQLRK-----YSEQTAKY--------------E 758

Query: 782  SIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTN 841
               LPKN  A+  L+D+E EPRKLSEVK+PQFTRRSKHFS+S+KR SVLS+YSTK S+TN
Sbjct: 759  VQKLPKNAKAVATLRDDEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTN 818

Query: 842  LADYLNNDVQLKSLQPSAP--TSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGV 899
            L D+L ND  L+ L P  P  +S K+ QEPEFMFE+  + +            E  K+  
Sbjct: 819  LVDHLKNDNYLEPL-PGQPEYSSSKVAQEPEFMFETVEELD------------ENSKLFE 865

Query: 900  EGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLD------HLNKPNGLGIYQ 953
              + E G+       + ++ R +  +++DI    LP LPPL         N   GLGIYQ
Sbjct: 866  VPETEEGKLASAARKESTDARKQSTNDKDI---NLPSLPPLQVSHDVADENGALGLGIYQ 922

Query: 954  APAPPKEPLGQPVMKSMIPDDIK----------IKCVPNQLSPRRRATERAPEKKLTKTV 1003
                 ++P    ++   I ++I           +K  P     R+   ER P +++T  V
Sbjct: 923  PNDQTQKPHKTMLIDESIDENISSTSDVSRTEVVKKPPLNDVVRKNNNERKPLEEITPKV 982

Query: 1004 PERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDC-DVQLDTTVGDSKMFRALNKLLNGWT 1062
              +                        +K+  +  D QL   V   KM++AL++LLN WT
Sbjct: 983  ENK----------RKISFFRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLLNEWT 1032

Query: 1063 SYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXXXXX 1122
            +YGLK V S P  + I+GKL+SDNILSLRST F+I +L                      
Sbjct: 1033 NYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGSTKTFN 1092

Query: 1123 RLVNEIEKILEKESVLVLA 1141
            RLV EIEKILEKE VLV +
Sbjct: 1093 RLVKEIEKILEKEKVLVFS 1111

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/563 (68%), Positives = 438/563 (77%), Gaps = 24/563 (4%)

Query: 8   VTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQG--STFVGS 65
           +T+L+GD+IGPWKLG TLGAGSTGKV++AQ+  TGQ AAVK++SKS+F  Q   ST VGS
Sbjct: 15  LTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSSTIVGS 74

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
           NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWET   LYMVLEYVEKGELFNLLV RGPL
Sbjct: 75  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPL 134

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 185
           PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALESKDKLLE
Sbjct: 135 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLE 194

Query: 186 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG 245
           TSCGSPHYAAPEIVSGLPYHGFESDVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQSG
Sbjct: 195 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG 254

Query: 246 KYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRED 305
           K+E+P  +EIS EA+DLI +ILTV+P  RIK+R ILKHPLLQKYPSIKDSKSIRNLPRED
Sbjct: 255 KFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPRED 314

Query: 306 TYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFENE 365
           TYLNPLD  DGTID  I+ NLVVLWHGRD+NEIT KLKEPGANLEKTFYALL RFK +++
Sbjct: 315 TYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDSQ 374

Query: 366 XXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHKRPVSI 425
                     +R  +   SP++  ++           +  KK R+  I+ SS+HKRPVS 
Sbjct: 375 QEQLKQQ---RRSQAMQVSPKKTGLRKSNSRRSINSTTPKKKTRAPVISASSSHKRPVSF 431

Query: 426 QKLN-------DCGTLNPTXXXXXXXXXXXXXXAVL----AGXXXXXXXXXXXXVGQDAP 474
            +L+       D  T N +              + L    +             +   AP
Sbjct: 432 SRLSYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINPNSSPTPASKRASLRELDPSAP 491

Query: 475 PVPTAVLRDYNK-------RASRASKRLSFLP-SKRGSITTKIIATYAKLSEDNDWEYID 526
           P+P  +L+DYNK       ++SR SKRLSFLP +KRGSITTK+IATYAK+SEDNDWEYI+
Sbjct: 492 PIPVDMLKDYNKAAPKANRKSSRISKRLSFLPGNKRGSITTKLIATYAKISEDNDWEYIE 551

Query: 527 REAKRTSSDFATLIDNIFEHEKY 549
           +E KRTS+DFATL D IFEHEKY
Sbjct: 552 KETKRTSADFATLCDEIFEHEKY 574

 Score =  293 bits (751), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 210/523 (40%), Positives = 273/523 (52%), Gaps = 38/523 (7%)

Query: 638  RSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLSEENTILE 697
            RS+S P+E    +  KR S  AL  +I  LL RRT SLETRP SRLDPGI   EE  +  
Sbjct: 658  RSVSAPVESV-LKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIYTLEE--VPN 714

Query: 698  DDLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPG 757
             D++     L+ EK ILETIRRSKFLGS +DI+KEL R RR K E+    K +       
Sbjct: 715  SDIKDGGRDLKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQR------- 767

Query: 758  LHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRS 817
               ++E R VS+ T    S    E   LPKN  A  +  D  S+PRK+SEV++PQFTRRS
Sbjct: 768  ---KKEDRVVSNATG-NYSENGYEPQTLPKNAAATKISNDAGSDPRKISEVQVPQFTRRS 823

Query: 818  KHFSASSKRLSVLSMYSTKVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAG 877
            +HF+AS+KRLSVLSMYSTK S+TNLAD+L     L+S+  S P++ ++  E EFMFES  
Sbjct: 824  RHFTASNKRLSVLSMYSTKASFTNLADHLRGKTDLQSINGSPPSTSRMEPETEFMFESVD 883

Query: 878  QENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRSKQYSE-----EDIAKV 932
             E +  A    D+ L       EG+   G     + L+ ++  +K  S      ED   +
Sbjct: 884  GEGKETADTSADSRLYEV---AEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGI 940

Query: 933  KLPILPPLDHL--NKPNGLGIYQAPAPPKEPLGQPVMKSMIPDDIKIKCVP-------NQ 983
            KLP LPPLD    +  NGLG+YQ  +   E       KSMIP D + K           Q
Sbjct: 941  KLPSLPPLDKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKEAAEAKPEEQKQ 1000

Query: 984  LSPRRRATERAPEKKLTKTVPE------RVIAAEXXXXXXXXXXXXXXXXXXREKMHSDC 1037
            + P+   +  AP  K+ K   E         A                     EK   + 
Sbjct: 1001 VPPKDVESAPAPLNKVMKKNTEAEKNQPNQPAPNAVKKNNKSFFRRFSGKSDDEKRPGEY 1060

Query: 1038 DVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEI 1097
            D + DT +  ++MF AL+KLL  W  YGLK+V + P+   I GK+SSDN+LSLRST FEI
Sbjct: 1061 DFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRSTLFEI 1120

Query: 1098 VILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVLVL 1140
             I+S  +                  +LV EIEKILE +  LV 
Sbjct: 1121 SIVSKGE-GSIVGFTKKSGSTKTFKKLVKEIEKILESKKALVF 1162

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/588 (67%), Positives = 439/588 (74%), Gaps = 46/588 (7%)

Query: 8   VTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNA----QGSTFV 63
           +T+L+ D+IGPWKLG  LGAGS GKVL+AQ+  TGQ AAVK++SKS+F A      ST V
Sbjct: 15  LTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIV 74

Query: 64  GSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123
           GSNDPD+LPYGIEREIIIMKLLNH NVLRLYDVWET  +LYMVLEYVEKGELFNLLV+RG
Sbjct: 75  GSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERG 134

Query: 124 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 183
           PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALESKDKL
Sbjct: 135 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKL 194

Query: 184 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243
           LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE++GNIR+LLLKVQ
Sbjct: 195 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQ 254

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPR 303
           SG+YE+PG DEIS EA+DLI +ILTV+P++RIKTREILKHPLLQKYPSIKDSKSIRNLPR
Sbjct: 255 SGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPR 314

Query: 304 EDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363
           EDTYLNPLDH DG+ID  ILQNLVVLWHGRD+NEI  KL EPGANLEKTFY LL RFK +
Sbjct: 315 EDTYLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKHD 374

Query: 364 NEXXXXXXXXIAKRIS----------------STSSSPQQNIVKXXXXXX-----XXXXL 402
                       ++                  S   SP++  +K                
Sbjct: 375 VHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSLSGT 434

Query: 403 STPKKK-RSSAINVSSAHKRPVSIQKLND-------CGTLNPTXXXXXXXXXXXXXXAVL 454
           +TPKKK R S I+VSS+HKRPVS  KL+        CGT   +              + +
Sbjct: 435 TTPKKKNRVSMISVSSSHKRPVSFNKLSTAGKSDSACGTPGSSTKRMSISLSSSKRLSAM 494

Query: 455 AGXXXXXXXXXXXXV---GQDAPPVPTAVLRDY---------NKRASRASKRLSFLPS-K 501
                         V      APPVP  VL DY          KRASRASKRLSFLP+ K
Sbjct: 495 GPNTSPTPANKRMSVRDMDSSAPPVPMDVLNDYTSALPNRKATKRASRASKRLSFLPNIK 554

Query: 502 RGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           RGSITTK+IATYAKLSE++DWEYI++E KRTS+DFATL D IFEHEKY
Sbjct: 555 RGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKY 602

 Score =  335 bits (859), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 229/579 (39%), Positives = 314/579 (54%), Gaps = 64/579 (11%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRP-SKRDSFLALQNN 663
            LQ+ + ++VA L+A+    + E     A +   R +S P+     +   KRDS   L  +
Sbjct: 660  LQELMAKEVAMLRADYGEPQTEPEEQGASKN--RCVSAPIASSSAKDDGKRDSIARLSGD 717

Query: 664  INSLLKRRTLSLETRPISRLDPGIRLSEE--NTILEDDLECNEDRLRVEKNILETIRRSK 721
            I+ LLKRRT+SL+TRP+SRLDPGI  +E   + I E+    +E  LR EK ILETIRRS+
Sbjct: 718  IDDLLKRRTVSLQTRPVSRLDPGIVAAENLGSVIYEEADGVDETTLRTEKTILETIRRSR 777

Query: 722  FLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSE 781
            FLGS +DI KEL+R +R+K              E  L  + +QR +S  T  +++++  E
Sbjct: 778  FLGSSFDIKKELERAQRKK--------------EEALARQHQQRILSSATAASATNDAYE 823

Query: 782  SIILPKNVTAIGVLKDEES-EPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYT 840
            S  LPKN  A+  L DE + EPRK+SE+K+PQFTRRS+HF+AS+KRLSVLSMYSTK S+T
Sbjct: 824  SRALPKNAAAVDTLNDERNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFT 883

Query: 841  NLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPT-DTYLERPKVGV 899
            NLAD+L     L+ +  SAP++ KI QEPEF+FES  +E+  +    T D+ L     G 
Sbjct: 884  NLADHLKGGADLQEVSGSAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGS 943

Query: 900  EGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDH--LNKPNGLGIYQAPAP 957
            E      +    +      DR    + ++ A VKLP LPPL+     KPNGLGIYQ+P  
Sbjct: 944  ESSKTSTKAAMRLNF---ADRFNTRAGDNPADVKLPPLPPLEKNGSKKPNGLGIYQSPER 1000

Query: 958  PK-EP-----LGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVI-AA 1010
            P+ +P     + +P + SMIPDDI     P + S +   +E  P     K+ P+  + +A
Sbjct: 1001 PRADPNPTSMVHEPKVFSMIPDDI---AGPAK-STKPAESENVPTSATKKSEPKNALHSA 1056

Query: 1011 EXXXXXXXXXXXXXXXXXXR---------------------------EKMHSDCDVQLDT 1043
            +                  R                           EK   + D +L+T
Sbjct: 1057 DAPEASQPPLNGMMRKNNDRKPLEDITPAAEKKRNRSFFRKFSRSSEEKKSDNFDAKLNT 1116

Query: 1044 TVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVA 1103
            +V   +MF AL KLL GW  YGLKEVR    + TITGKLSSDNILSLRST FEI++   +
Sbjct: 1117 SVEAVQMFNALGKLLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDS 1176

Query: 1104 DXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVLVLAS 1142
                               RLV E+EK+LE+E+VL   S
Sbjct: 1177 SKGSVVWFVKKSGSTKTFKRLVKEVEKVLERENVLTSTS 1215

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/561 (65%), Positives = 425/561 (75%), Gaps = 30/561 (5%)

Query: 5   NNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVG 64
           +NN+ S++GD++GPWKLGETLG GSTGKV LA N  TG+ AA+KVISKSVFN   +    
Sbjct: 4   SNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSS 63

Query: 65  SNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGP 124
              PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY EKGELFNLLV++GP
Sbjct: 64  LTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGP 123

Query: 125 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 184
           L E EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLL
Sbjct: 124 LQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLL 183

Query: 185 ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
           ETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQS
Sbjct: 184 ETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 243

Query: 245 GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304
           G++E+P +DEIS EA+DL+ +ILTV+PE+RI+ R+ILKHPLLQKYPSIKDSKSIRNLPRE
Sbjct: 244 GEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRE 303

Query: 305 DTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFEN 364
           DTYLNPL  N+ TID+ ILQNLVVLWHGRD NEI  KLKEPGAN EKT YALL RFK ++
Sbjct: 304 DTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDS 363

Query: 365 EXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTP--KKKRSSAINVSSAHKRP 422
           E        I KR S TSS  +    K           STP  +K R S I+VSS+HK+P
Sbjct: 364 EKENFKNEQIRKRQSITSSVSRSPAKKA----------STPQRRKNRISMISVSSSHKKP 413

Query: 423 VSIQKLNDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPPVP----- 477
            S  +L+     N +              ++                  ++ P P     
Sbjct: 414 ASFNRLSSVVHNNLSASSSTTTTPASKKFSM----NKKLSMIADKSNSNNSSPTPAHRNK 469

Query: 478 -TAVLR-------DYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDRE 528
            T+++          NKRASR+SKRLS + + KRGSITTK+IATYAKLSED+DWEYI++E
Sbjct: 470 RTSMINTDRQSILSKNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKE 529

Query: 529 AKRTSSDFATLIDNIFEHEKY 549
            KRTSSDFATLID IFEHEKY
Sbjct: 530 TKRTSSDFATLIDEIFEHEKY 550

 Score =  226 bits (576), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 181/570 (31%), Positives = 271/570 (47%), Gaps = 87/570 (15%)

Query: 605  LQKSLEEQVARLKAEVAAT---KQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQ 661
            LQ+ ++E++  L+A++       QEK      E + RS+S P+ ++              
Sbjct: 599  LQRQMDEEIENLRADLKGDVEPNQEK-----NEDNYRSVSVPLSKETVN----------- 642

Query: 662  NNINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNE----DRLRVEKNILETI 717
               ++LL++R  SL+TRPISRLDPG+  SE++   E  +  +E     +L  EK ILETI
Sbjct: 643  ---DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILETI 699

Query: 718  RRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSH 777
            RRSKFLGS +DI++EL+                            E+R +   T    + 
Sbjct: 700  RRSKFLGSSFDINRELKAA--------------------------EKRVMQPPTVQKLTT 733

Query: 778  EDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKV 837
            E+  S  LPK+      L    +E  K+S++++PQFTR+S+HF+ S++RLSVLSMYST+ 
Sbjct: 734  ENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQ 793

Query: 838  SYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKV 897
            S++NL D L N      L    PT      + EF+FE+  +E  Y   +  D  L     
Sbjct: 794  SFSNLVDILKNTEAGTELGQRTPTP-HSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVAD 852

Query: 898  GVEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGLGIYQAPAP 957
                +   G  +   +  + ++        DI   KLP+LPPLD      GLGIYQ  +P
Sbjct: 853  LDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQN-KLPVLPPLDG---KAGLGIYQTSSP 908

Query: 958  PKEP--LGQPV-------------------MKSMIPDDI-----KIKCVPNQLSPRRRAT 991
              EP  L +PV                   +KSMIP+ +      +  +  Q + + +  
Sbjct: 909  I-EPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEH 967

Query: 992  ERAP--EKKLTKTVPERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSK 1049
            ++ P  EKK     P++  + +                    K  ++ +  L T +   +
Sbjct: 968  DKRPVMEKKPEVVAPKQRESDQEKKRSVSFFRKFSGSSISSNKSKAETEKVLVTNIAARQ 1027

Query: 1050 MFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXX 1109
            +F  L +LLNGW+ YGLK VRS+ ++ TI+GKLSSDNILSLRST FEI + S  +     
Sbjct: 1028 VFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGE-SSSV 1086

Query: 1110 XXXXXXXXXXXXXRLVNEIEKILEKESVLV 1139
                         RL  EIE I  KE VL+
Sbjct: 1087 LIRKKSGSSKAVLRLTTEIENIFSKEGVLL 1116

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/588 (63%), Positives = 434/588 (73%), Gaps = 49/588 (8%)

Query: 1   MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQG- 59
           M   N    S++GD IGPWKLGETLG GSTGKV LA N  T Q AA+KVISKSVF++ G 
Sbjct: 1   MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGN 60

Query: 60  -STFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNL 118
            S+ V S  PD L YGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY EKGELFNL
Sbjct: 61  NSSMVSST-PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNL 119

Query: 119 LVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALE 178
           LV++GPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIK+ADFGMAALE
Sbjct: 120 LVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALE 179

Query: 179 SKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNL 238
           ++DKLLETSCGSPHYAAPEIVSGLPYHG E+DVWSCGVIL+ALLTGRLPFDEEDGNIRNL
Sbjct: 180 TEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNL 239

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSI 298
           LLKVQ G++E+PG+DEIS EA+DL+ +IL V+PE+RIK+REILKHPLLQKYPSIKDSK+I
Sbjct: 240 LLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTI 299

Query: 299 RNLPREDTYLNPLDHNDG---TIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYA 355
           RNLPREDTYLNPL  NDG   TID+ ILQNLVVLWHGR++++I  KL+EPGAN EKT YA
Sbjct: 300 RNLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYA 359

Query: 356 LLHRFKFENEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKK--RSSAI 413
           LL+RFK ++E        I KR         Q+I+            +TP+KK  R+S I
Sbjct: 360 LLYRFKVDSEQEALKNSQIKKR---------QSIISNNNLKSGNINTTTPQKKKNRNSVI 410

Query: 414 NVSSAHKRPVSIQKL-------------NDCGTLNPTXXXXXXXXXXXXXXAVL----AG 456
           +VSS+HKRPVS+ +L             +   T   +               +L    +G
Sbjct: 411 SVSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSG 470

Query: 457 XXXXXXXXXXXXV-----GQDAPPVPTAVLRDYN---------KRASRASKRLSFLP-SK 501
                       V       + PP+P  +L+DY          KRASR SKRLS LP +K
Sbjct: 471 SPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAK 530

Query: 502 RGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           RGSITTKII+TYAKLSED+DWE+I++E KR SSDFATLID IFEHEKY
Sbjct: 531 RGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKY 578

 Score =  231 bits (590), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 176/523 (33%), Positives = 268/523 (51%), Gaps = 68/523 (13%)

Query: 635  QHVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLS---- 690
            ++VRSIS P+E      S+ D+             +R+ SL+TRP+S+LDPGI+      
Sbjct: 650  KNVRSISSPVENGNEAKSEEDAS-----------GQRSFSLQTRPVSKLDPGIKCGSNKP 698

Query: 691  -EENTILEDDLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKS 749
             +   I+ED+L+   D  +V   ILETIRRSKFLGS ++IDKEL++V+++  E   MRKS
Sbjct: 699  VQMEEIVEDELDKTIDSQKV---ILETIRRSKFLGSSFNIDKELKQVKKD-AEVKRMRKS 754

Query: 750  QDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKD--EESEPRKLSE 807
            Q           +E R VS G  V+ ++E  E+ +LPKN TA G LKD  EE EPRK+S+
Sbjct: 755  Q-----------KEDRDVS-GRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISD 802

Query: 808  VKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLNN---DVQLKSLQPSAPTSIK 864
            +++PQFTR+SK F+ S+KRLSVLS+YS+  SYTNLA+ L     D+ +         +++
Sbjct: 803  IQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDIGVNE----GSNNVE 858

Query: 865  IPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRSKQY 924
            + +EPEF FE+ G E                 +        G  ++L   D  +      
Sbjct: 859  VSEEPEFQFETVGTEIENNKYEEEKEIENENNLS------QGANIKLNYADRFD------ 906

Query: 925  SEEDIAKVKLPILPPLDHLNKPNGLGIYQAPAPPKEPLGQPV--------MKSMIPDDIK 976
            +  ++ +VKLP LPPL      +GLGIY + +  +    +PV         +++   +++
Sbjct: 907  TAGNVNEVKLPTLPPLGDDKVSDGLGIYSSKSGSEGNESKPVPSIKENKSEETLKEKNVE 966

Query: 977  IKCVPNQLSPRRRATERAPEKKLTKTVPERVIAAEXXXXXXXXXXXXXXXXXXREKMHSD 1036
             K   N + P+ R T++      T  V                           +   + 
Sbjct: 967  PKPPLNDVVPKTRDTKK------TNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTG 1020

Query: 1037 CDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFE 1096
             DV+L + V  ++++  L  LL GW  YGLKE++S   +++I+ +LSSDNILSLRST  +
Sbjct: 1021 YDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVD 1080

Query: 1097 IVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVLV 1139
            +V+ S                     RL +E+EK+L KE VL 
Sbjct: 1081 MVVFSEG-KHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLA 1122

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/574 (64%), Positives = 433/574 (75%), Gaps = 32/574 (5%)

Query: 5   NNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGS---T 61
           N +V +++G++IGPWKLGETLG GSTGKV LA +  T Q AA+KVISK++FN +GS   +
Sbjct: 6   NRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDS 65

Query: 62  FVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQ 121
            V ++ PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY +KGELFNLLV+
Sbjct: 66  SVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVE 125

Query: 122 RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKD 181
           RGPLPE EA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALE++D
Sbjct: 126 RGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETED 185

Query: 182 KLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
           KLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFD+EDGNIRNLLL+
Sbjct: 186 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQ 245

Query: 242 VQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNL 301
           VQSG+YE+PG+DEISP+A+DLI +ILTV+PEQRIK R+ILKHPLLQKYPSI DSKSIRNL
Sbjct: 246 VQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNL 305

Query: 302 PREDTYLNPLDHNDGT-IDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRF 360
           PREDTYL+PL   +   ID+ ILQNLVVLWHGR++ EI  KL+EPGAN EKT YALL RF
Sbjct: 306 PREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRF 365

Query: 361 KFENEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKK-RSSAINVSSAH 419
           K + E          KR+S  +   Q    K           ++PK++ R+S I+VSS+H
Sbjct: 366 KSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTN---ASPKRRNRTSMISVSSSH 422

Query: 420 KRPVSIQKLNDC---GTL------NPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVG 470
           KRPVS  KL++    G++       P+              AV               V 
Sbjct: 423 KRPVSFNKLSNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVS 482

Query: 471 ---------QDAPPVPTAVLRDYN-----KRASRASKRLSFLPS-KRGSITTKIIATYAK 515
                     D PPVP  +L+DY+     KR SR + RLSF PS KRGSITTK+I+TYAK
Sbjct: 483 IVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAK 542

Query: 516 LSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           LSED+DWEYI++E KRTSSDFATL D IFEHEK+
Sbjct: 543 LSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKF 576

 Score =  277 bits (708), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 205/567 (36%), Positives = 296/567 (52%), Gaps = 68/567 (11%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHV----RSISEPMERKGTRPSKRDSFLAL 660
            +Q+ ++E+VA L  E+       + +   ++H     RS+SEP+++K   P        L
Sbjct: 625  IQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVNGRSVSEPLQKKSADP-----MADL 679

Query: 661  QNNINSLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRV--EKNILETIR 718
            Q NI+ LL++RT SL+TRP+SRLDPG+  S+ +   +D    +EDR ++  +K ILETIR
Sbjct: 680  QANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSE--KDQYTGSEDRAKLNNDKIILETIR 737

Query: 719  RSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHE 778
            RSKFLGS +DI+KEL+R    + +K                  Q Q   +    ++++++
Sbjct: 738  RSKFLGSSFDINKELKRAADNEAKK------------------QRQSKATSDRIISTTND 779

Query: 779  DSESIILPKNVTAIGVLKDE--ESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTK 836
            + E+ ILPKN TA   LKD   ++EPRK+S++K+PQFTR+S+ F  S+KRLSVLSMYS+K
Sbjct: 780  EYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSK 839

Query: 837  VSYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYL-ERP 895
             SYTNLAD LN +         +P   +   EPEF+FE+  ++      +  D  L E P
Sbjct: 840  QSYTNLADLLNEEASNAKGNRDSPND-QSGHEPEFLFENVQEDGEVTGDSSHDGRLYEVP 898

Query: 896  KVGVEGDHEPGEPVELIELDDSEDRSKQYSEEDIA----KVKLPILPPLDHLNKPNGLGI 951
                E  +   E ++L    +  DR K  + ED       V+LP LPPLD   +  GLGI
Sbjct: 899  ----EDSNMTKEKLKL----NFADRFKTSNGEDRTAEDKNVRLPTLPPLDG-KEAKGLGI 949

Query: 952  YQAPAPPKEPLGQPVMKSMIPDDIKIKCVPNQ------LSPRRRATERAPEKKLTKTVP- 1004
            YQ+ +       Q  +KSMI +D   +  P++      +       ER  E  L  ++P 
Sbjct: 950  YQSSSESLPEPAQHNVKSMIQND---ENQPSETAEVLSIKEDNAQVERQQEAPLNASIPK 1006

Query: 1005 ---------ERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALN 1055
                     ER+ + E                   EK + + D +L  +V   ++F  L 
Sbjct: 1007 HRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKQLFNGLQ 1066

Query: 1056 KLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXX 1115
             LL GW  YGLK V+SMP   T+TGKLSS+NILSLRST FE+V+ S              
Sbjct: 1067 NLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRG-KGSIVGFRKKS 1125

Query: 1116 XXXXXXXRLVNEIEKILEKESVLVLAS 1142
                   RLV+EIEK+L KE VL   S
Sbjct: 1126 GSTKTLKRLVSEIEKVLLKERVLTKES 1152

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/570 (63%), Positives = 417/570 (73%), Gaps = 40/570 (7%)

Query: 10  SLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQ---GSTFVGSN 66
           ++RGD++GPWKLGETLG GSTGKV LA N  T Q AAVK ISK++F+A+   G++ + ++
Sbjct: 11  TVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPGNSSIAAS 70

Query: 67  DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP 126
            PD LPYGIEREIIIMKLLNHPNVLRLYDVWET   LYMVLEY EKGELFNLLV+ GPLP
Sbjct: 71  TPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPLP 130

Query: 127 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLET 186
           ENEAV FFRQIIIG+SYCHALGIVHRDLKPENLLLDH  NIK+ADFGMAALE++DKLLET
Sbjct: 131 ENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALETEDKLLET 190

Query: 187 SCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGK 246
           SCGSPHYAAPEIVSG+PYHGF SD+WSCGVI +ALLTGRLPFDEEDGNIRNLLLKVQSGK
Sbjct: 191 SCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSGK 250

Query: 247 YEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDT 306
           +E+P +DEISPEA+DL+ +ILTV+PE RIK REILKHPLLQKYP++ D+KSIRNLPREDT
Sbjct: 251 FEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRNLPREDT 310

Query: 307 YLNPL-DHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFENE 365
           YL+PL D     +DQ ILQNLVVLWHGR   EI  KLK+PGAN EKT YALL RFK + E
Sbjct: 311 YLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLARFKNDTE 370

Query: 366 XXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHKRPVSI 425
                   I KR S   +    N             +S  K+ R+S IN SS+HKRPVS+
Sbjct: 371 REAARQKQIKKRSSLNGTGAGVN----------NNHVSPKKRNRASTINASSSHKRPVSL 420

Query: 426 QKLNDCGTLNPTXXXXXXXXXXXXXXAV-LAGXXXXXXXXXXXXVGQ------------- 471
            KL+     N                +V L+              G              
Sbjct: 421 IKLSGSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVKTQGNGGSPTPASRSKRVSII 480

Query: 472 ------DAPPVPTAVLRDYN-----KRASRASKRLSFLPS-KRGSITTKIIATYAKLSED 519
                  APPVP  +L+DYN     KR SRAS RLSF P+ KRGS+TTK+I+TYAKLSE+
Sbjct: 481 ESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTTKLISTYAKLSEE 540

Query: 520 NDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           +DWEYI++E KRTSSDFATLID IFEHEK+
Sbjct: 541 DDWEYIEKETKRTSSDFATLIDEIFEHEKF 570

 Score =  200 bits (509), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 199/359 (55%), Gaps = 55/359 (15%)

Query: 637 VRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLSEENTIL 696
           VRS+S P+ERK     KRDS + +Q++I  +  +RT+SL+TRP+SRLDPG+  +EE+   
Sbjct: 644 VRSVSAPLERK-----KRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGLFYAEESNEP 698

Query: 697 EDDLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEP 756
           E      E +LR +KNILETIRRSKFLGS +DI KELQ    E+L+K   +  +DR    
Sbjct: 699 EAGDTEEEKKLRTQKNILETIRRSKFLGSSFDIGKELQ---NEELKKKASQPHRDR---- 751

Query: 757 GLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRR 816
                          TV+ ++E  ++ +LP    A   L+D+  EPRK+SE+ +PQFTR+
Sbjct: 752 ---------------TVSQTNEPYDTRVLPTQAVATAPLRDQ--EPRKISEISVPQFTRK 794

Query: 817 SKHFSASSKRLSVLSMYSTKVSYTNLADYLNN-DVQLKSLQPSAPTS-IKIPQEPEFMF- 873
           S+ FS S+KRLSVLSMYSTK SY NL++ LN+ D     L  +A  S +K  +EPEF F 
Sbjct: 795 SRFFSDSNKRLSVLSMYSTKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFE 854

Query: 874 ---ESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRSKQYSEEDIA 930
              E++ ++N     +  D  L R   G  G    G  V    L    +    +++   A
Sbjct: 855 AVREASDEDNGISRLSNNDERL-RNVSGTSG----GSGVPHDNLSSKHNMKLNFADRFSA 909

Query: 931 ---------------KVKLPILPPLDHLNKPNGLGIYQAPAPPKEPLGQPVMKSMIPDD 974
                           VKLP LPPLD  ++ NGLGIYQ+ +     + +P  KS + D+
Sbjct: 910 DEPTAGSSNSSSASKNVKLPTLPPLDGTSEANGLGIYQSSSESFRDIVEPTPKSKLQDN 968

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 1/108 (0%)

Query: 1031 EKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSL 1090
            EK  +  D +++TTV   ++F  L  LL+GWT YGLK+VRS P   T+TGKL+S+NILSL
Sbjct: 1081 EKDTTGFDGEINTTVSAKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTGKLTSENILSL 1140

Query: 1091 RSTAFEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVL 1138
            RST FE+V+ S                     RLV+E+EK+L KE V+
Sbjct: 1141 RSTLFEMVVWSRG-KVSVVGFRKKSGSSKAMRRLVSEVEKVLLKEGVI 1187

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/570 (61%), Positives = 411/570 (72%), Gaps = 61/570 (10%)

Query: 9   TSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQG----STFVG 64
           T ++GD IGPWKLG+TLG GSTGKV LA N  T Q AA+K+ISKS+F +QG    S+ V 
Sbjct: 8   TKMKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIF-SQGTVGESSMVS 66

Query: 65  SNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGP 124
           ++ PD LPYGIEREIIIMKLL HPNVL LYDVWET   LYM+LEY EKGELFNLLV+RGP
Sbjct: 67  NSSPDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGP 126

Query: 125 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 184
           LPE EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK NIK+ADFGMAALE+KDK+L
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKML 186

Query: 185 ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
           ETSCGSPHYAAPEIVSG+PYHGF+SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQS
Sbjct: 187 ETSCGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 246

Query: 245 GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304
           G+YE+P +DEIS EA+DLI +ILTV+PEQRIKTR+ILKHPLLQKYPSIKDS+SI+NLPRE
Sbjct: 247 GEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPRE 306

Query: 305 DTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFEN 364
           DTYL PL  N+  ID +ILQNLV LWHGRDK++I  KL+E GA+ EKT YALL+RFK E 
Sbjct: 307 DTYLYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEA 366

Query: 365 EXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHKRPVS 424
           E              +T SSP+                   +K R S I+VSS+HKRPVS
Sbjct: 367 EKM------------NTCSSPR-------------------RKNRISMISVSSSHKRPVS 395

Query: 425 IQKLNDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXX-------------XXVGQ 471
           ++K++      P                 ++G                           +
Sbjct: 396 MKKISTVQNNTPPSNRRLSISLSSTQRKRMSGILQHTNSSPTPSRTKRISVINIDDSENK 455

Query: 472 DAPPVPTAVLRDYNKRASRASK------------RLSFLPSKRGSITTKIIATYAKLSED 519
             PPVP  +L DY   +    +            RL+ + +KR SITTK+++TYAKLSED
Sbjct: 456 APPPVPMEMLEDYKNNSKNVRRTIKKKKKKKNNYRLTLVNNKRVSITTKLLSTYAKLSED 515

Query: 520 NDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           ++WEYI+RE KRTSSDFATLID +FEHEKY
Sbjct: 516 DNWEYIERETKRTSSDFATLIDELFEHEKY 545

 Score =  184 bits (468), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 170/556 (30%), Positives = 242/556 (43%), Gaps = 139/556 (25%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNI 664
            LQ+ ++E++++LK +             ++ + RS+S P++                   
Sbjct: 584  LQQKIDEEISKLKEDAL-----------EKDNFRSVSAPIKENEDEDENE---------- 622

Query: 665  NSLLKRRTLSLETRPISRLDPGIRLSE-------ENTILEDDLECNEDRLRVEKNILETI 717
            N L  RR  SL+TRP+SRLDPGI  S        E  ++ +    N+   + ++ ILETI
Sbjct: 623  NELRNRRQFSLQTRPVSRLDPGILYSAPAEIPSYERVVVNES--GNKSSAQQQRKILETI 680

Query: 718  RRSKFLGSQYDIDKELQRVRREKL--EKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTS 775
            RRSKFLGS ++I +EL+  +R  L   K  +    + KLE GL                 
Sbjct: 681  RRSKFLGSSFNIQQELEFSQRNVLVPTKEQVVDVDEVKLEGGL----------------- 723

Query: 776  SHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYST 835
                                       RK+SEVKIPQFTR+S+HFS S+KRLSVLSMYST
Sbjct: 724  ---------------------------RKISEVKIPQFTRKSRHFSDSNKRLSVLSMYST 756

Query: 836  KVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERP 895
            K SYTNL   L +  +    +P+  T       PE +FES   +  Y+            
Sbjct: 757  KQSYTNLGHILKDGTE--ESEPAKKT-------PELLFESGRDDRLYEV----------- 796

Query: 896  KVGVEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHL---------NKP 946
                                 SE+   Q  +EDI  V LP LPPL             + 
Sbjct: 797  ---------------------SEEPEIQEEKEDIETVTLPQLPPLKQSANTNANANETEI 835

Query: 947  NGLGIYQAPAPPKEPLG----QPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKT 1002
            NGL I++    PKE +        +K +IP     K  P  ++  ++  E  PE++L + 
Sbjct: 836  NGLAIFR----PKENIELEDITKEVKEVIPSQDHGKDKPIAINNPKQRLEVKPERQLDEI 891

Query: 1003 VPERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALNKLLNGWT 1062
             P +V   E                  +       D ++   +G  +++  L KLL GWT
Sbjct: 892  APNKVGTTEKKRNVSFFRKFSNNSATIK-----GYDHEIYVNIGSRQLYTGLRKLLEGWT 946

Query: 1063 SYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXXXXX 1122
             YGLK+VRS   +  ITGKL++DNILSLRST FE+++                       
Sbjct: 947  QYGLKDVRSDNTAMKITGKLANDNILSLRSTLFELLVEPKGSKYSLIGFTKVQGSSKVVR 1006

Query: 1123 RLVNEIEKILEKESVL 1138
            RL  EIEK+L KE VL
Sbjct: 1007 RLFTEIEKVLNKEGVL 1022

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/568 (61%), Positives = 416/568 (73%), Gaps = 32/568 (5%)

Query: 5   NNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF-NAQGSTFV 63
           N    +++GD+IG WK+GETLG GSTGKV LA N  TG  AA+KVISK++F ++  ++ V
Sbjct: 4   NKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMV 63

Query: 64  GSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123
            +  PD LPYGIEREI+IMKLLNH NVLRLYDVWET  +LYMVLEY EKGELFNLLV+RG
Sbjct: 64  DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERG 123

Query: 124 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 183
           PLPENEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIK+ADFGMAALE++DKL
Sbjct: 124 PLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL 183

Query: 184 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243
           LETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ
Sbjct: 184 LETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPR 303
           +G++E+P +DEIS EA++LI +IL V P +RI  R+ILKHPLLQKYPSIKDSKSIRNLPR
Sbjct: 244 AGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPR 303

Query: 304 EDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363
           EDTYL+PL   +  ID+ ILQNLVVLWHGRD  EI +KLKE GAN EKT YA+L+RFK +
Sbjct: 304 EDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLD 363

Query: 364 NEXXXXXXXXIAKRIS---STSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHK 420
            E        +  R S   STS +P  N              +  KK R+S I+V+S+HK
Sbjct: 364 VEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHK 423

Query: 421 RPVSIQKLNDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPPVP--- 477
           RP+S QKL    TLN T                L+                +  P P   
Sbjct: 424 RPISFQKL---PTLNSTSSLAAITPSTSARRKRLSKISGYPVSNV------NGSPTPASR 474

Query: 478 -------------TAVLRDYN--KRASRASKRLSFLP-SKRGSITTKIIATYAKLSEDND 521
                        ++ ++  N  K+ +RASKR+S LP +K G+I +K+I+TYAKLSED++
Sbjct: 475 KKRNSMANIQAARSSTIKKTNTFKKNNRASKRVSILPNNKNGTIASKLISTYAKLSEDDE 534

Query: 522 WEYIDREAKRTSSDFATLIDNIFEHEKY 549
           WEY+++E KRTSS+FATLID IFEHEKY
Sbjct: 535 WEYLEQETKRTSSNFATLIDEIFEHEKY 562

 Score =  214 bits (545), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 181/564 (32%), Positives = 264/564 (46%), Gaps = 83/564 (14%)

Query: 606  QKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNIN 665
            Q+ +EE++  LK E+     E +         RS+SEP+ +K            ++  + 
Sbjct: 612  QRIMEEEIENLKKELDMMSHEGKT------ESRSVSEPLNKKQG---------GVEIEVK 656

Query: 666  SLLKRRTLSLETRPISRLDPGIRL-SEENTILEDDLECNE----DRLRVEKNILETIRRS 720
             LL++R  +L+TRP SRLDPG+   S E+      L+  E    ++L+ EK ILETIRRS
Sbjct: 657  ELLRQRNAALQTRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRRS 716

Query: 721  KFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDS 780
            KFLGS +DI KEL+          + R    R               + G  +T+     
Sbjct: 717  KFLGSSFDISKELK--------SASARSDYSR---------------APGRVITAPSNLE 753

Query: 781  ESIILPKNVTAIGVLKDEESEP--RKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVS 838
             S +LPKN  A   L+    +P  RK+S++K+PQFTR+S++FS SSKRLSVLSMYST+ S
Sbjct: 754  RSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQS 813

Query: 839  YTNLADYLN-----NDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLE 893
            + NL+D +N      D      Q + P S     + EF+FES  +E        TD  L 
Sbjct: 814  FKNLSDMMNFESENTDAAENRGQIATPNS---AGQSEFLFESVNEEAENTNNTSTDGKLY 870

Query: 894  RPKVGVEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGLGIYQ 953
                  E   + G  V L     S+  +K  SE D+   KLPILPPLD   +  GLGIYQ
Sbjct: 871  EVSESPESSSKKGLRVNL-----SDRYNKANSEADMEN-KLPILPPLDP--EIAGLGIYQ 922

Query: 954  -----APAPPKEPL-------------GQPVMKSMIPDDIKIKCVPNQLSPRRRATERAP 995
                   A P+E               G+P +  +  ++I+    P     ++   ++  
Sbjct: 923  DQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQR 982

Query: 996  EKKLTKTVPERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALN 1055
              + TK   E   +                     +K     +  + TTV  ++M++ L 
Sbjct: 983  NDERTKASKENTFSNNFLRKLSGQSNTTTQSV---KKTKLGAEDGIHTTVSATQMYQGLY 1039

Query: 1056 KLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXX 1115
             LL GW SYGLK ++    + TITGKL+S+NILSLRST FEI+I+               
Sbjct: 1040 NLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREG-KGSKVDIKKKS 1098

Query: 1116 XXXXXXXRLVNEIEKILEKESVLV 1139
                   RL  E++ +L KE V++
Sbjct: 1099 GSTKAVNRLAGEVKNVLVKEGVMI 1122

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/572 (60%), Positives = 407/572 (71%), Gaps = 39/572 (6%)

Query: 1   MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNA--- 57
           M    N+V +++ + IGPWKLGETLG GSTGKV LA+N  TGQ AAVKVISK+VFN    
Sbjct: 1   MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNV 60

Query: 58  QGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFN 117
            G++ VGS  PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  DLY+VLEY EKGELFN
Sbjct: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFN 120

Query: 118 LLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL 177
           LLV+RGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAAL
Sbjct: 121 LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 178 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN 237
           E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR 
Sbjct: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 238 LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKS 297
           LLLKVQ G++E+P +DEIS EA+DLI +ILTV+PE+RIKTR+ILKHPLLQKYPSIKDSKS
Sbjct: 241 LLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKS 300

Query: 298 IRNLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALL 357
           IR LPREDTYL PL  ++ +ID  ILQNLV+LWHGRD + I  KL+E GAN EKT YALL
Sbjct: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALL 360

Query: 358 HRFKFENEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSS 417
           +RFK + +        I KR        Q                   +K R S I+VSS
Sbjct: 361 YRFKCDTQKELVKQQQIKKR--------QSISSLSISPSKKLSTTPQRRKNRESMISVSS 412

Query: 418 AHKRPVSIQKLNDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPPVP 477
           + K+P+S  K         T              +                V Q +P   
Sbjct: 413 SRKKPISFNKF--------TASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPA 464

Query: 478 TAVLR-------------------DYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLS 517
           +   R                     NKR S++ KR+S +PS KR S+TTK+++TYAKL+
Sbjct: 465 SRNKRASVINIEKNQKRASVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKLA 524

Query: 518 EDNDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           ED+DWEYI++E KRTSS+FATLID IFE+EKY
Sbjct: 525 EDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556

 Score =  218 bits (556), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 192/584 (32%), Positives = 276/584 (47%), Gaps = 107/584 (18%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNI 664
            L+K +E  ++ L+ E++  K+EK      + ++RSIS PME      ++  +   L  +I
Sbjct: 608  LKKQIEMDISDLEQELSRHKEEK-----PDGNIRSISAPME------NEEKNIDHLGTDI 656

Query: 665  NSLLKRRTLSLETRPISRLDPGIRLSE--ENTILEDDLECNEDRLRVEKNILETIRRSKF 722
            +++L+RR  SL+TRP+SRLDPGI  S   E     +      +RL  EK ILETIRRSKF
Sbjct: 657  DNILRRRNFSLQTRPVSRLDPGIVFSNPIETVYPVEPKRSENERLTTEKKILETIRRSKF 716

Query: 723  LGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSES 782
            LGS ++I+KEL      KL K+           P + + ++   +S    V+  +   ES
Sbjct: 717  LGSSFNIEKEL------KLSKMEY---------PSVLAPEK---LSGERVVSDLNGKYES 758

Query: 783  IILPKNVTAIGVLKDE----------ESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSM 832
            +ILPK+   +  LKD+          + + RK+SEV++PQFTR+S+HFS S+KRLS+LSM
Sbjct: 759  LILPKDAKGVSQLKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSM 818

Query: 833  YSTKVSYTNLADYL-NNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTY 891
            YSTK S+TNL D L N+++ + + Q     + +   + EF+FE+  +E  Y   +  D  
Sbjct: 819  YSTKESFTNLVDILKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDER 878

Query: 892  LERPKVGVEGDHEPGEPVEL-IELDDSEDRSKQYSEEDIAKVKLPILPPL---DHLNKPN 947
            L        GD    +   L +   D  + S +Y E D   + LP LPPL   D + K N
Sbjct: 879  LYDV-----GDSTIKDKTALKLNFADRFNESTEYKETD--NLHLPSLPPLSGDDEMRKQN 931

Query: 948  GLGIYQAPAPPKEPLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERV 1007
                       ++ L QP +KSMIP            S     TE+  EK+      +  
Sbjct: 932  S---------EEDSLVQPKVKSMIPQ-----------SDSSSHTEKVEEKEGESQEVQEE 971

Query: 1008 IAAEXXXXX----XXXXXXXXXXXXXREKMHSDCDV----QLDTTVGDSKMFR------- 1052
               E                      +EK H    +    Q   T G+S  FR       
Sbjct: 972  SEKEAKDIEPPLNKSVQKLREKNPGPQEKDHQRDHLKEHKQDRNTTGNSSFFRKFSKSSA 1031

Query: 1053 ------------------ALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTA 1094
                               L KLL GWT +GLK ++S P + T+TGKLSS+NI SLRST 
Sbjct: 1032 SDKLVELYAKVSARQLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTL 1091

Query: 1095 FEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVL 1138
            FEI I                       +LVNE+E +L KE VL
Sbjct: 1092 FEINIYPKG-RMSVVQFKKISGSFKAVKKLVNEVENVLNKEGVL 1134

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/563 (60%), Positives = 416/563 (73%), Gaps = 26/563 (4%)

Query: 5   NNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVG 64
           +N V+ ++ ++IGPWKLGETLG+GSTGKVLLA N  T Q AAVKVISK+VF A  ++   
Sbjct: 6   SNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESN 65

Query: 65  SNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGP 124
            +  + LPY IE+EIIIMKLLNHPNVLRL+DVWET  DLY+VLEY EKGELFN+LV+RGP
Sbjct: 66  GDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGP 125

Query: 125 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 184
           LPENEAVR FRQIIIGISYCH+LG+VHRDLKPENLLLD+K NIK+ADFGMAALES+DKLL
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKLL 185

Query: 185 ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
           ETSCGSPHYAAPEI+SGLPY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQ 
Sbjct: 186 ETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQK 245

Query: 245 GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304
           G++E+P +DEI+ EA+DL+ ++LTV+P +RI  REILKHPLLQKYPSIKDS+SIRNLPRE
Sbjct: 246 GEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPRE 305

Query: 305 DTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFEN 364
           DTYL+PL   +  ID AILQNLV+LWHG+D  EI  KL+EPGAN EKT YALL+RFK + 
Sbjct: 306 DTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDT 365

Query: 365 EXXXXXX---XXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHKR 421
           +           I +R S+  S+  ++  K            TP+KK   A  ++S+ KR
Sbjct: 366 QREANRARRQSKIVQRNSTIRSTAPESPSKKKTY--------TPQKKNKRASIIASSSKR 417

Query: 422 PVSIQKLNDCGTLNP-------TXXXXXXXXXXXXXXAVLAGX----XXXXXXXXXXXVG 470
           PVS+ K     T+N        +              + L G                + 
Sbjct: 418 PVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGTRDSPTKTSRSRRSSIIT 477

Query: 471 QD---APPVPTAVLRDYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYID 526
           +D     P  + +   +NKRAS++SKR+S +P+ KR S+TTK++ATYAKLSED+DWEYI+
Sbjct: 478 KDFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIE 537

Query: 527 REAKRTSSDFATLIDNIFEHEKY 549
           RE KRTSSDFATLID IFE+EKY
Sbjct: 538 RETKRTSSDFATLIDEIFEYEKY 560

 Score =  207 bits (526), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 182/559 (32%), Positives = 263/559 (47%), Gaps = 91/559 (16%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNI 664
            + + ++E+++ LK E+   +         E   RS+SEP+E      SK      ++ +I
Sbjct: 609  IARQMDEEISNLKKELVGDQD-------NEDKFRSVSEPLE------SKSKKIEDIEEDI 655

Query: 665  NSLLKRRTLSLETRPISRLDPGI------RLSE----ENTILEDDLECNEDRLRVEKNIL 714
            + +L+ R  SL+TRP+SRLDPGI      R SE    E   LE +LE        E+ IL
Sbjct: 656  DGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELE------ETEQKIL 709

Query: 715  ETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVT 774
            ETIRRSKFLGS +DI KEL+ V+R +     + K       P L                
Sbjct: 710  ETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEM---APPALPE-------------- 752

Query: 775  SSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYS 834
                      LPK V    V  D     RK+S++K+PQFTR+S+HFS S++RLSVLSMYS
Sbjct: 753  ---------TLPKAVEKKNVSMD--PSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYS 801

Query: 835  TKVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLER 894
            TK SY+NLAD L N    K +  +APT  K   + + +F++  + +   + +  +   E 
Sbjct: 802  TKESYSNLADILKNGPGEKEMIQTAPTP-KSADDSDQLFDTIDEADTPASVSREERLYE- 859

Query: 895  PKVGVEGDHE-PGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGLGIYQ 953
              V  E ++E   + +++ +L +SE  + +  EE    +KLP LPPL             
Sbjct: 860  --VAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFE----------- 906

Query: 954  APAPPKEPLGQPVMKSMIPDDIKIKCVPNQ-----------LSPRRRATERAPEKKLTK- 1001
                 KE   Q   KSMIP++++      Q           L+P         +K +TK 
Sbjct: 907  -DGSTKETKEQS--KSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKE 963

Query: 1002 --TVPERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALNKLLN 1059
              TV  +  + +                        + DV L T+V   ++F  L  LL 
Sbjct: 964  KPTVTMKTTSEQVSADKKRNMSFLRKLSKGSSSSKDNVDVTLSTSVSSKQLFSGLVNLLK 1023

Query: 1060 GWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXX 1119
            GWT YGLK +     S TITGKL++DNILS RSTAF I+I S  +               
Sbjct: 1024 GWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFS-QEKGSAVTFRKVSGSGK 1082

Query: 1120 XXXRLVNEIEKILEKESVL 1138
               RL +E++K+L KE VL
Sbjct: 1083 AVRRLSDEVKKVLSKEGVL 1101

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/574 (60%), Positives = 417/574 (72%), Gaps = 43/574 (7%)

Query: 1   MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNA--- 57
           M    N++ +++ + IGPWKLGETLG GSTGKV LA+N  TGQ AAVKVISK+VFN    
Sbjct: 1   MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60

Query: 58  QGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFN 117
            G++ VGS  PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  DLY+VLEY EKGELFN
Sbjct: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 118 LLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL 177
           LLV+RGPLPE+EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAAL
Sbjct: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 178 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN 237
           E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR 
Sbjct: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 238 LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKS 297
           LLLKVQ G++E+P +DEIS EA+DLI +ILTV+PE+RIKTR+ILKHPLLQKYPSI+DSKS
Sbjct: 241 LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300

Query: 298 IRNLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALL 357
           IR LPREDTYL PL  ++ +ID  ILQNLV+LWHGRD   I  KL+EPGAN EKT YALL
Sbjct: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360

Query: 358 HRFKFENEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKKRS--SAINV 415
           +RFK + +        + KR S +S S   +              +TP+++R+  S I+V
Sbjct: 361 YRFKCDTQKELIKQQQVKKRQSISSVSVSPSKKVS----------TTPQRRRNRESLISV 410

Query: 416 SSAHKRPVSIQKLNDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPP 475
           +S+ K+P+S  K         T              +                V Q +P 
Sbjct: 411 TSSRKKPISFNKF--------TASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPT 462

Query: 476 VPTAVLR-------------------DYNKRASRASKRLSFLPS-KRGSITTKIIATYAK 515
             +   R                     NKR+SR+ KR+S +PS KR S+TTK+++TYAK
Sbjct: 463 PASRNKRASVINVEKNQKRASIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAK 522

Query: 516 LSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           L+ED+DWEYI++E KRTSS+FATLID IFE+EKY
Sbjct: 523 LAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556

 Score =  225 bits (573), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 199/589 (33%), Positives = 284/589 (48%), Gaps = 111/589 (18%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNI 664
            L+K +E  ++ L+ E++  K+EK      + ++RSIS PME      ++  +   L+ +I
Sbjct: 608  LKKQIEIDISDLEQELSKHKEEK-----LDGNIRSISAPME------NEEKNINHLEVDI 656

Query: 665  NSLLKRRTLSLETRPISRLDPGIRLS---EENTILEDDLECNEDRLRVEKNILETIRRSK 721
            +++L+RR  SL+TRP+SRLDPGI  S   EE + +E     NE RL  EK ILETIRRSK
Sbjct: 657  DNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENE-RLTTEKKILETIRRSK 715

Query: 722  FLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQ---EQRFVSDGTTVTSSHE 778
            FLGS ++IDKEL      KL K+           P + + Q   E+R VSD      S++
Sbjct: 716  FLGSSFNIDKEL------KLSKMEY---------PSIIAPQRLSEERVVSD------SND 754

Query: 779  DSESIILPKNVTAIGVLKDEESEP--------RKLSEVKIPQFTRRSKHFSASSKRLSVL 830
              ES+ILPK+   +  LKD  +          RK+SE+++PQFTR+S+HFS S+KRLSVL
Sbjct: 755  GYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVL 814

Query: 831  SMYSTKVSYTNLADYL-NNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTD 889
            SMYSTK S+TNL D L N ++ + + Q     + +   + EF+FE+  +E  Y   +  D
Sbjct: 815  SMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSND 874

Query: 890  TYLERPKVGVEGDHEPGEPVEL-IELDDSEDRSKQYSEEDIAKVKLPILPPL---DHLNK 945
              L        GD    +   L +   D  + S +  + D   + LPILPPL   + L K
Sbjct: 875  ERLYDV-----GDSTIKDKSALKLNFADRFNGSNEAKQTD--NLHLPILPPLNGDNELRK 927

Query: 946  PNGLGIYQAPAPPKEPLGQPVMKSMIPDD--------IKIKCVPNQLSPRRRATERAPEK 997
             N     QA          P +KSMIP+          +      +  P +   E   EK
Sbjct: 928  QNSQEGDQA---------HPKIKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEK 978

Query: 998  KLTKTVPERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQ-----LDTTVGDSKMFR 1052
            +      E+V+                     + K HS   ++      +T +G+   FR
Sbjct: 979  R------EKVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGSFFR 1032

Query: 1053 ALN-----------------------KLLNGWTSYGLKEVRSMPASYTITGKLSSDNILS 1089
              +                       KLL GWT YGLK ++S P + T+TGKLSSDNI S
Sbjct: 1033 KFSKSSDKTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFS 1092

Query: 1090 LRSTAFEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVL 1138
            LRST FE+ I                       +LVNE+E +L KE VL
Sbjct: 1093 LRSTLFEVNIYPRG-KMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/595 (59%), Positives = 418/595 (70%), Gaps = 67/595 (11%)

Query: 10  SLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFN------------- 56
           ++ G+ IGPWKLGETLG GSTGKV LA N +T Q AA+K+ISKSVF+             
Sbjct: 10  TVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSAL 69

Query: 57  -----AQGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVE 111
                  GS     ++ + LPYGIEREIIIMKLLNH NVLRLYDVWET  +LYMVLEY E
Sbjct: 70  AASDVNNGSV---QHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAE 126

Query: 112 KGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLAD 171
           KGELFNLLV++GPL ENEAVRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIK+AD
Sbjct: 127 KGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIAD 186

Query: 172 FGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE 231
           FGMAALE++DKLLETSCGSPHYAAPEIVSGLPY+G E+D+WSCGVIL+ALLTGRLPFDEE
Sbjct: 187 FGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEE 246

Query: 232 DGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPS 291
           DGNIRNLLLKVQ G++E+PG DE+S EA+DLI +ILTV P+QRIKTREILKHPLLQKYP+
Sbjct: 247 DGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPN 306

Query: 292 IKDSKSIRNLPREDTYLNPLDHNDGT---IDQAILQNLVVLWHGRDKNEITMKLKEPGAN 348
           IKDSK+IR+LPREDTYLNPL  N+G    ID++ILQNL VLWHG+DKNEI  KLKEPGAN
Sbjct: 307 IKDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGAN 366

Query: 349 LEKTFYALLHRFKFENEXXXXXXXXIAKRISSTSSSPQQNIVKXXXXXXXXX-XLSTPKK 407
            EKT Y LLHRFK + E        + KR         Q+++K           +   +K
Sbjct: 367 AEKTLYVLLHRFKEDTERENHKNSQLRKR---------QSLMKASSSSSSNQGNVPRRRK 417

Query: 408 KRSSAINVSSAHKRPVSIQKLNDCGTLN------PTXXXXXXXXXXXXXXAVLAGXXXXX 461
            R+S I+V+S+HK+PVS  K+   G  +      P+              ++ +      
Sbjct: 418 NRNSMISVTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKRNS 477

Query: 462 XXXXXXXVGQDAP--------------------PVPTAVLRDY------NKRASRASKRL 495
                       P                    P+P  VL+DY      NKR SR SKR 
Sbjct: 478 RLYTQSNSSSPTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRGSRLSKRY 537

Query: 496 SF-LPSKRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKY 549
           SF L +KRGS+TTKI++TYAKL+ED+DWE+I++E KR SSDFATLID IFEHEK+
Sbjct: 538 SFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKF 592

 Score =  196 bits (499), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 179/551 (32%), Positives = 269/551 (48%), Gaps = 78/551 (14%)

Query: 605  LQKSLEEQVARLKAEVAATKQEKRISLAQEQHV--RSISEPMERKGTRPSKRDSFLALQN 662
            LQ  ++E+   LK E      E      QE  +  RS+SEP++  GT    +        
Sbjct: 646  LQNDIDEEARLLKDEFNFVNDE-----TQENPINSRSVSEPVKNGGTDEKGQ-------- 692

Query: 663  NINSLLKRRTLSLETRPISRLDPGIRLS-----EENTILEDDLECNEDRLRVEKNILETI 717
                    R  SL+TRPISRLDPG+  S     + N+ ++++L  N      +K ILETI
Sbjct: 693  --------RNFSLQTRPISRLDPGLMFSKLGDVDNNSSVDENLTMNN-----QKTILETI 739

Query: 718  RRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSH 777
            RRSKFLGS +DI+KEL     E+     ++  + ++LE      +++R  S      +S+
Sbjct: 740  RRSKFLGSSFDINKELNNANEERKRLRQLQLQKQKELE------EKERIAS------TSY 787

Query: 778  EDSESIILPKNVTAIGVLKDEES--EPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYST 835
              +E+ +L KN   +  LKD  S  EPRK+SEV++PQFTR+SK+FS S+KRLSVLS YS+
Sbjct: 788  VSNENQVLSKNAIGVVDLKDFSSDVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSFYSS 847

Query: 836  KVSYTNLADYLN-NDVQLKSLQPSAPTSIKIPQEPEFMFESAGQEN-RYQAAAPTDTYLE 893
            K SYTNL D +  N V+ +           + ++P F FE +  +    +  AP +   E
Sbjct: 848  KQSYTNLVDMIKENPVEDED----------VTEDPGFNFEDSQYDYLEEKNEAPLEVSDE 897

Query: 894  RPKV---GVEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNKPN--G 948
             PK     V+ + +    ++L   D   + +    +E   + K P +     L+K    G
Sbjct: 898  VPKEVDDKVQEEEKNSVSMKLNFADRFSNVNSNTKQESSFEDKFPNI-----LSKSGTEG 952

Query: 949  LGIYQAPAPPKEPLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERA-PEKKLTKTVPERV 1007
            LG+Y +     EP  +PV KSMIP++ K+   P   +P  +   +   E K T   P   
Sbjct: 953  LGLY-SKNEKTEP--KPV-KSMIPEEDKVNSSPVVEAPLNKVVNKTRAENKSTSKGPS-- 1006

Query: 1008 IAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLK 1067
              ++                          +V L ++V ++++F  L  LL GWT+YGLK
Sbjct: 1007 -GSQKVSNTSSFLRKISGKSSNSTVAKGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGLK 1065

Query: 1068 EVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXXXXXRLVNE 1127
            +V+       I GKLS+DNILSLRST  E+ + + +                   RL +E
Sbjct: 1066 DVKVDKQKKMIVGKLSNDNILSLRSTIVELCVFTES-KFSVIGIRKKSGSSKTMRRLASE 1124

Query: 1128 IEKILEKESVL 1138
            IEK+L KE VL
Sbjct: 1125 IEKVLSKEGVL 1135

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/428 (71%), Positives = 349/428 (81%), Gaps = 11/428 (2%)

Query: 11  LRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSN--DP 68
           ++G+ +GPWKLGETLG GSTGKV LA N+ TGQ AA+KVISK+VFN   +    S    P
Sbjct: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANASDSALLTP 71

Query: 69  DVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPEN 128
           D LPYGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY EKGELFNLLV+RGPLPEN
Sbjct: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131

Query: 129 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSC 188
           EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLLETSC
Sbjct: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191

Query: 189 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYE 248
           GSPHYAAPEI+SGLPYHG E+DVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQSG++E
Sbjct: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251

Query: 249 IPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYL 308
           +PG DEIS EA+DLI +ILTV+P++RIKTREILKHPL+QKYPSIKDSK+IRNLPREDTYL
Sbjct: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311

Query: 309 NPLDHNDGT---IDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFENE 365
           NPL  ++G    ID  ILQNLVVLWHGRD  EIT KLKEPGAN EKT YALL RFK + E
Sbjct: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371

Query: 366 XXXXXXXXIAKR---ISSTSSSPQQNIVKXXXXXXXXXXLSTP--KKKRSSAINVSSAHK 420
                   + KR   +  T S    N             ++TP  +K R+S ++VSSAHK
Sbjct: 372 KEIKRQSQLKKRQSQVQQTHSHSNSN-TSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430

Query: 421 RPVSIQKL 428
           RPVS  +L
Sbjct: 431 RPVSFNRL 438

 Score =  150 bits (380), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 129/369 (34%), Positives = 182/369 (49%), Gaps = 75/369 (20%)

Query: 638  RSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLSEEN---- 693
            RS+S P+E+  T  S+   F           K+R  SL TRP+SRLDPG+  S       
Sbjct: 762  RSVSAPLEK--TEKSRDSPF--------DYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSA 811

Query: 694  ---TILEDDLECNE--DRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRK 748
               +   +DL      +R+  +K ILETIRRSKFLGS +D+ KEL+ V   +  ++  + 
Sbjct: 812  YNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQA 871

Query: 749  SQDRKLEP----GLHSRQEQRFVSDGTTVTSSHEDSESIILPKN----VTAIGVLKDEES 800
             QD  LE          Q     S+   V+++++  E+ ILPK+       IG L D   
Sbjct: 872  FQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIG-LNDSSV 930

Query: 801  EPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLNNDVQLKSLQPSAP 860
            +PR LSE+K+PQFTR+SK FS S+KRLSVLS+YS++ S+TNL D L  D    +++P+  
Sbjct: 931  QPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDG--INVEPTER 988

Query: 861  TSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDS-ED 919
            +     QEPEF+FES   +   + ++  D  +         + E  EP++   L  S  D
Sbjct: 989  SPTTKSQEPEFLFESPSVDTYSRDSSTEDKPI--------NEKENSEPIQSNNLRLSFHD 1040

Query: 920  R-SKQYSEEDIAK----------------------------------VKLPILPPLDHLN 944
            R ++Q S ED  K                                  VKLP LPPL    
Sbjct: 1041 RFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLT-TK 1099

Query: 945  KPNGLGIYQ 953
            K +GLGIYQ
Sbjct: 1100 KTDGLGIYQ 1108

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 1/64 (1%)

Query: 487 RASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFE 545
           RASR+ KR S  P+ +RGSITTK+I+TYA+L+ED+DWE+I++E KR SS+FATLIDNIFE
Sbjct: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665

Query: 546 HEKY 549
           HEKY
Sbjct: 666 HEKY 669

 Score = 88.6 bits (218), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 60/105 (57%)

Query: 1035 SDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTA 1094
            +D D QL   V   +MF+ L+ L  GW+ YGLK ++S P S   TGK+SS+NILS +ST 
Sbjct: 1286 NDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTV 1345

Query: 1095 FEIVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVLV 1139
            FE+ I+S +                   RLVNE+E +L KE VL+
Sbjct: 1346 FELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/542 (56%), Positives = 376/542 (69%), Gaps = 40/542 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           IGPWKLGETLG GS GKV LAQ+  T    AVK+ISKS+FN +G+     N   VLPY I
Sbjct: 18  IGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNY---GNHGSVLPYNI 74

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
           EREI+IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLLV RG LPE EA++ FR
Sbjct: 75  EREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCFR 134

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QIII +SYCHALGIVHRDLKPENLLLD  +NIK+ADFGMAAL++   LLETSCGSPHYAA
Sbjct: 135 QIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSPHYAA 194

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDEE+GNIR LLLKVQ G++E+P + EI
Sbjct: 195 PEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEI 254

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHND 315
           S +A+DLI +IL V+P QRIK R+IL HPLL++Y +IKDSKSI++LPREDTYL PL    
Sbjct: 255 SKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADAG 314

Query: 316 GTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE-----NEXXXXX 370
             ID +ILQNLVVLWHGR  +EI  KLK  G N EKT YALL+RFK E     N+     
Sbjct: 315 AAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKRRRHK 374

Query: 371 XXXIAKRISSTSSSPQQNIVKXXXXXXXXXXLSTPKKK--RSSAINVSSAHKRPVSIQKL 428
                 R  STSSS    +VK           STP+K+  ++ + N SS  KR   I   
Sbjct: 375 TKKTKNRKFSTSSS----LVKGRNLE------STPRKRTSKTHSNNFSSGKKRSSFILSP 424

Query: 429 NDCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPPVPTAVLRDYNKRA 488
           N   ++N +              A   G                +P VP  +L  + + +
Sbjct: 425 N---SINSSPIPLRNSKGISLRNATSGG----------------SPVVPVILLNSFKRNS 465

Query: 489 SRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHE 547
             +SKR S++P+ K GS+T+++++ Y KL +++DWE I+++ KRTSS+FATLID IFE E
Sbjct: 466 KLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEIFEPE 525

Query: 548 KY 549
           ++
Sbjct: 526 EF 527

 Score =  122 bits (306), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 140/502 (27%), Positives = 219/502 (43%), Gaps = 93/502 (18%)

Query: 660  LQNNINSLLKRR-TLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLR-VEKNILETI 717
            L  +I++LL  R  LS  TRPIS+LDPG+  +   T    D++     +R  E  I+ETI
Sbjct: 584  LLQDIDTLLTNRYQLSAYTRPISKLDPGLMPAAGTT--PHDIKEQTALIRDTEVKIIETI 641

Query: 718  RRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSH 777
             RSKFLGS  ++        RE + K       D +L P          + + + ++++ 
Sbjct: 642  HRSKFLGSLLNV--------REGMSK------DDDELAP----------IEESSIISTT- 676

Query: 778  EDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKV 837
                            ++ D+ +E RK+S+V++P FTR+S+HF+A+S R SVLS+YS++ 
Sbjct: 677  ---------------PLIYDDRTEVRKISDVEVPHFTRKSRHFTAASNRRSVLSLYSSRD 721

Query: 838  SYTNLADYLNNDVQLKSLQPSA--PTSIKIPQEPEFMFESA-----GQENRYQAAAPTDT 890
            S+ +L+    N+      Q S    +S K     E +   A        N + +   +D 
Sbjct: 722  SFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESLASVAEHIDDDSYNDHNSGMNSDN 781

Query: 891  YLERPKVGVEGDHEPGEPVELIELDD-SEDRSKQYSEEDIAKVKLPILPPLDHLNKPNGL 949
             L     GV+       P E+   D+ S       S E    V+LP L      N  +GL
Sbjct: 782  VLYDVPEGVD------LPQEVKNSDEQSSCSLVSSSLEPTPVVELPSLSSFQGKN-ASGL 834

Query: 950  GIYQ-APAPPKEPLGQ------------PVMKSMIPDDIKIKCVPNQLSPRRRATERAPE 996
            GIYQ  P+    P                V K +  D I      + +     AT  AP 
Sbjct: 835  GIYQREPSKVSLPTATIDTSDAVENRETEVKKELKHDSIATNLPDDNVKENNNATAEAPS 894

Query: 997  KKLTKTVPERVIAAEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALNK 1056
            + + K+    ++                     + K+    ++++   + + ++F  L+K
Sbjct: 895  R-IKKSSNVSIL-----------------KNISKGKI---LELEIHAKIPNKRLFEGLHK 933

Query: 1057 LLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXX 1116
            LL GW  YGLK++    A   I GKL +D+ILSLRST FEI++L   D            
Sbjct: 934  LLEGWKQYGLKKLGFDAAKMIIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKTG 993

Query: 1117 XXXXXXRLVNEIEKILEKESVL 1138
                  +L  EI+ IL+KE VL
Sbjct: 994  SSKVLTKLATEIQIILQKEGVL 1015

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/545 (56%), Positives = 379/545 (69%), Gaps = 38/545 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           IGPWKLGETLG GSTGKV LA++  TGQ  AVKVI KS+F ++GS   G+ND  VLP+ I
Sbjct: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH--GNND-SVLPFNI 74

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
           EREI+IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLLV RGPLPE EA++ F+
Sbjct: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QIII ISYCHALGIVHRDLKPENLLLD+ +NIK+ADFGMAAL++   +LETSCGSPHYAA
Sbjct: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ G++E+P   EI
Sbjct: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL---- 311
           S +A+DLI +IL V+P QRIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL    
Sbjct: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314

Query: 312 DHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFENEXXXXXX 371
           +H   TID +ILQNLV+LWHGR   EI  KL++ G N EKT YALL+RFK E+       
Sbjct: 315 NHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNKR 374

Query: 372 XXIAKRISSTSSSPQQNIVKXXXXXXXXXXL--STPKK--KRSSAINVSSAHKRPVSIQK 427
                +I+ T  S + + +              S P+K   R  + N  S+ KR   I  
Sbjct: 375 SR--SKINKTKKSKRVSTLSSSSSSAFNHQSLDSAPRKHASRGHSKNFPSSRKRSSFILS 432

Query: 428 LN--DCGTLNPTXXXXXXXXXXXXXXAVLAGXXXXXXXXXXXXVGQDAPPVPTAVLRDYN 485
            N  DC  +                                  V  +   VP + L+   
Sbjct: 433 SNSTDCSPI---------------------PLRSSKRISISSAVPGNTLQVPDSSLK-LK 470

Query: 486 KRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIF 544
           + + R+SKRLS++P+  RGS+TT +++ Y  L +D+DWEYID++ KRTSS+FATLID IF
Sbjct: 471 RNSKRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFATLIDEIF 530

Query: 545 EHEKY 549
           E EK+
Sbjct: 531 EPEKF 535

 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 130/499 (26%), Positives = 211/499 (42%), Gaps = 88/499 (17%)

Query: 660  LQNNINSLLKRR-TLSLETRPISRLDPGI---------RLSEENTILEDDLECNEDRLRV 709
            L  +I++LL  R  LS  TRPISRLDPG+          + E+  +L+D           
Sbjct: 600  LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQD----------T 649

Query: 710  EKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSD 769
            E  I+ETIR+S+FLGS  ++        RE + + N + +                    
Sbjct: 650  EMKIIETIRKSEFLGSLLNV--------REGISQDNNQLA-------------------- 681

Query: 770  GTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSV 829
                        SI +   ++   ++ +++ E RK+S+V++P FTR+SKHF+ ++ R SV
Sbjct: 682  ------------SIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSV 729

Query: 830  LSMYSTKVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTD 889
            LS+YS K S  +L     N+      Q S   + K  +  + + E   Q+N       ++
Sbjct: 730  LSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASK-SELVDVIEEVTEQKNSQHDQDDSN 788

Query: 890  TYLERPKVGVEGD-HEPGEPVELIELDDSEDRSKQYSEEDIAK--VKLPILPPLDHLNKP 946
                     +  D  E  +  +  +++D+       S+    K  VKLP L      N  
Sbjct: 789  DSNGMNNNNILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQRKN-A 847

Query: 947  NGLGIYQAPAPPKEPLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPER 1006
            +GLGIYQ  +           +  +P       V   +S   + TE   +K++     + 
Sbjct: 848  SGLGIYQRESS----------RESLP------SVTINISESDKTTENEAQKEIKHDKSDT 891

Query: 1007 VIA-----AEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLD--TTVGDSKMFRALNKLLN 1059
            +++     A+                   +K+     ++LD    + + +++  L+KLL 
Sbjct: 892  ILSNHDGKADSYKGDISNIVRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLE 951

Query: 1060 GWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXXX 1119
            GW  YGLK +    A   I+GKL +D ILSLRST FEIVIL                   
Sbjct: 952  GWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTK 1011

Query: 1120 XXXRLVNEIEKILEKESVL 1138
               +   EI+ IL+KE VL
Sbjct: 1012 TLTKFATEIQIILQKEGVL 1030

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  534 bits (1376), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/352 (71%), Positives = 291/352 (82%), Gaps = 7/352 (1%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           IGPWKLGETLG GSTGKV LAQ+  TG   AVKVISKS+FN  G+    SND  VLPY I
Sbjct: 18  IGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGN---HSNDDSVLPYNI 74

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
           EREI+IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLLV  GPLPE EA+  FR
Sbjct: 75  EREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFR 134

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QIIIGISYCHALGIVHRDLKPENLLLD  +NIK+ADFGMAAL++   LLETSCGSPHYAA
Sbjct: 135 QIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAA 194

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ G++E+P + EI
Sbjct: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEI 254

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL---- 311
           S +A+DLI +IL V+P QRIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL    
Sbjct: 255 SRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSN 314

Query: 312 DHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363
           +H   +ID +ILQNLVVLWHGR  ++I  KLKE G N EK  YALL+RFK +
Sbjct: 315 NHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLD 366

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 52/61 (85%), Gaps = 1/61 (1%)

Query: 490 RASKRLSFLP-SKRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEK 548
           R+SKRLS++P +KR S+T+K ++ +  L +D+DWEYI+++AKRTSS+FATLID IFE EK
Sbjct: 477 RSSKRLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEK 536

Query: 549 Y 549
           +
Sbjct: 537 F 537

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 99/197 (50%), Gaps = 61/197 (30%)

Query: 660 LQNNINSLLKRR-TLSLETRPISRLDPGI---------RLSEENTILEDDLECNEDRLRV 709
           L  +I++LL  R  LS  TRPISRLDPG+          L E+  +L+D           
Sbjct: 601 LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQD----------T 650

Query: 710 EKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSD 769
           EK I+ETIRRSKFLGS                  +N+R      L PG   + E   + +
Sbjct: 651 EKKIIETIRRSKFLGSL-----------------LNVRGG----LSPG---KSELAPIEE 686

Query: 770 GTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSV 829
              V+++                 ++ ++  EPR++S+V++P FTR+SKHF+ ++ R SV
Sbjct: 687 SPIVSTT----------------PLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSV 730

Query: 830 LSMYSTKVSYTNLADYL 846
           LS+Y+ K S  +L ++L
Sbjct: 731 LSLYA-KDSIKDLNEFL 746

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (53%)

Query: 1037 CDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFE 1096
             ++++   + + +++  L+KLL GW  YGLK +     +  ITGKL +D+IL LRST FE
Sbjct: 934  LELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFE 993

Query: 1097 IVILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVL 1138
            I++L   D                  +L  EI+ IL+KE VL
Sbjct: 994  IMVLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVL 1035

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  526 bits (1355), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/352 (69%), Positives = 292/352 (82%), Gaps = 7/352 (1%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           IGPW+LGETLG+GSTG+V LAQ+  TG   AVKVISK++F+ +     G      LPY I
Sbjct: 10  IGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDG---GGXXXLALPYNI 66

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
           EREI++MKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLLV RGPLPE EAV+ FR
Sbjct: 67  EREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKCFR 126

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QIII ISYCHALGIVHRDLKPENLLLD+ +NIK+ADFGMAAL++  +LLETSCGSPHYAA
Sbjct: 127 QIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSPHYAA 186

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDE++GN+R+LLLKVQ G++E+P   EI
Sbjct: 187 PEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEI 246

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL---- 311
           S +A++LI +IL V+P QR+KTR+IL HPLL+KY +I+DSKSIRNLPRE+TYL PL    
Sbjct: 247 SKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLADAG 306

Query: 312 DHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363
           +H + TID +ILQNLVVLWHGR  +EI   LK+ G N EKT YALL+RFK E
Sbjct: 307 NHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQE 358

 Score = 94.4 bits (233), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 62/79 (78%), Gaps = 1/79 (1%)

Query: 472 DAPPVPTAVLRDYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAK 530
           + PPVP  +L  Y + + R+SKRLS++P+ KRGS+T+K ++ Y  L +++DWEYI+++ K
Sbjct: 447 NVPPVPVKLLNSYKRNSKRSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTK 506

Query: 531 RTSSDFATLIDNIFEHEKY 549
           RTSS+FATLID IFE EK+
Sbjct: 507 RTSSNFATLIDEIFEPEKF 525

 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 95/189 (50%), Gaps = 41/189 (21%)

Query: 660 LQNNINSLLKRRT-LSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRVEKNILETIR 718
           L  +IN+LL  R  LS  TRPIS+LDPG+  + E TI  D  E  +  L  E  ILETIR
Sbjct: 590 LLQDINTLLTNRCQLSAYTRPISKLDPGLMPTPE-TIPYDIKEKTDLLLDTEMKILETIR 648

Query: 719 RSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHE 778
           +SK L S  ++ KE+ R               DR     L S +E    S  TT    + 
Sbjct: 649 KSKILDSSLNLRKEVSR-------------DADR-----LPSVEESPIAS--TTPLVYNN 688

Query: 779 DSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVS 838
           DS+ +                    K+S++++P FTR+SK F+ ++ R SVLS+YS++ S
Sbjct: 689 DSKEVC-------------------KISDIQVPHFTRKSKCFTPTNNRRSVLSLYSSRHS 729

Query: 839 YTNLADYLN 847
           +  L+  LN
Sbjct: 730 FKGLSRILN 738

 Score = 71.6 bits (174), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 56/101 (55%)

Query: 1038 DVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEI 1097
            ++++   +   ++F  L+KLL GW  YGLK +    A+  ITGKL +DNILSLRST FEI
Sbjct: 922  ELEIHAKIPAERLFEGLHKLLEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEI 981

Query: 1098 VILSVADXXXXXXXXXXXXXXXXXXRLVNEIEKILEKESVL 1138
            ++L   D                  +L  EI+ +L+KE VL
Sbjct: 982  IVLPNRDDRSLIKFNKKTGSTKTLKKLGYEIQIVLQKEGVL 1022

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  419 bits (1076), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 212/367 (57%), Positives = 261/367 (71%), Gaps = 22/367 (5%)

Query: 202 LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARD 261
           LPYHGFESDVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQSG++E+P  DEISPEA+D
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 262 LIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHNDGTIDQA 321
           LI +ILTV+P  RIK+REILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD  +G+ID++
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 322 ILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFENEXXXXXXXXIAKRISST 381
           I+ NLVVLWHGRD+NEIT +LKEPGANLEKTFYALL RFK ++           +R  ++
Sbjct: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ---RRSQAS 186

Query: 382 SSSPQQNIVKXXXXXXXXXXLSTPKKKRSSAINVSSAHKRPVSIQKL---NDCGTLN--P 436
             SP+++ ++          ++  KK ++  I+ SS+HKRPVS  +L   N   T +  P
Sbjct: 187 HISPKRSNMRNSVSRRSITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPP 246

Query: 437 TXXXXXXXXXXXXXXAVLA------GXXXXXXXXXXXXVGQDAPPVPTAVLRDYNK---- 486
           T               + A                   +   APP+P  +L+DYNK    
Sbjct: 247 TSASKRASVNLSSNKRISALINPNNSPTPVHKRSSMRDLDASAPPIPMDMLKDYNKSAPK 306

Query: 487 ---RASRASKRLSFLP-SKRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDN 542
              R++R SKRLSFLP +KRGSITTK+IATYAK+S+DNDWEYI++E +RTS+DFATL D 
Sbjct: 307 VSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDE 366

Query: 543 IFEHEKY 549
           IFEHEKY
Sbjct: 367 IFEHEKY 373

 Score =  317 bits (813), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 223/564 (39%), Positives = 291/564 (51%), Gaps = 57/564 (10%)

Query: 606  QKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNIN 665
            Q+ +E+++A LK  V           +   HVRS+S P E    +  KR S   L N+I 
Sbjct: 431  QELIEQEIALLKQSVNPQ------GPSDSNHVRSVSAPAE-SVLKVDKRGSTGNLDNDIM 483

Query: 666  SLLKRRTLSLETRPISRLDPGIRLSEENTILEDDLECNEDRLRVEKNILETIRRSKFLGS 725
            +LL RRT SLETRP SRLDPGI  SEE      +   +   L  EK ILETIRRSKFLGS
Sbjct: 484  ALLNRRTFSLETRPKSRLDPGIYTSEEEDFGSKNHGAD---LSTEKTILETIRRSKFLGS 540

Query: 726  QYDIDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIIL 785
             +DI+KEL R RR K E+  + K +D           E+R  S+ TT        ES  L
Sbjct: 541  SFDINKELARERRLKEERAALAKRKD-----------EERVASNATTANVVGNGYESQTL 589

Query: 786  PKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADY 845
            PK    +G   +  SEPRK+SEV++PQFTRRS+HF+AS+KRLSVLSMYSTK S+TNLAD+
Sbjct: 590  PKR--KMGSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADH 647

Query: 846  LNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEP 905
            L     ++ +Q S P++ K+ QE EFMFES  +E +  A    D+ L   +V    D + 
Sbjct: 648  LKGKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLY--EVAETKDAKN 705

Query: 906  GEPVELIELDDSEDRSKQYSEEDI---AKVKLPILPPLDHLNKPN---GLGIYQAPAPPK 959
             +P   +   D  +R      +D    A +KLP LPPLD  NKPN   GLG+YQA A P 
Sbjct: 706  AKPAVKLNFADRFNRPTSPPSQDTDSSAAIKLPALPPLDK-NKPNMVSGLGLYQATAEPS 764

Query: 960  EPLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIA---------- 1009
                QPV KSM+ DD++ +       PR   TE     K +  VP   +A          
Sbjct: 765  HEDAQPVAKSMVIDDVESEIT---TEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNT 821

Query: 1010 -----------AEXXXXXXXXXXXXXXXXXXREKMHSDCDVQLDTTVGDSKMFRALNKLL 1058
                                            EK   D D +  T + +++MF AL+KLL
Sbjct: 822  DADRKPLSDITPAVEKKANKSFFRKFSSKGSDEKKSGDYDFRFKTVIEETQMFNALSKLL 881

Query: 1059 NGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVADXXXXXXXXXXXXXX 1118
              W  YGLK+V + P+   I GKLSSDNILSLRST F I ++   +              
Sbjct: 882  AAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGE-GSYVEFTKKSGSN 940

Query: 1119 XXXXRLVNEIEKILEKESVLVLAS 1142
                +LV EIEKILE +  LV ++
Sbjct: 941  KTFKKLVKEIEKILESKKALVFSN 964

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  410 bits (1054), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 202/350 (57%), Positives = 255/350 (72%), Gaps = 13/350 (3%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPY 73
           D +GPWKLG+TLG GS+G+V LA+N ETG++AA+K++ K       +          LPY
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLTS------LPY 112

Query: 74  GIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
           GIEREIIIMKL++HPNV+ LY+VWE   +LY+VLEYVE GELF+ L+ RG LPE EAV +
Sbjct: 113 GIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAVHY 172

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKLADFGMAALESKDKLLETSCGSPH 192
           F+QI+ G+SYCH   I HRDLKPENLLLD K  ++K+ADFGMAALE+ DKLLETSCGSPH
Sbjct: 173 FKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCGSPH 232

Query: 193 YAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGE 252
           YA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D N++ LLLKVQSGKY++P  
Sbjct: 233 YASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMP-- 288

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD 312
             IS EA+DLI +IL V+P  RI   E+L+HPLL KY   + SKS  NL   D+  N + 
Sbjct: 289 QNISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDSTPNIVV 347

Query: 313 -HNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
             ++  ID++IL NL +LWHG  K  +T KL + G   EK FY+LL R++
Sbjct: 348 LESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  407 bits (1045), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 201/361 (55%), Positives = 260/361 (72%), Gaps = 16/361 (4%)

Query: 5   NNNVTSLRGDR--IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTF 62
           NN  TS R +R  +GPWKLG+TLG GS+G+V LA+N ETG+++A+K++ K         F
Sbjct: 57  NNTKTSKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKK--------F 108

Query: 63  VGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQR 122
           V SN    LPYGIEREIIIMKL++HPNV+ LY+VWE   +LY+VLEYVE GELF+ LV +
Sbjct: 109 VKSNQIKQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSK 168

Query: 123 GPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLD-HKFNIKLADFGMAALESKD 181
           G LPE+EA+ +F+QI+  ++YCH   I HRDLKPENLLLD  K +IK+ADFGMAALE+ D
Sbjct: 169 GKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSD 228

Query: 182 KLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
           KLLETSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D N++ LLLK
Sbjct: 229 KLLETSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLK 286

Query: 242 VQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNL 301
           VQSGKY++P    +S EA+DLI +IL V+P +RI   +IL+H LL KY     SKS  +L
Sbjct: 287 VQSGKYQMP--QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDL 344

Query: 302 PREDTYLNPLDH-NDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRF 360
              +   N +   ++  ID+ IL NL +LWHG  +  +  +L +PG   EK FY+LL  +
Sbjct: 345 NLLNRTPNIVSFSSERDIDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNY 404

Query: 361 K 361
           +
Sbjct: 405 Q 405

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  408 bits (1049), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/389 (52%), Positives = 272/389 (69%), Gaps = 45/389 (11%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK-----------SVFNAQGSTF 62
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K           +V N+  S+ 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSM 135

Query: 63  VGSN--DPDVL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEY 109
           V SN   P +            PYGIEREI+IMKL++H NV+ L++VWE   +LY+VLEY
Sbjct: 136 VTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 110 VEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIK 168
           V+ GELF+ LV +G LPE EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 169 LADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228
           +ADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 229 DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           +  D NI+ LLLKVQSGKY++P    +S EARDLI +IL ++PE+RI T+EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPS--NLSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371

Query: 289 YPSIKDSKSIRNLPREDT----------YLNPLD------HNDGTIDQAILQNLVVLWHG 332
           Y  +  +K +R + +++            LN +       H+ G ID++IL++L +LWHG
Sbjct: 372 YDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHG 431

Query: 333 RDKNEITMKLKEPGANLEKTFYALLHRFK 361
             +  IT KL +   + EK FY+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  405 bits (1041), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 202/389 (51%), Positives = 271/389 (69%), Gaps = 45/389 (11%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK-----------SVFNAQGSTF 62
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K           +V N+  S+ 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 63  VGSN--DPDVL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEY 109
           + SN   P +            PYGIEREI+IMKL++H NV+ L++VWE   +LY+VLEY
Sbjct: 136 ITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 110 VEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIK 168
           V+ GELF+ LV +G LPE EA+ +F+QI+ G+S+CH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIK 255

Query: 169 LADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228
           +ADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 229 DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           +  D NI+ LLLKVQSGKY++P    +S EARDLI +IL + PE+RI T+EIL HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPM--NLSAEARDLISKILVINPEKRITTQEILNHPLIKK 371

Query: 289 YPSIKDSKSIRNLPREDT----------YLNPLD------HNDGTIDQAILQNLVVLWHG 332
           Y ++  +K IR + R++            LN +       H+ G ID++IL++L +LWHG
Sbjct: 372 YDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHG 431

Query: 333 RDKNEITMKLKEPGANLEKTFYALLHRFK 361
             +  IT KL +   + EK FY+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  397 bits (1020), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/358 (56%), Positives = 256/358 (71%), Gaps = 32/358 (8%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPY 73
           D IGPWKLG+TLG GS+G+V LA+N ETG++AAVK++ K+           S+ P+ LPY
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKT----------KSSRPNALPY 102

Query: 74  GIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
           GIEREIIIMKL++HPNV+ LY+VWE   +L++VLEYV+ GELF+ LV RG L E EA+ +
Sbjct: 103 GIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIHY 162

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSPH 192
           FRQII G +YCH+  I HRDLKPENLLLD K   IK+ADFGMAAL++ +KLLETSCGSPH
Sbjct: 163 FRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPH 222

Query: 193 YAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGE 252
           YA+PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQ+GKY++P  
Sbjct: 223 YASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP-- 278

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD 312
             IS EA+DLI +IL V+P +RI   +IL HPL+ KY   K SKS       ++ L+ L 
Sbjct: 279 QAISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKS-------NSDLHILS 330

Query: 313 H---------NDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
           H         ++  +D  ILQNL +LWHG  K+ I  +L EP    EKTFY+LL  ++
Sbjct: 331 HTSPQICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  402 bits (1032), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/389 (51%), Positives = 273/389 (70%), Gaps = 45/389 (11%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK-----------SVFNAQGSTF 62
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K           +V N+  S+ 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 63  VGSN--DPDVL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEY 109
           V SN   P ++           PYGIEREI+IMKL++H NV+ L++VWE   +LY+VLEY
Sbjct: 136 VTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 110 VEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIK 168
           V+ GELF+ LV RG LPE EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIK 255

Query: 169 LADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228
           +ADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 229 DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           +  D NI+ LLLKVQSGKY++P    +S EAR+LI +IL ++PE+RI T+EIL+HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEILEHPLIKK 371

Query: 289 YPSIKDSKSIRNLP-------REDTYLNPLD---------HNDGTIDQAILQNLVVLWHG 332
           Y ++  +K +R +        + ++ L+ LD         +    ID++IL++L +LWHG
Sbjct: 372 YDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEIDESILRSLQILWHG 431

Query: 333 RDKNEITMKLKEPGANLEKTFYALLHRFK 361
             +  IT KL +   + EK FY+LL R+K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  401 bits (1030), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/389 (51%), Positives = 271/389 (69%), Gaps = 45/389 (11%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK-----------SVFNAQGSTF 62
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K           ++ N+  S+ 
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 63  VGSN--DPDVL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEY 109
           V SN   P ++           PYGIEREI+IMKL++H NV+ L++VWE   +LY+VLEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 110 VEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIK 168
           V+ GELF+ LV +G LPE EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 169 LADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228
           +ADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 229 DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           +  D NI+ LLLKVQSGKY++P    +S EARDLI +IL ++P +RI T+EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPM--NLSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 289 YPSIKDSKSIRNLPREDT----------YLNPLD------HNDGTIDQAILQNLVVLWHG 332
           Y  +  +K +R + R++            LN +       ++   ID++IL++L +LWHG
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHG 431

Query: 333 RDKNEITMKLKEPGANLEKTFYALLHRFK 361
             +  IT KL +   + EK FY+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  402 bits (1034), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 260/389 (66%), Gaps = 47/389 (12%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQG-------------- 59
           D +GPWKLG+TLG GS+G+V LA+N +TGQ+AA+K++ K+  + +               
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 60  ---STFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELF 116
              +T     +P    YGIEREI+IMKL++HPNV+ LY+VWE   +LY+VLEYV+ GELF
Sbjct: 128 KPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELF 187

Query: 117 NLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMA 175
           + LV RG LPE EAV +F+QII G++YCHA  I HRDLKPENLLLD K   IK+ADFGMA
Sbjct: 188 DYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMA 247

Query: 176 ALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNI 235
           ALE  DKLL TSCGSPHYA+PEIV G  YHG  +DVWSCG+IL+ALLTG LPF+ +  NI
Sbjct: 248 ALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NI 305

Query: 236 RNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYP----- 290
           + LLLKVQSG Y +P   ++SP+A+DLI +IL V+P++R+ T EIL H L+ KY      
Sbjct: 306 KKLLLKVQSGVYHMPS--DLSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLT 363

Query: 291 --------SIKDSKS------IRNLPREDTYL-NPLDHNDGTIDQAILQNLVVLWHGRDK 335
                   S+   KS      I NL   D  L NP D     ID +IL NL +LWHG  K
Sbjct: 364 NRNYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCD-----IDTSILSNLQILWHGESK 418

Query: 336 NEITMKLKEPGANLEKTFYALLHRFKFEN 364
           + I  KL +P  N EK FY+LL ++K +N
Sbjct: 419 HAIIDKLLQPNMNEEKLFYSLLLKYKQKN 447

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  397 bits (1019), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/351 (55%), Positives = 249/351 (70%), Gaps = 9/351 (2%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPY 73
           D +GPWKLG+TLG GS+G+V LA+N ETG++AA+K++ K V  +  ++   +     LPY
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAANGNLPY 115

Query: 74  GIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
           GIEREIIIMKL++HPN++ LY+VWE   +L++VLEYVE GELF+ LV +G LPE EAV +
Sbjct: 116 GIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAVHY 175

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKLADFGMAALESKDKLLETSCGSPH 192
           FRQII G++YCH   I HRDLKPENLL+D K   IK+ADFGMAALE+ +KLLETSCGSPH
Sbjct: 176 FRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCGSPH 235

Query: 193 YAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGE 252
           YA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQSGKY +P  
Sbjct: 236 YASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHMP-- 291

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI--KDSKSIRNLPREDTYLNP 310
             IS EA+DLI +IL V+P  RI   E+L+HPL+ KY     K +  +  L R    +  
Sbjct: 292 QNISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKARSKSNSDLHLLSRTPQLVTL 351

Query: 311 LDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
               D  ID +IL NL +LWHG     I  +L + G   EK FY+LL +++
Sbjct: 352 QSKED--IDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  395 bits (1015), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/392 (51%), Positives = 262/392 (66%), Gaps = 48/392 (12%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK--------------------- 52
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K                     
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSN 133

Query: 53  -----SVFNAQGSTFVGSNDPDVL--PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYM 105
                ++ N   + +  +   +V   PYGIEREI+IMKL++H NVL LY+VWE   +LY+
Sbjct: 134 SSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYL 193

Query: 106 VLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF 165
           VLEYV+ GELF+ LV RG L E EAV +F+QII G+SYCHA  I HRDLKPENLLLD K 
Sbjct: 194 VLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKN 253

Query: 166 N-IKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTG 224
           + IK+ADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG
Sbjct: 254 STIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTG 313

Query: 225 RLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHP 284
            LPF+  D +I+ LLLKVQSGKY++P    +S EA+DLI +ILTV P +R+ T EIL+HP
Sbjct: 314 HLPFN--DDSIKKLLLKVQSGKYQMP--QNLSKEAQDLIAKILTVNPAKRLTTEEILRHP 369

Query: 285 LLQKYPSIKDSKSIRNL------PREDTYLNPLDHNDGT---------IDQAILQNLVVL 329
           L+ KY S+  +K  + L       + +  L+ L++ + T         ID  IL NL +L
Sbjct: 370 LIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQIL 429

Query: 330 WHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
           WHG  +  I  KL +P  + EK FY+LL ++K
Sbjct: 430 WHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  393 bits (1010), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 252/354 (71%), Gaps = 32/354 (9%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPY 73
           D IGPWKLG+TLG GS+G+V LA+N ETG++AA+K++ K+  +  GS          LPY
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGS----------LPY 102

Query: 74  GIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
           GIEREIIIMKL++HPNV+ LY+VWE   +L++VLEYV+ GELF+ LV RG LPE EA+ +
Sbjct: 103 GIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHY 162

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSPH 192
           FRQII G +YCH   I HRDLKPENLLLD K   IK+ADFGMAAL++ +KLLETSCGSPH
Sbjct: 163 FRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPH 222

Query: 193 YAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGE 252
           YA+PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQ+GKY++P  
Sbjct: 223 YASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP-- 278

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLD 312
             +S  A+DLI +IL V+P++RI   EIL HPLL KY + K SKS       ++ L+ L 
Sbjct: 279 QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKS-------NSDLHILS 330

Query: 313 H---------NDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALL 357
           H         ++  +D  ILQNL +LWHG  K  I   L +P    EKTFY+LL
Sbjct: 331 HSKPQISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLL 384

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  395 bits (1016), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/351 (55%), Positives = 251/351 (71%), Gaps = 14/351 (3%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK-SVFNAQGSTFVGSNDPDVLP 72
           D +GPWKLG+TLG GS+G+V LA+N ++G++AA+K++ K +V + Q            LP
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQV-------TALP 108

Query: 73  YGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVR 132
           YGIEREIIIMKL+ HPN++ LY+VWE   +LY+VLEYVE GELF+ L+ RG LPE EA+ 
Sbjct: 109 YGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIH 168

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIKLADFGMAALESKDKLLETSCGSP 191
           +F+QI+ G+SYCH   I HRDLKPENLLLD K   +K+ADFGMAALE+ ++LLETSCGSP
Sbjct: 169 YFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGSP 228

Query: 192 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG 251
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D N+R LLLKVQ G+Y++P 
Sbjct: 229 HYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQMPS 286

Query: 252 EDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL 311
              +S EA+DLI +IL V+PE+RI   +IL+HPLL KY +         L + +     L
Sbjct: 287 --NVSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPLEKPEERPKVL 344

Query: 312 D-HNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
           D H+   ID+ IL NL +LWHG  K  +  KL + G   EK FYALL R++
Sbjct: 345 DIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  388 bits (996), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 254/377 (67%), Gaps = 34/377 (9%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVL-- 71
           D +GPWKLG+TLG GS+G+V LA+N E GQ+AA+K++ K+     G+    SND      
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 72  ----------------PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGEL 115
                           PYGIEREI+IMKL++H NV+ L++VWE   DL++VLEYV+ GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 116 FNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGM 174
           F+ LV +G LPE EAV +F+QII G+++CH+  I HRDLKPENLLLD K   IK+ADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN 234
           AALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+ALLTG LPF+  D N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDN 320

Query: 235 IRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKD 294
           IR LLLKVQSG++ +P    IS EA+DLI +IL V P QRIK  +ILKHPL+ KY     
Sbjct: 321 IRKLLLKVQSGRFRLP--RNISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 295 SK-------SIRNLPREDTYLNPLD---HNDGTIDQAILQNLVVLWHGRDKNEITMKLKE 344
            K       S  NL  E   L P +    +   ID++IL+NL +LWHG  +  I  KL +
Sbjct: 379 VKFNQVPNPSATNLNSEH-MLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQ 437

Query: 345 PGANLEKTFYALLHRFK 361
              + EK FY+LL ++K
Sbjct: 438 YPMSAEKIFYSLLWQYK 454

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  387 bits (995), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 264/389 (67%), Gaps = 53/389 (13%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK-------------SVFNAQG- 59
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K             S F+A   
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 60  -----STFVGS---------NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYM 105
                ST   S         N P+  PYGIEREI+IMKL++HPNV+ LY+VWE   +LY+
Sbjct: 156 SNSNISTLATSPPMNNGSEKNQPN--PYGIEREIVIMKLISHPNVMALYEVWENKSELYL 213

Query: 106 VLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF 165
           VLEYV+ GELF+ LV +G L E EAV +F+QII G+SYCH+  I HRDLKPENLLLD K 
Sbjct: 214 VLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKN 273

Query: 166 -NIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTG 224
            +IK+ADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG
Sbjct: 274 KSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTG 333

Query: 225 RLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHP 284
            LPF+  D NI+ LLLKVQ+GK+ +P    +SPEA+DLI +IL ++P +RI T  IL HP
Sbjct: 334 HLPFN--DDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRILVIDPSKRITTDRILNHP 389

Query: 285 LLQKY-PSIKDSKSIRNLPREDTYLNPLDH-----------NDGTIDQAILQNLVVLWHG 332
           L+ KY P+ K+  S     + ++ L+ L+H           ND  ID +IL+NL +LWHG
Sbjct: 390 LILKYEPAGKNMVS----GKSNSDLHVLEHISPQPISLTSRND--IDASILKNLQILWHG 443

Query: 333 RDKNEITMKLKEPGANLEKTFYALLHRFK 361
             +  I  KL +   + EK FY+LL ++K
Sbjct: 444 TSRELIIAKLLQTPMSEEKLFYSLLWQYK 472

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  386 bits (991), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/383 (52%), Positives = 264/383 (68%), Gaps = 36/383 (9%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKS-VFNAQG-STF----VGSND 67
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K+ +F  Q  ++F      SND
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 68  PD------------VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGEL 115
                         + PYGIEREI+IMKL++HPNV+ LY+VWE   +L++VLEYV+ GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 116 FNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGM 174
           F+ LV RG L E EAV +F+QII G+SYCH+  I HRDLKPENLLLD K N IK+ADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN 234
           AALE  +KLL TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 235 IRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKD 294
           I+ LLLKVQSGK+++P    IS EA DLI +IL V+PE+RI+  +IL HPL++KY   K 
Sbjct: 325 IKKLLLKVQSGKFQMP--QNISLEAEDLISRILVVDPEKRIQINDILIHPLIRKYEDNKT 382

Query: 295 SKSIRNLPREDTYLNPLDH--ND-----------GTIDQAILQNLVVLWHGRDKNEITMK 341
             +  +  ++ +  N   H  ND             ID++IL+NL +LWHG  +  I  K
Sbjct: 383 DSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELIISK 442

Query: 342 LKEPGANLEKTFYALLHRFKFEN 364
           L +   + EK FY+LL ++K +N
Sbjct: 443 LLQTPMSEEKLFYSLLLQYKKKN 465

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  382 bits (982), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/398 (50%), Positives = 259/398 (65%), Gaps = 54/398 (13%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSV-----------------FN 56
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K                   F+
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 57  A-------------QGSTFVGSNDPDVL--PYGIEREIIIMKLLNHPNVLRLYDVWETAQ 101
           A              G T   +   +V   PYGIEREI+IMKL++H N+L LY+VWE   
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKS 215

Query: 102 DLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL 161
           +LY+VLEYV+ GELF+ LV RG L E EAV +F+QI+ G+SYCH+  I HRDLKPENLLL
Sbjct: 216 ELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLL 275

Query: 162 DHKF-NIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYA 220
           D K  +IK+ADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+A
Sbjct: 276 DKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFA 335

Query: 221 LLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREI 280
           LLTG LPF+  D NI+ LLLKVQSGK+ +P    +S EA+DL+ +IL V P +RI T EI
Sbjct: 336 LLTGHLPFN--DDNIKKLLLKVQSGKFHMP--QNLSAEAKDLMSKILVVNPFKRIATEEI 391

Query: 281 LKHPLLQKYPS----IKDSKSIRNLP----REDTYLNPLDHNDGT---------IDQAIL 323
           L HPLL KY      +K   S+  +     + ++ L+ LD ++           ID +I+
Sbjct: 392 LNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIV 451

Query: 324 QNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
            NL +LWHG  +  I  KL +P  + EK FY+LL  +K
Sbjct: 452 SNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  380 bits (977), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/400 (48%), Positives = 265/400 (66%), Gaps = 43/400 (10%)

Query: 3   DKNNNVTSLRGDR--IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFN---- 56
           + NN  +S R  R  +GPWKLG+TLG GS+G+V LA+N E G +AA+K++ K  +N    
Sbjct: 75  NSNNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMR 134

Query: 57  -----AQGSTFVGSNDPD---------------VLPYGIEREIIIMKLLNHPNVLRLYDV 96
                  G    G++  D               + PYGIEREI+IMKL++HPNV+ L +V
Sbjct: 135 DQKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEV 194

Query: 97  WETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 156
           WE   +LY+VLEYV+ GELF+ LV +G L E EAV +F QII G+SYCH+  I HRDLKP
Sbjct: 195 WENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKP 254

Query: 157 ENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCG 215
           ENLLLD K   IK+ADFGMAALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG
Sbjct: 255 ENLLLDKKNKVIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCG 314

Query: 216 VILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRI 275
           +IL+ALLTG LPF+  D NI+ LLLKVQ+G++++P    ++ +A+DLI +IL   PE+R+
Sbjct: 315 IILFALLTGHLPFN--DDNIKKLLLKVQAGRFQLPP--YLTNDAKDLITRILVTNPEKRL 370

Query: 276 KTREILKHPLLQKY---PSIKDSKSIRNLPREDTYLNPLDHN---------DGTIDQAIL 323
              EIL HPL++KY   P+     ++    + ++ L+ L++N         +  IDQ+IL
Sbjct: 371 TINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSIL 430

Query: 324 QNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFE 363
           ++L +LWHG  +  +  +L   GA  EK FY+LL ++K +
Sbjct: 431 KSLQILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYKLK 470

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  379 bits (972), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/410 (49%), Positives = 267/410 (65%), Gaps = 57/410 (13%)

Query: 4   KNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSV-FNAQG-ST 61
           KN N    R D +GPWKLG+TLG GS+G+V LA+N ETG++AA+K++ K+  FN Q  S 
Sbjct: 80  KNKNKRRTR-DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSK 138

Query: 62  FVGSNDPDVL------------------------------PYGIEREIIIMKLLNHPNVL 91
              SN+ D+                               PYGIEREI+IMKLL+HPNV+
Sbjct: 139 NTNSNNGDLFLSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVM 198

Query: 92  RLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVH 151
            LY+VWE   +LY+VLEYV+ GELF+ LV +G L E+EAV +F+QII GISYCH+  I H
Sbjct: 199 ALYEVWENNNELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICH 258

Query: 152 RDLKPENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESD 210
           RDLKPENLLLD K   IK+ADFGMAAL+  ++LL+TSCGSPHYA+PEIV G  Y+G  SD
Sbjct: 259 RDLKPENLLLDKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSD 318

Query: 211 VWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVE 270
           +WSCG+IL+ALLTG LPF+  D NI+ LL+KVQ+G+Y++P    IS EA++LI +IL V+
Sbjct: 319 IWSCGIILFALLTGHLPFN--DDNIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVD 374

Query: 271 PEQRIKTREILKHPLLQKYP---SIKDSKSIRN-----LPREDTYLNPLDH--------- 313
           P +RI T +IL HPLL KY      KD K  +N       + ++ LN L +         
Sbjct: 375 PSKRISTEQILSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVK 434

Query: 314 --NDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
                 ID++IL+NL +LWHG  ++ I  KL +   + EK  Y+LL ++K
Sbjct: 435 LRARSDIDESILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  327 bits (839), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 166/298 (55%), Positives = 214/298 (71%), Gaps = 13/298 (4%)

Query: 73  YGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVR 132
           YGIEREI+IMKL++HPNV+ LY+VWE   +LY++LEYV+ GELF+ LV RG LPE EA+ 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLL-LDHKFNIKLADFGMAALESKDKLLETSCGSP 191
           +F+QII G+SYCH+  I HRDLKPENLL    K +IK+ADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 192 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG 251
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF+  D NI+ LLLKVQ+GKY++P 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMP- 373

Query: 252 EDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY-PSIKDSKSIRNLPREDTYL-- 308
              +S EA+DLI +IL V P +R+ T EIL HPL+ KY  S K    ++     D +L  
Sbjct: 374 -KNLSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 309 -----NPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK 361
                N   ++   ID++IL+NL +LWHG  ++ I  KL +   + EK FY+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK 52
           D +GPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ K
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  316 bits (810), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 217/316 (68%), Gaps = 33/316 (10%)

Query: 73  YGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVR 132
           YGIEREI+IMKL++HPNV+ LY+VWE   +LY+VLEYV+ GELF+ LV +G L E EAVR
Sbjct: 205 YGIEREIVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVR 264

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSP 191
           +F+QII G+ YCH+  I HRDLKPENLLLD K   IK+ADFGMAAL+  + LL+TSCGSP
Sbjct: 265 YFKQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSP 324

Query: 192 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG 251
           HYA+PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF+  D +I+ LL+KVQ+G+Y++P 
Sbjct: 325 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP- 381

Query: 252 EDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY--------------PSIKDSKS 297
            + +S +A+DLI +IL V P+ R+ T +IL+HPL+ KY               +IK+  +
Sbjct: 382 -NYLSKDAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNN 440

Query: 298 ------------IRNLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEP 345
                       ++N+P +   +     ND  ID +IL+NL +LW+G  +  +  KL + 
Sbjct: 441 LMRGKSNTDLAILQNIPDKTDIIQLRSRND--IDDSILRNLQILWNGVPRETLISKLIQD 498

Query: 346 GANLEKTFYALLHRFK 361
             + EK  Y+LL ++K
Sbjct: 499 PVSEEKLIYSLLWQYK 514

 Score = 65.5 bits (158), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/40 (67%), Positives = 35/40 (87%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKS 53
           D IGPWKLG+TLG GS+G+V LA+N ETGQ+AA+K++ KS
Sbjct: 91  DMIGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKS 130

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  242 bits (618), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 113/120 (94%), Positives = 117/120 (97%)

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGI 141
           MKLL+H NVLRLYDVWET  +LYMVLEYVEKGELFNLLV+RGPLPENEAVRFFRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 142 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSG 201
           SYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALESKDKLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  251 bits (641), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 134/282 (47%), Positives = 183/282 (64%), Gaps = 23/282 (8%)

Query: 5   NNNVTSLR-GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGS 60
           +N V+SL  G R+G +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG 
Sbjct: 24  SNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR 83

Query: 61  TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
                         IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +V
Sbjct: 84  --------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 128

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           QR  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + + 
Sbjct: 129 QRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 188

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L+TSCGSP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L  
Sbjct: 189 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 246

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
            + +G Y +P    +SP A DLI ++L V P  RI   EI++
Sbjct: 247 NISNGVYTLP--KFLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  246 bits (629), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 179/273 (65%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G RIG +++ +TLG GS GKV LA +  T Q  A+K+I+K +    + QG          
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGR--------- 86

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++ +D+ MV+EY +  ELF+ +VQR  + ENE
Sbjct: 87  -----IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENE 140

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A +FF+QII  + YCH   IVHRDLKPENLLLD + N+K+ADFG++ + +    L+TSCG
Sbjct: 141 ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD  D +I  L   + +G Y +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTL 258

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P    +SP A +LI ++L V P  RI   EI++
Sbjct: 259 P--KFLSPGAANLIKRMLIVNPLNRISMNEIME 289

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  247 bits (631), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 134/282 (47%), Positives = 182/282 (64%), Gaps = 23/282 (8%)

Query: 5   NNNVTSLR-GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGS 60
           NN  +SL  G  IG +++ +TLG GS GKV LA +T TGQ  A+K+I+K V    + QG 
Sbjct: 39  NNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR 98

Query: 61  TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
                         IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +V
Sbjct: 99  --------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 143

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           QR  + E+EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + + 
Sbjct: 144 QRDKMSEDEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 203

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L+TSCGSP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L  
Sbjct: 204 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 261

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
            + +G Y +P    +SP A  LI ++L V P  RI   EI++
Sbjct: 262 NISNGVYSLP--KFLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  246 bits (629), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/282 (47%), Positives = 181/282 (64%), Gaps = 23/282 (8%)

Query: 5   NNNVTSLR-GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGS 60
           NN  +SL  G  IG +++ +TLG GS GKV LA +T TGQ  A+K+I+K V    + QG 
Sbjct: 40  NNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR 99

Query: 61  TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
                         IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +V
Sbjct: 100 --------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 144

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           QR  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + + 
Sbjct: 145 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 204

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L+TSCGSP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L  
Sbjct: 205 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 262

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
            + +G Y +P    +SP A  LI ++L V P  RI   EI++
Sbjct: 263 NISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  246 bits (629), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 134/282 (47%), Positives = 181/282 (64%), Gaps = 23/282 (8%)

Query: 5   NNNVTSLR-GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGS 60
           NN  +SL  G  IG +++ +TLG GS GKV LA +T TGQ  A+K+I+K V    + QG 
Sbjct: 40  NNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR 99

Query: 61  TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
                         IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +V
Sbjct: 100 --------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 144

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           QR  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + + 
Sbjct: 145 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 204

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L+TSCGSP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L  
Sbjct: 205 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 262

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
            + +G Y +P    +SP A  LI ++L V P  RI   EI++
Sbjct: 263 NISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  246 bits (627), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 134/282 (47%), Positives = 181/282 (64%), Gaps = 23/282 (8%)

Query: 5   NNNVTSLR-GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGS 60
           NN  +SL  G  IG +++ +TLG GS GKV LA +T TGQ  A+K+I+K V    + QG 
Sbjct: 41  NNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR 100

Query: 61  TFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
                         IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +V
Sbjct: 101 --------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 145

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           QR  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + + 
Sbjct: 146 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 205

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L+TSCGSP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L  
Sbjct: 206 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 263

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
            + +G Y +P    +SP A  LI ++L V P  RI   EI++
Sbjct: 264 NISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  243 bits (620), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 203/345 (58%), Gaps = 45/345 (13%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G RIG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG          
Sbjct: 33  GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR--------- 83

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + ENE
Sbjct: 84  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENE 137

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 138 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 197

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y I
Sbjct: 198 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSI 255

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLN 309
           P    +S  A +LI ++L V P  RI   EI+           +D     +LP    YL 
Sbjct: 256 P--KFLSQGAANLIKRMLIVNPLNRITIHEIM-----------EDEWFKVDLP---DYLV 299

Query: 310 PLDHND------GTIDQAILQNLVVLW---HGRDKNEITMKLKEP 345
           P+D         GT D+ I + LV +       DK+EI   L++P
Sbjct: 300 PVDMKADATSKPGTDDERIDEALVAVLANTMSYDKDEIYEALEDP 344

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  243 bits (620), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/273 (46%), Positives = 177/273 (64%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G RIG +++ +TLG GS GKV LA +  TGQ  A+K+I++ V    + QG          
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSKSDMQGR--------- 86

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP+++RLYDV ++  ++ M++EY    ELF+ +VQR  + ENE
Sbjct: 87  -----IEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENE 140

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A +FF+QII  + YCH   IVHRDLKPENLLLD  +N+K+ DFG++ + +    L+TSCG
Sbjct: 141 ARKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCG 200

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L   + +G Y +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTL 258

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P  + +S  A  LI ++L V P  RI   EI++
Sbjct: 259 P--NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  242 bits (618), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 176/273 (64%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G  IG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG          
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 90

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + E+E
Sbjct: 91  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDE 144

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 145 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 204

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L   + +G Y I
Sbjct: 205 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTI 262

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P    +S  A  LI ++L V P  RI  +EI++
Sbjct: 263 P--KFLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  242 bits (617), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 130/273 (47%), Positives = 176/273 (64%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G RIG +++ +TLG GS GKV LA +  T Q  A+K+I+K V    + QG          
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR--------- 87

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + ENE
Sbjct: 88  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENE 141

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 142 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 201

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y I
Sbjct: 202 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSI 259

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P    +SP A +LI ++L V P  RI   EI++
Sbjct: 260 P--KFLSPGAANLIKKMLIVNPLNRITIHEIME 290

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  243 bits (619), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 177/273 (64%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G +IG +++ +TLG GS GKV LA +  TGQ  A+K+I+K +    + QG          
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKSDMQGR--------- 93

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ +V+E+    ELF+ ++QR  + ENE
Sbjct: 94  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENE 147

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 148 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 207

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L   + +G Y +
Sbjct: 208 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYIL 265

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P    +SP A  LI ++L V P  RI   EI++
Sbjct: 266 P--KFLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  241 bits (616), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 175/273 (64%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G RIG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG          
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------- 86

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + E E
Sbjct: 87  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKE 140

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 141 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 258

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P    +SP A  LI ++L V P  RI   EI++
Sbjct: 259 P--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  241 bits (615), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 176/274 (64%), Gaps = 22/274 (8%)

Query: 12  RGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDP 68
           +G  IG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG         
Sbjct: 28  QGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGR-------- 79

Query: 69  DVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPEN 128
                 IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  +PE 
Sbjct: 80  ------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQ 132

Query: 129 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSC 188
           EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSC
Sbjct: 133 EARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 192

Query: 189 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYE 248
           GSP+YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y 
Sbjct: 193 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYT 250

Query: 249 IPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           IP  + +S  A  LI ++L V P  RI   EI++
Sbjct: 251 IP--NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  241 bits (616), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 179/278 (64%), Gaps = 22/278 (7%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G +IG +++ +TLG GS GKV LA ++ T Q  A+K+I+K V    + QG          
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGR--------- 74

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY +  ELF+ +VQR  + ENE
Sbjct: 75  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENE 128

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
             RFF+QII  + YCH   IVHRDLKPENLLLD  +N+K+ DFG++ + +    L+TSCG
Sbjct: 129 GRRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCG 188

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY LL  RLPFD+E  +I  L   + +G Y I
Sbjct: 189 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTI 246

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           P  + +S  A  LI ++L V P  RI   +I++ P  +
Sbjct: 247 P--NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  240 bits (613), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/271 (47%), Positives = 175/271 (64%), Gaps = 22/271 (8%)

Query: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPDVL 71
           RIG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG            
Sbjct: 27  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 75

Query: 72  PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAV 131
              IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + ENEA 
Sbjct: 76  ---IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEAR 131

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L TSCGSP
Sbjct: 132 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSP 191

Query: 192 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG 251
           +YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y +P 
Sbjct: 192 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLP- 248

Query: 252 EDEISPEARDLIVQILTVEPEQRIKTREILK 282
              +SP A +LI ++L V P  RI   EI++
Sbjct: 249 -KFLSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  239 bits (610), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 176/271 (64%), Gaps = 22/271 (8%)

Query: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPDVL 71
           RIG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG            
Sbjct: 28  RIGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR----------- 76

Query: 72  PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAV 131
              IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + E+EA 
Sbjct: 77  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEAR 132

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCGSP
Sbjct: 133 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 192

Query: 192 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG 251
           +YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y +P 
Sbjct: 193 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP- 249

Query: 252 EDEISPEARDLIVQILTVEPEQRIKTREILK 282
              +SP A +LI ++L V P  RI   EI++
Sbjct: 250 -KFLSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  239 bits (611), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 173/272 (63%), Gaps = 22/272 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G RIG +++ +TLG GS GKV LA +  T Q  A+K+I+K V    + QG          
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGR--------- 112

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                +EREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF  +VQR  + ENE
Sbjct: 113 -----VEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENE 166

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A +FF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 167 ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCG 226

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD  D +I  L   + +G Y +
Sbjct: 227 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTL 284

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREIL 281
           P    +S  A +LI ++L V P  RI   EI+
Sbjct: 285 P--KFLSEGAANLIKKMLIVNPLNRISMTEII 314

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  240 bits (612), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 127/273 (46%), Positives = 176/273 (64%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G +IG +++ +TLG GS GKV LA +  TGQ  A+K+I++ V    + QG          
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGR--------- 88

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY +  ELF+ +VQR  + E E
Sbjct: 89  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQE 142

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 143 ARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 202

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L   + +G Y +
Sbjct: 203 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTL 260

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P    +S  A  LI ++L V P  RI   EI++
Sbjct: 261 P--RFLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  240 bits (613), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/292 (45%), Positives = 181/292 (61%), Gaps = 23/292 (7%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G  IG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG          
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 105

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + ENE
Sbjct: 106 -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENE 159

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 160 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 219

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y I
Sbjct: 220 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTI 277

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ-KYPSIKDSKSIRN 300
           P    +S  A  LI ++L V P  RI   EI++    +   P    S+ +RN
Sbjct: 278 P--KFLSQGASSLIKRMLIVNPLNRISISEIMQDEWFKVDLPEYLLSQDLRN 327

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  238 bits (607), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 175/271 (64%), Gaps = 22/271 (8%)

Query: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPDVL 71
           RIG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG            
Sbjct: 26  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 74

Query: 72  PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAV 131
              IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + E EA 
Sbjct: 75  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREAR 130

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 191
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCGSP
Sbjct: 131 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 190

Query: 192 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG 251
           +YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y +P 
Sbjct: 191 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP- 247

Query: 252 EDEISPEARDLIVQILTVEPEQRIKTREILK 282
              +SP A +LI ++L V P  RI   EI++
Sbjct: 248 -KFLSPGAANLIKRMLIVNPLNRITIHEIME 277

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  237 bits (604), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 127/278 (45%), Positives = 175/278 (62%), Gaps = 22/278 (7%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G RIG +++ +TLG GS GKV LA +  T Q  A+K+I+K V    + QG          
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGR--------- 89

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ +V+E+    ELF+ ++QR  + E E
Sbjct: 90  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQE 143

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 144 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 203

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+E  +I  L   + +G Y +
Sbjct: 204 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYIL 261

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           P    +S  A +LI ++L V P  RI   EI K    Q
Sbjct: 262 P--KFLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  233 bits (593), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/273 (46%), Positives = 173/273 (63%), Gaps = 22/273 (8%)

Query: 13  GDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVF---NAQGSTFVGSNDPD 69
           G  IG +++ +TLG GS GKV LA +  TGQ  A+K+I+K V    + QG          
Sbjct: 45  GSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR--------- 95

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                IEREI  ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +VQR  + E E
Sbjct: 96  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEE 149

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 189
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 150 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 209

Query: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPFD+E  +I  L   + +G Y +
Sbjct: 210 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTL 267

Query: 250 PGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
           P    +S  A  LI ++L V P  RI   EI++
Sbjct: 268 P--KFLSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  210 bits (534), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 114/309 (36%), Positives = 184/309 (59%), Gaps = 26/309 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKS--VFNAQGSTFVGS-------N 66
           +G W   ET+GAGS GKV LA+N +T ++ A+K+++++  +F  + S  +         N
Sbjct: 94  LGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIMN 153

Query: 67  DPDVLPYG--IEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGE 114
           + D+L     +E+EI           + ++L HP++ RL++++  +   YM+ EYV  G+
Sbjct: 154 EKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGGQ 213

Query: 115 LFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGM 174
           L + ++Q G L E+ A  F RQI+  + Y HA  IVHRDLK EN+++    NIK+ DFG+
Sbjct: 214 LLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFGL 273

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN 234
           + L  K K L+T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ N
Sbjct: 274 SNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 333

Query: 235 IRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIK 293
           +  L  K++ G+   P    +S E   L+  +L V+P +R    +++KH  + K Y SI 
Sbjct: 334 V--LHEKIKQGRVFYP--QFLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSIP 389

Query: 294 DSKSIRNLP 302
           D+   + +P
Sbjct: 390 DAHLPKRVP 398

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  201 bits (510), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/320 (36%), Positives = 176/320 (55%), Gaps = 38/320 (11%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETG--------QIAAVKVISKSVFNAQGSTFVGSND 67
            GP+ +G TLG G  GKV +   T  G        +  A+K+I +   +   S  V    
Sbjct: 39  FGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDKSKEVK--- 95

Query: 68  PDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPE 127
                  I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + +R  L E
Sbjct: 96  -------IYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRRVLKE 148

Query: 128 NEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLET 186
           + A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+ T
Sbjct: 149 HVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNELMTT 208

Query: 187 SCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLL 240
           SCGSP YAAPE+V S  PY G  +D+WSCG+IL+A+L G LP+D++  N     I  L  
Sbjct: 209 SCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIAKLYY 268

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPS--------- 291
            +     + P  + I+P  RDL+ +IL  +P +R+  REI  H  L+K+           
Sbjct: 269 YITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQPEEW 326

Query: 292 --IKDSKSIRNLPREDTYLN 309
             I  SK+I  LP+ + + +
Sbjct: 327 DRISQSKNITRLPKHNKHYS 346

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  202 bits (515), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/314 (35%), Positives = 185/314 (58%), Gaps = 29/314 (9%)

Query: 2   GDKNNNVTSLRGD-------RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVIS--- 51
           G+ NNN TS + +        +G W   ET+GAGS GKV LA++ +T +I A+K+++   
Sbjct: 138 GNANNNATSNQNEPKQFHRKSLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAM 197

Query: 52  KSVFNAQGSTFVGSNDPDVLPY--GIEREII----------IMKLLNHPNVLRLYDVWET 99
           K+  + + S      + +VL     +E+EI           + ++L HP++ RL+++   
Sbjct: 198 KAFLHKEQSMPPPRTEQEVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTM 257

Query: 100 AQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENL 159
           +   YM+ EYV  G+L + ++Q G L E+ A +F R I   + Y HA  IVHRDLK EN+
Sbjct: 258 SNHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENI 317

Query: 160 LLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILY 219
           ++     IK+ DFG++ +  + K L T CGS ++AAPE++   PY G E DVWS GV+LY
Sbjct: 318 MISTSGEIKIIDFGLSNVFDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLY 377

Query: 220 ALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTRE 279
            L+ G++PFD+E+ ++  L  K++ GK + P  + +S E   L+ ++L V+P +R   ++
Sbjct: 378 VLVCGKVPFDDENSSV--LHEKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQ 433

Query: 280 ILKHPLLQK---YP 290
           +++HP + +   YP
Sbjct: 434 VVEHPWMTRGYDYP 447

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  202 bits (513), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 174/288 (60%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++  TG++ A+K++   +K+  + + ++    N+ +++ 
Sbjct: 105 LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIME 164

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++  HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 165 RQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYII 224

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R +   + Y HA  IVHRDLK EN+++ +   IK+ DFG++ +   
Sbjct: 225 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYDT 284

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 285 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 342

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK E P    +S E   L+ ++L V+P +R   +++++HP + K
Sbjct: 343 KIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  201 bits (511), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 165/289 (57%), Gaps = 26/289 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G W   ET+GAGS GKV LA+N  T ++ A+K+++++        +   ++   +P   
Sbjct: 68  LGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS- 126

Query: 76  EREII---------------------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGE 114
           E+E+I                     + ++L HP++ RLY++   +   YM+ EYV  G+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 115 LFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGM 174
           L + ++Q G L E+ A  F RQI   + Y H+  IVHRDLK EN+++    NIKL DFG+
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN 234
           + L  K   L+T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ N
Sbjct: 247 SNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 306

Query: 235 IRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           +  L  K++ GK   P    +S E   L+ ++L V+P +R    +++ H
Sbjct: 307 V--LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  200 bits (508), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 168/286 (58%), Gaps = 24/286 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETG-----QIAAVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ +G TLG G  GKV L  +  TG     +  A+K+I +        T   ++D +V
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRD-------TVPKNSDKEV 93

Query: 71  LPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
               I REI  +K L HPN++RL +V + ++ + +VLEY   GE +  + ++  L E+ A
Sbjct: 94  ---KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEHAA 150

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 189
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       K++L++TSCG
Sbjct: 151 CRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTSCG 210

Query: 190 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLKVQ 243
           SP YAAPE +V+  PY   ++D+WSCGVI+YA+L G LP+D++  N     I  L   + 
Sbjct: 211 SPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYIT 270

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
               + P  + I+P  RDL+ +IL   P++R+  R++ +H  LQ +
Sbjct: 271 KTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  201 bits (512), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 169/283 (59%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++  T +I A+K++   +K+  + + S    +ND +++ 
Sbjct: 142 LGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIME 201

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 202 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 261

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A RF R I   + Y HA  IVHRDLK EN+++     IKL DFG++ L   
Sbjct: 262 QHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYDN 321

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 322 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 379

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK E      +S E   L+ ++L V+P++R   ++++ H
Sbjct: 380 KIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  199 bits (506), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/303 (37%), Positives = 169/303 (55%), Gaps = 31/303 (10%)

Query: 6   NNVTSLRGDRI--GPWKLGETLGAGSTGKVLLA----------QNTETGQIAAVKVISKS 53
           N   S+R   I  GP+ +G T+G G  GKV L            N    +  A+K+I + 
Sbjct: 54  NQQVSMRRKHIAFGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRD 113

Query: 54  VFNAQGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKG 113
             +   S  +           I REI  +K L+HPN+++L +V + ++ + +VLEY   G
Sbjct: 114 AISKDSSKELK----------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGG 163

Query: 114 ELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFG 173
           E +  + ++  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG
Sbjct: 164 EFYRYIQRKKRLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFG 223

Query: 174 MA-ALESKDKLLETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEE 231
                 S ++L++TSCGSP YAAPE+V S  PY   ++D+WSCG+ILYA+L G LP+D++
Sbjct: 224 FVNEFYSHNELMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDD 283

Query: 232 DGN-----IRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
            GN     I  L   +     + P  D I+P  RDL+ +IL  +P +RI  ++I KH  L
Sbjct: 284 SGNPDGDDISRLYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWL 341

Query: 287 QKY 289
           + +
Sbjct: 342 KPH 344

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  196 bits (499), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 166/293 (56%), Gaps = 27/293 (9%)

Query: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIA--------AVKVISKSVFNAQGSTFVGSN 66
           R G + LG TLG G  GKV L  +T +   +        A+K+I +  +  +GS      
Sbjct: 42  RFGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRD-YVKKGS------ 94

Query: 67  DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP 126
           D ++  Y   REI  +KLL HPN++RL +V + ++ + +VLE+   GE +  L ++  L 
Sbjct: 95  DKEIKIY---REINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLK 151

Query: 127 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLE 185
           E  A + F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L++
Sbjct: 152 EPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMK 211

Query: 186 TSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLL 239
            SCGSP YAAPE+V S  PY   + D+WSCG+ILYA+L G LP+D++  N     I  L 
Sbjct: 212 RSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLY 271

Query: 240 LKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
             +     + P    ISP ARDLI +ILT  P +RI    I KH  L+ + S 
Sbjct: 272 QYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  198 bits (503), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 166/294 (56%), Gaps = 29/294 (9%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQ-----NTETGQI-----AAVKVISKSVFNAQGSTFVGS 65
            GP+ LG TLG G  GKV L       N+ T         AVK+I +   +      V  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEVK- 96

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
                    I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + ++  L
Sbjct: 97  ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 184
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 185 ETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
           +TSCGSP YAAPE +VS  PY   ++D+WSCGVILYA+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRL 267

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
              + S   + P  D I P  RDL+ +IL  +P++RI  ++I KH  L+ + S 
Sbjct: 268 YNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  198 bits (504), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 171/283 (60%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV LA++  T ++ AVK++   +K+  + +       N+ DVL 
Sbjct: 115 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 235 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 295 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK E P    +S E   L+ ++L V+P++R   +++++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  197 bits (501), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 151/279 (54%), Gaps = 25/279 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T Q   +K   KS             DP+V+    
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS-------------DPNVV---- 81

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  ++P + +LY+V  T   ++M LEY    EL++ L+ +  LP  E    F 
Sbjct: 82  -REVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFA 140

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI   + Y H L  VHRDLK EN+LLD   N KL DFG         +LET CG+  Y A
Sbjct: 141 QITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMA 200

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE- 254
           PE++   PY GF+ D+WS GVILY LL G LPFDE+D      LL  Q    + P  DE 
Sbjct: 201 PEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVIDER 255

Query: 255 -ISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
              PEA++LI Q+L+ +P +R  T  IL HP LQ Y ++
Sbjct: 256 ITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  199 bits (505), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 172/288 (59%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDV-- 70
           +G W   ET+GAGS GKV LA++ +T +I A+K++   +K+  + + S     N+ ++  
Sbjct: 161 LGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHKEQSMPPPKNEQEIAE 220

Query: 71  ----LPYGIER------EIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               L   I R      E  + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 221 RQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 280

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y H   IVHRDLK EN+++ +   IK+ DFG++ +   
Sbjct: 281 QHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGLSNVFDN 340

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS G++LY L+ G++PFD+E+ ++  L  
Sbjct: 341 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV--LHE 398

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK E P  + +S E   L+ +++ V+P +R   R++++HP + +
Sbjct: 399 KIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTR 444

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  196 bits (498), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 167/293 (56%), Gaps = 37/293 (12%)

Query: 16  IGPWKLGETLGAGSTGKVLLA------QNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
            GP+ +G TLG G  GKV L        + +  +  A+K+I +                D
Sbjct: 37  FGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR----------------D 80

Query: 70  VLPYGIEREIII------MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123
            +P   E+EI I      +K LNHPN++RL +V + ++ + +VLEY   GE +  + ++ 
Sbjct: 81  TIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKR 140

Query: 124 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDK 182
            L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       +++
Sbjct: 141 RLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENE 200

Query: 183 LLETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DG-NIR 236
           L++TSCGSP YAAPE +V+  PY   ++DVWSCGVILYA+L G LP+D++    DG +I 
Sbjct: 201 LMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIG 260

Query: 237 NLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
            L   +     + P  D I+P  RDL+ +IL  +P++RI   + LKH  LQ +
Sbjct: 261 KLYRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  196 bits (497), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 172/286 (60%), Gaps = 24/286 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLL--AQNTETGQIA---AVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ LG TLG G  G+V L  ++NT   +++   A+K+I +        T   ++D ++
Sbjct: 41  FGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRD-------TIPKNSDKEI 93

Query: 71  LPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
               I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + ++  L E  A
Sbjct: 94  ---KIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEAVA 150

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 189
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      +  +L++TSCG
Sbjct: 151 CRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMKTSCG 210

Query: 190 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DGN-IRNLLLKVQ 243
           SP YAAPE +VS  PY   ++D+WSCGVILYA+L G LP+D++    DGN I  L   + 
Sbjct: 211 SPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQYIT 270

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
               + P  + I+P  RDL+ +IL  +P++RI  R I KH  ++ +
Sbjct: 271 RTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  198 bits (504), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 109/315 (34%), Positives = 183/315 (58%), Gaps = 23/315 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++ +T ++ A+K++   +KS    + S     ++ + L 
Sbjct: 151 LGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEALE 210

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 211 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYII 270

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y H   IVHRDLK EN+++    +IK+ DFG++ L   
Sbjct: 271 QHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYDS 330

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E D+WS GV+LY L  G++PFD+E+ ++  L  
Sbjct: 331 KKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LHE 388

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRN 300
           K++ GK + P    +S E   L+ ++L V+P++R   ++I+ HP + +     D+K+   
Sbjct: 389 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTRG---FDTKAPSY 443

Query: 301 LP-REDTYLNPLDHN 314
           LP R    ++ ++HN
Sbjct: 444 LPLRVPMSIDMINHN 458

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  196 bits (497), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 163/288 (56%), Gaps = 34/288 (11%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQI-----AAVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ +G TLG G  GKV L     T ++      A+K+I +                 +
Sbjct: 37  FGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDA---------------I 81

Query: 71  LPYG-----IEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
           L Y      I REI  +K L HPN+++L +V + ++ + +VLE+   GE +  + ++  L
Sbjct: 82  LNYSEKETKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRL 141

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 184
            E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       +++L+
Sbjct: 142 KETPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELM 201

Query: 185 ETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DG-NIRNL 238
           +TSCGSP YAAPE +V+  PY   ++DVWSCG+ILYA+L G LP+D++    DG +I  L
Sbjct: 202 KTSCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKL 261

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
            L +     + P  + I+P  RDL+ +IL  +P +R+  R I KH  L
Sbjct: 262 YLYITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  196 bits (498), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 114/287 (39%), Positives = 167/287 (58%), Gaps = 25/287 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLL------AQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
            GP+ +G TLG G  GKV L      + + E  +  A+K+I +          V      
Sbjct: 36  FGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIPKNSEKEVK----- 90

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + ++  L E  
Sbjct: 91  -----IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKEAI 145

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSC 188
           A R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ + DFG      S ++L++TSC
Sbjct: 146 ACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHNELMKTSC 205

Query: 189 GSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DGN-IRNLLLKV 242
           GSP YAAPE +VS  PY   +SDVWSCGVILYA+L G LP+D++    DGN I  L   +
Sbjct: 206 GSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYI 265

Query: 243 QSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
                + P  + I+P +RDL+ +IL  +P++RI  R I KH  L+ +
Sbjct: 266 TRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  196 bits (497), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 165/294 (56%), Gaps = 29/294 (9%)

Query: 16  IGPWKLGETLGAGSTGKVLL----------AQNTETGQIAAVKVISKSVFNAQGSTFVGS 65
            GP+ LG TLG G  GKV L          A   E  +  AVK+I +   +      V  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKKEVK- 96

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
                    I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + ++  L
Sbjct: 97  ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 184
            E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 185 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
           +TSCGSP YAAPE+V S  PY   ++D+WSCGVILYA+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRL 267

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
              + S   + P  D I P  RDL+ +IL  +P++R+  ++I KH  L  + S 
Sbjct: 268 YNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSHFSF 319

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  192 bits (488), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 167/289 (57%), Gaps = 27/289 (9%)

Query: 16  IGPWKLGETLGAGSTGKVLLA-----QNTE---TGQIAAVKVISKSVFNAQGSTFVGSND 67
            GP+ LG T+G G  GKV        QN      G+  A+K+I +        T     D
Sbjct: 52  FGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRD-------TLAEKKD 104

Query: 68  PDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPE 127
            ++  Y   REI  +KLL+HPN+++L DV + ++ + +VLEY   GE +  L ++  L E
Sbjct: 105 QELKVY---REINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKKRLKE 161

Query: 128 NEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLET 186
             A   F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ + DFG    + + +KL++T
Sbjct: 162 PLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNKLMKT 221

Query: 187 SCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DG-NIRNLLL 240
            CGSP YAAPE+V S  PY   ++D+WS GVILYA+L G LP+D++    DG NI  L  
Sbjct: 222 PCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRLYE 281

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
            +     + P  D I P ARDLI +IL ++P+ R+   ++ +H  L+ +
Sbjct: 282 YITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  197 bits (501), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 171/283 (60%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV LA++  T ++ AVK++   +K+  + +       N+ DVL 
Sbjct: 128 LGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 187

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 188 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 247

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 248 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 307

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 308 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 365

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK E P    +S E   L+ ++L V+P++R   +++++H
Sbjct: 366 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  197 bits (501), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 171/288 (59%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV L ++ +T ++  +K++   SK+  + Q S     N+ +VL 
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVLE 163

Query: 73  YG--IEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 283

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+E+ +I  L  
Sbjct: 284 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK + P    +S EA  L+ +++ V+P +R   + ++ HP + +
Sbjct: 342 KIKKGKVDYPS--HLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  197 bits (500), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 171/288 (59%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV L ++ +T ++  +K++   SK+  + Q S     N+ ++L 
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLPPPKNENELLE 163

Query: 73  YG--IEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y HA  IVHRDLK EN+++ +   IK+ DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNIFDS 283

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+E+ +I  L  
Sbjct: 284 KKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK + P    +S +A  L+ +++ V+P +R   + +  HP + +
Sbjct: 342 KIKKGKVDYPS--HLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  197 bits (500), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 171/288 (59%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV L ++ +T +I  +K++   SK+  + Q S     N+ ++L 
Sbjct: 96  LGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILE 155

Query: 73  YG--IEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 156 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 215

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 216 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 275

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+E+ +I  L  
Sbjct: 276 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 333

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK + P    +S E   L+ +++ V+P +R   + +++HP + +
Sbjct: 334 KIKKGKVDYP--SHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  195 bits (495), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 163/291 (56%), Gaps = 29/291 (9%)

Query: 16  IGPWKLGETLGAGSTGKVLL----------AQNTETGQIAAVKVISKSVFNAQGSTFVGS 65
            GP+ +G TLG G  GKV L          +   +  +  A+K+I +   +   S  +  
Sbjct: 45  FGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIK- 103

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
                    I REI  +K L HPN+++L +V + ++ + +VLEY   GE +  + ++  L
Sbjct: 104 ---------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRL 154

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA-LESKDKLL 184
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG  +   S  +L+
Sbjct: 155 KEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELM 214

Query: 185 ETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
           +TSCGSP YAAPE +VS  PY   ++D+WSCGVILYA+L G LP+D++ GN     I  L
Sbjct: 215 KTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRL 274

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
              +     + P  D I+P  RDL+ +IL  +P +RI  + I KH  L+ +
Sbjct: 275 YHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  196 bits (499), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 171/288 (59%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV L ++ +T ++  +K++   SK+  + Q +     N+ ++L 
Sbjct: 103 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEILE 162

Query: 73  YG--IEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 163 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 222

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 223 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 282

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+E+ +I  L  
Sbjct: 283 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 340

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK + P    +S EA  L+ +++ ++P +R   + ++ HP + +
Sbjct: 341 KIKKGKVDYPS--HLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  194 bits (494), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 169/287 (58%), Gaps = 25/287 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLL------AQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
            GP+ +G TLG G  GKV +      + + +  +  A+K+I +        T   +++ +
Sbjct: 37  FGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRD-------TIPKNSEKE 89

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
           V  Y   REI  +K LNHPN++RL +V + ++ + +VLEY   GE +  + ++  L E+ 
Sbjct: 90  VKIY---REINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESA 146

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSC 188
           A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       +++L++TSC
Sbjct: 147 ACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSC 206

Query: 189 GSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DG-NIRNLLLKV 242
           GSP YAAPE +V+  PY   ++D+WSCGVI+YA+L G LP+D++    DG +I  L   +
Sbjct: 207 GSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYI 266

Query: 243 QSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
                + P  D I+P  RDL+  IL  +P++RI   + L H  LQ +
Sbjct: 267 TRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  193 bits (491), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 171/296 (57%), Gaps = 23/296 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLA---------QNTETG---QIAAVKVISKSVFNAQGSTFV 63
            GP+ +G TLG G  GKV LA          NTE     +    KV  +         F+
Sbjct: 45  FGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI 104

Query: 64  GSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123
            + DP      I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + ++ 
Sbjct: 105 -TKDPSK-ETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKR 162

Query: 124 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDK 182
            L EN A R F Q+I  + Y H+ G+VHRDLK ENLLLD++ N+ + DFG       ++ 
Sbjct: 163 RLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFLRQNG 222

Query: 183 LLETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DG-NIR 236
           +++TSCGSP YAAPE +VS  PY   ++D WSCG+IL+A+L G LP+D++    DG +I 
Sbjct: 223 MMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDIS 282

Query: 237 NLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
            L   + +   + P  + I+P  RDL+ +IL ++P++RI  R I KHP L+ + + 
Sbjct: 283 RLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHSTF 336

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  196 bits (497), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 171/283 (60%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV LA++  T ++ AVK++   +K+  + +       N+ DVL 
Sbjct: 115 LGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 235 QHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 295 RKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK E P    +S E   L+ ++L V+P++R   +++++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  196 bits (497), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 172/286 (60%), Gaps = 19/286 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++ +T +I A+K++   +K+  + + S     N+ ++L 
Sbjct: 98  LGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQSLAPPKNENEMLE 157

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 158 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 217

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R +   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 218 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFDT 277

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E D+WS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 278 RKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--LHE 335

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           K++ GK E P  + +S E   L+ ++L V+P +R    ++++HP +
Sbjct: 336 KIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  194 bits (493), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 164/285 (57%), Gaps = 25/285 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLA------QNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
            GP+ +G TLG G  GKV L        N E  +  A+K+I +          V +++ +
Sbjct: 41  FGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRD-------KIVKNSEKE 93

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
           +    I REI  +K L HPN+++L +V + ++ + +VLEY   GE +  + ++  L E  
Sbjct: 94  I---KIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKETA 150

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDK-LLETSC 188
             R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ + DFG      KD  L++TSC
Sbjct: 151 GCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKTSC 210

Query: 189 GSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDE-----EDGNIRNLLLKV 242
           GSP YAAPE+V S  PY   ++D+WSCG+ILYA+L G LP+D+     E  +I  L   +
Sbjct: 211 GSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFI 270

Query: 243 QSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
                + P  + ISP  RDL+ ++L  +P +R+  R+I +H  L+
Sbjct: 271 TRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLR 313

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  193 bits (491), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 161/286 (56%), Gaps = 24/286 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQN-----TETGQIAAVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ +G TLG G  GKV L        TE  +  A+K+I +              D +V
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDA-------DKEV 95

Query: 71  LPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
             Y   REI  +K L HPN++ L +V + ++ + +VLE+V  GE +  + ++  L E+ A
Sbjct: 96  KIY---REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKD-KLLETSCG 189
            R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ + DFG      KD +L+ TSCG
Sbjct: 153 CRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMNTSCG 212

Query: 190 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLKVQ 243
           SP YAAPE +VS  PY   ++DVWSCGVILYA+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYIT 272

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
               + P  + I+P  RDL+ +IL   P +R+  R I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  195 bits (496), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 171/283 (60%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W+  ET+GAGS GKV LA++  T ++ AVK++   +K+  + +       N+ DVL 
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 176

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 177 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 236

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 237 QHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDS 296

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 297 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 354

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK E P    +S E   L+ ++L V+P++R   +++++H
Sbjct: 355 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  195 bits (496), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/336 (33%), Positives = 187/336 (55%), Gaps = 42/336 (12%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G W   ET+GAGS GKV LA++  T +I A+K+++++        F+   + ++ P   
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRAT-----KAFL-HKEQNLPPPKS 159

Query: 76  EREII---------------------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGE 114
           E+EI+                     + ++L HP++ RL+++   +   YM+ EYV  G+
Sbjct: 160 EQEILQRQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 219

Query: 115 LFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGM 174
           L + ++Q G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG+
Sbjct: 220 LLDYIIQHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGL 279

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN 234
           + +    K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E  +
Sbjct: 280 SNVYDPRKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSS 339

Query: 235 IRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIK 293
           +  L  K++ G  E P  + +S E   L+ ++L V+PE+R   +++++HP + + Y  I 
Sbjct: 340 V--LHEKIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYIT 395

Query: 294 DSKSIRNLPREDTYLNPLDHNDGTIDQAILQNLVVL 329
            S   + +P     L P       +DQA+++ +  L
Sbjct: 396 PSYLPKRIP-----LTP-----DMLDQAVIKEMFRL 421

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  193 bits (491), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 165/294 (56%), Gaps = 29/294 (9%)

Query: 16  IGPWKLGETLGAGSTGKVLLA-----QNTETGQI-----AAVKVISKSVFNAQGSTFVGS 65
            GP+ LG TLG G  GKV L       N+           A+K+I +   +      V  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVK- 96

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
                    I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + ++  L
Sbjct: 97  ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 184
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 185 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
           +TSCGSP YAAPE+V S  PY   ++D+WSCGVILYA+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRL 267

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
              + S   + P  D I P  RDL+ ++L  +P++RI  ++I KH  L+ + S 
Sbjct: 268 YNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  194 bits (494), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 167/288 (57%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVL- 71
           +G W   ET+GAGS GKV LA++  T +I A+K++   +KS  + Q       ++ + L 
Sbjct: 76  LGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEALE 135

Query: 72  -PYGIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 136 RKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 195

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E  A +F R I   + Y H   IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 196 QHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNMYDP 255

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 256 KKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--LHE 313

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK E P    +S E   L+ ++L V+P +R   ++++ H  +Q+
Sbjct: 314 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  193 bits (490), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 165/294 (56%), Gaps = 29/294 (9%)

Query: 16  IGPWKLGETLGAGSTGKVLLA----------QNTETGQIAAVKVISKSVFNAQGSTFVGS 65
            GP+ LG TLG G  GKV L              E  +  AVK+I +            S
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTI---------S 88

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
           ND       I REI  +K L+HPN+++L +V + ++ + +VLEY   GE +  + +R  L
Sbjct: 89  NDYKK-EVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKRRRL 147

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 184
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 185 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
           +TSCGSP YAAPE+V S  PY   ++D+WSCGVILYA+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRL 267

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
              +     + P  D I P  RDL+ +IL  +P++RI  ++I KH  L+ + S 
Sbjct: 268 YNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPHFSF 319

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  191 bits (484), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 162/288 (56%), Gaps = 28/288 (9%)

Query: 15  RIGPWKLGETLGAGSTGKVLLAQN---------TETGQIAAVKVISKSVFNAQGSTFVGS 65
           + GP+ +G TLG G  GKV +  +         TE  +  A+K+I +  F  +GS     
Sbjct: 34  KFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRD-FIKKGSE---- 88

Query: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
                    I REI  +K L HPN++RL +V + ++ + +VLEY   GE +  + ++  L
Sbjct: 89  -----KEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRL 143

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 184
            E  A R F Q+I G+SY H+ GIVHRDLK ENLLLD   N+ + DFG      + ++L+
Sbjct: 144 KEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELM 203

Query: 185 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNL 238
           +TSCGSP YAAPE+V +  PY   ++D+WSCG+ILY +L G LP+D++  N     I  L
Sbjct: 204 KTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRL 263

Query: 239 LLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
              +     + P  + I+P  RDL+  IL   P +R+ +R I KH  L
Sbjct: 264 YHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  189 bits (479), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 169/290 (58%), Gaps = 23/290 (7%)

Query: 15  RIGPWKLGETLGAGSTGKVLLA----QNTETGQIAAVKVISKSVFNAQGS-------TFV 63
           R G + LG+TLG G  GKV L      N +T   +  K+ + S    Q +       T  
Sbjct: 55  RFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRDTLS 114

Query: 64  GSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123
            S + ++  Y   REI  +K+L HPN+++L +V + ++ + +VLEY   GE +  +  + 
Sbjct: 115 ASKESEIKLY---REINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIKFKK 171

Query: 124 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK-DK 182
            L E++A   F Q+I G+SY H+ G+VHRDLK ENLLLD   N+ + DFG     +K +K
Sbjct: 172 RLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTKTNK 231

Query: 183 LLETSCGSPHYAAPEIVSGL-PYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN---- 237
           L+ T CGSP YAAPE+V+ + PY+  ++D+WSCGVILYA+L G LP+D++  NI      
Sbjct: 232 LMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDDPKNINGTDIV 291

Query: 238 -LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
            L   +++   + P    + P  RDL+ ++L ++P +R+  + IL+H  +
Sbjct: 292 KLYKYIENQPLKFPEYINMVP--RDLLRRMLEIDPAKRMSMKHILQHAWI 339

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  194 bits (493), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 169/283 (59%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSV---FNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++  T ++ A+K+++++     + + S      + ++L 
Sbjct: 75  LGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRATNAFLHKEQSLPPPKKEEEILE 134

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 135 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 194

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L  K
Sbjct: 195 QHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNLFDK 254

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 255 SKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 312

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK E P    +S E   L+ ++L V+P +R   +++++H
Sbjct: 313 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  194 bits (492), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 166/284 (58%), Gaps = 25/284 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLA------QNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
            GP+ +G TLG G  GKV L        +T+  +  A+K+I +          V  ++ +
Sbjct: 69  FGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRRDAI-------VKGSEKE 121

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
           +    I REI  +K L HPN++RL +V + ++ + +VLEY   GE +  + ++  L E+ 
Sbjct: 122 I---KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESV 178

Query: 130 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK-DKLLETSC 188
           A   F Q++ G+ Y H  G+VHRDLK ENLLLD   N+ + DFG     SK  +L++TSC
Sbjct: 179 ASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDFGFVNEFSKFSELMKTSC 238

Query: 189 GSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DGN-IRNLLLKV 242
           GSP YAAPE+V S  PY   ++D+WSCG+IL+A+L G LP+D++    DGN I  L   +
Sbjct: 239 GSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYI 298

Query: 243 QSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
            +   + P  + ISP ARDL+  IL   P++R   ++ILKH  L
Sbjct: 299 TTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQILKHQWL 340

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  194 bits (492), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 168/283 (59%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++  T +I A+KV+   +K   + + +      + ++L 
Sbjct: 180 LGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQTLPPPQTEQEILE 239

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 240 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 299

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 300 QHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYDT 359

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            + L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 360 TRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 417

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK + P    +S E   L+ ++L V+P++R   R++++H
Sbjct: 418 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  191 bits (486), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 155/284 (54%), Gaps = 22/284 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNT----ETGQIAAVKVISKSVFNAQGSTFVGSNDPDVL 71
            GP+ +G TLG G  GKV L  +     E  +  A+K++ +          V        
Sbjct: 62  FGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIPKHSEKEVK------- 114

Query: 72  PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAV 131
              I REI  +K LNHPN++RL +V + ++ + +VL+Y   GE +  + ++  L E  A 
Sbjct: 115 ---IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPAC 171

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 191
           R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ + DFG      K+ L++TSCGSP
Sbjct: 172 RLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCGSP 231

Query: 192 HYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDE-----EDGNIRNLLLKVQSG 245
            YAAPE +V+  PY   ++DVWSCGVILYA+L G LP+D+     E  +I  L   +   
Sbjct: 232 CYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKS 291

Query: 246 KYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
             + P  + I P  RDL+ +IL   P+ R+   EI  H  L+ +
Sbjct: 292 ALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  187 bits (475), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/303 (36%), Positives = 169/303 (55%), Gaps = 32/303 (10%)

Query: 7   NVTSLRGDR---IGPWKLGETLGAGSTGKVLLA----------QNTETGQIAAVKVISKS 53
           N  S RG +    GP+ +G TLG G  GKV L           Q     +  A+K+I + 
Sbjct: 29  NSMSSRGKKHVTFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRD 88

Query: 54  VFNAQGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKG 113
                  T V +++ ++    I REI  +K L HPNV+RL +V + ++ + +VLEY   G
Sbjct: 89  -------TIVKNSEKEI---KIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGG 138

Query: 114 ELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFG 173
           E +  + ++  L E+ A R F Q+I G++Y H+  +VHRDLK ENLLLD   N+ + DFG
Sbjct: 139 EFYKYIQRKRRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFG 198

Query: 174 MA-ALESKDKLLETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEE 231
                   ++ ++TSCGSP YAAPE+V S  PY   ++DVWSCG+ILYA+L G LP+D++
Sbjct: 199 FVNEFLPDNEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDD 258

Query: 232 DGN-----IRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             N     I  L   +     + P  + I+P  RDL+ +IL  +P +R+  + I +H  L
Sbjct: 259 STNPEGDDIGKLYQYITRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWL 316

Query: 287 QKY 289
           + +
Sbjct: 317 KPH 319

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  192 bits (487), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 166/295 (56%), Gaps = 31/295 (10%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLP--- 72
           +G W   ET+GAGS GKV LA++  T ++ A+K+++++       +F+       LP   
Sbjct: 112 LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT-----KSFIHKQQQQQLPPPS 166

Query: 73  ---------YGIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKG 113
                      +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G
Sbjct: 167 NEEELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 226

Query: 114 ELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFG 173
           +L + ++Q G L E  A +F R I   + Y H   IVHRDLK EN+++     I++ DFG
Sbjct: 227 QLLDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFG 286

Query: 174 MAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG 233
           ++ L    K L T CGS ++AAPE++   PY G E D+WS GV+LY L+ G++PFD+E+ 
Sbjct: 287 LSNLYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENA 346

Query: 234 NIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           ++  L  K++ GK E P    +S +   L+ ++L V+P +R   ++++ H  +QK
Sbjct: 347 SV--LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/289 (37%), Positives = 164/289 (56%), Gaps = 24/289 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLA-----QNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ +G TLG G  GKV L      ++T+  +  A+K+I +        + +   + ++
Sbjct: 31  FGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRD-------SILQDREKEI 83

Query: 71  LPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
               I REI  +K L HPN++RL +V + ++ + +VLEY   GE +  + ++  L E  A
Sbjct: 84  ---KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEPIA 140

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 189
            + F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L++TSCG
Sbjct: 141 CKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMKTSCG 200

Query: 190 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN-----LLLKVQ 243
           SP YAAPE +V+  PY   ++DVWSCG+IL+A+L G LP+D++  N R      L   + 
Sbjct: 201 SPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYIT 260

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
           +   + P    IS   RDL+ +IL   P QR+  REI  H  L+ + S 
Sbjct: 261 TSPLKFPS--YISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 164/288 (56%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++  T ++ A+K++   +KS  + Q        + +++ 
Sbjct: 95  LGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELME 154

Query: 73  YGIE------------REIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
              +            RE  + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 155 RKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 214

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E  A +F R I   + Y H   IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 215 QHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYDN 274

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E D+WS GV++Y L+ G++PFD+E+ ++  L  
Sbjct: 275 KKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--LHE 332

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK E P    +S E   L+ ++L V+P +R   +++  H  +Q+
Sbjct: 333 KIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 164/292 (56%), Gaps = 25/292 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++  T ++ A+K++   +KS  + Q     G   P    
Sbjct: 51  LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQ--QLQGLPPPATEE 108

Query: 73  YGIER----------------EIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELF 116
             +ER                E  + ++L HP++ RL+++   +   YM+ EYV  G+L 
Sbjct: 109 ELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 168

Query: 117 NLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 176
           + ++Q G L E  A +F R I   + Y H   IVHRDLK EN+++     I++ DFG++ 
Sbjct: 169 DYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSN 228

Query: 177 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIR 236
           +    K L T CGS ++AAPE++   PY G E D+WS GV+LY L+ G++PFD+E+ ++ 
Sbjct: 229 MYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV- 287

Query: 237 NLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
            L  K++ GK E P    +S +   L+ ++L V+P +R   ++++ H  +QK
Sbjct: 288 -LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  189 bits (481), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 168/288 (58%), Gaps = 19/288 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV LA++  T ++ A+K++   +K++ + +          +VL 
Sbjct: 181 LGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPPPRTQEEVLE 240

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + ++L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 241 RERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 300

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E  A +F R I   + Y H   IVHRDLK EN+++     IK+ DFG++ + + 
Sbjct: 301 QHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNMFNP 360

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 361 KKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 418

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           K++ GK E P    +S E   L+ ++L V+P +R   ++++ H  +Q+
Sbjct: 419 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  188 bits (477), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 154/276 (55%), Gaps = 21/276 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LAQ+  T      KV+ KS            NDP+++    
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPT----HTKVVLKSS---------DKNDPNIV---- 77

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  ++P + +LY+V  T   ++M LEY    EL++ ++    +P +E V+ F 
Sbjct: 78  -REVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFA 136

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+ G+ Y H+L  VHRDLK EN+LLD   + KL DFG          LET CG+  Y A
Sbjct: 137 QIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVYMA 196

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D+WS GVILY ++ G +PFDE+D       +  Q+ +     E+ +
Sbjct: 197 PELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NENIV 253

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPS 291
           + +A+DLI+++L   P  R    +ILKHP LQ + S
Sbjct: 254 TADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  187 bits (476), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 152/276 (55%), Gaps = 21/276 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           IG +K+ + +G GS GKV LA +  T Q   +K  +K             NDP+V+    
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNK-------------NDPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P++ +LY+V  T   ++M LEY    EL+  L+ +  +   E+ + F 
Sbjct: 77  -REVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLFA 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H+L  VHRDLK EN+LLD K   K+ DFG     +   +LET CG+  Y A
Sbjct: 136 QIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D+WS GVILY ++ G +PFDEED       +  +   Y    +D +
Sbjct: 196 PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDDVV 252

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPS 291
           S +A+DLI Q+L  +P QR +  ++L HP LQ Y S
Sbjct: 253 SKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  188 bits (477), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 159/290 (54%), Gaps = 34/290 (11%)

Query: 16  IGPWKLGETLGAGSTGKVLL----AQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVL 71
            GP+ +G TLG G  GKV L    A+     +  A+K+I +                D +
Sbjct: 42  FGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR----------------DTV 85

Query: 72  PYGIEREIII------MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPL 125
           P   E+EI I      +KLL+HPN++RL +V + ++ + +VL+Y   GE +  + ++  L
Sbjct: 86  PKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRL 145

Query: 126 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 185
            E  A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ + DFG      K+ L+ 
Sbjct: 146 KEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMR 205

Query: 186 TSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLL 239
           TSCGSP YAAPE +VS  PY   ++DVWSCGVILYA+L G LP+D++  N     I  L 
Sbjct: 206 TSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLY 265

Query: 240 LKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
             +     + P  + I P  RDL+ +IL   PE R+   +I +H  LQ +
Sbjct: 266 QYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  186 bits (472), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 156/286 (54%), Gaps = 24/286 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQN-----TETGQIAAVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ +G TLG G  GKV L         E  +  A+K+I +          V       
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKEVK------ 96

Query: 71  LPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
               I REI  +K L HPN++ L +V + ++ + +VLE+V  GE +  + ++  L E+ A
Sbjct: 97  ----IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 189
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L+ TSCG
Sbjct: 153 CRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMRTSCG 212

Query: 190 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLKVQ 243
           SP YAAPE +VS   Y   ++DVWSCGVILYA+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYIT 272

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
               + P  + I+P  RDL+ +IL   P +R+  R I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/276 (35%), Positives = 150/276 (54%), Gaps = 26/276 (9%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
           +G  LG G  GKV   ++ E+G I A+KV+ K+               D+L Y +ER+ I
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQKT---------------DILQYKLERQFI 159

Query: 81  ----IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQ 136
               I   LNHPN+ +LY  +   + +Y+++EY+  GEL+  L   GP     A  +  Q
Sbjct: 160 REVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNYVYQ 219

Query: 137 IIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAP 196
           I   I Y H   I+HRD+KPEN+L+     +KL DFG + +  K     T CG+  Y +P
Sbjct: 220 IASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDYLSP 279

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL-KVQSGKYEIPGEDEI 255
           EIV    Y     D+W+ G++ Y LL G  PF+E   N ++L   +++ G    P   ++
Sbjct: 280 EIVDYKEY-DHNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERIRRGDIVFP--KQV 333

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPS 291
           +PEARD I +IL +EP++R+  +EI+ HP + KY S
Sbjct: 334 TPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  187 bits (476), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 165/283 (58%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDVLP 72
           +G W   ET+GAGS GKV +A++  T +I A+K+I   +K+  + +       N+ + L 
Sbjct: 137 LGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEALE 196

Query: 73  Y--GIEREII----------IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               +E+EI           + + L HP++ RL+++   +   YM+ EYV  G+L + ++
Sbjct: 197 RQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 256

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 257 QHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFDP 316

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E+ ++  L  
Sbjct: 317 RTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 374

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK + P    +S E   L+ ++L V+P +R   +++++H
Sbjct: 375 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 159/286 (55%), Gaps = 24/286 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQN-----TETGQIAAVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ +G TLG G  GKV L  +      E  +  A+K+I +              D +V
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDA-------DKEV 95

Query: 71  LPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
             Y   REI  +K L HPN++ L +V + ++ + +VLE+V  GE +  + ++  L E+ A
Sbjct: 96  KIY---REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 189
            R F Q+I G++Y H  G+VHRDLK ENLL+D   N+ + DFG        ++L+ TSCG
Sbjct: 153 CRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELMRTSCG 212

Query: 190 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLKVQ 243
           SP YAAPE +VS   Y   ++DVWSCGVILYA+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYIT 272

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
               + P  + I+P  RDL+ +IL   P +R+  R I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  186 bits (471), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 158/283 (55%), Gaps = 19/283 (6%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVI---SKSVFNAQGSTFVGSNDPDV-- 70
           +G W    T+GAGS GKV LA++     + AVK++   +K+    Q S     +  D+  
Sbjct: 115 LGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIKE 174

Query: 71  ----LPYGIER------EIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLV 120
               L   I R      E  + ++L+H N+ +LY +   +   YM+ EYV  G+L + ++
Sbjct: 175 RERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYII 234

Query: 121 QRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 180
           Q G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IK+ DFG++ L   
Sbjct: 235 QHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFDP 294

Query: 181 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240
              L T CGS ++AAPE++   PY G E D+WS GVILY L+ G++PFD+E+ N   L  
Sbjct: 295 RAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA--LHE 352

Query: 241 KVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           K++ GK   P    +S E   L+ ++LTV P++R   +EI+ H
Sbjct: 353 KIKRGKVSYPA--TLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  184 bits (467), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 161/286 (56%), Gaps = 24/286 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLL-----AQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDV 70
            GP+ +G TLG G  GKV L     + + E  +  A+K+I +              D ++
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDA-------DKEI 95

Query: 71  LPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
             Y   REI  +K L HPN++ L +V + ++ + +VLE+V  GE +  + ++  L E+ A
Sbjct: 96  KIY---REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSA 152

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 189
            R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ + DFG        ++L++TSCG
Sbjct: 153 CRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKTSCG 212

Query: 190 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRNLLLKVQ 243
           SP YAAPE +VS   Y   ++DVWSCGVILYA+L G LP+D++  N     I  L   + 
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYIT 272

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
               + P  + I+P  RDL+ +IL   P +RI  + I +H  L+ +
Sbjct: 273 QTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  186 bits (471), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 164/288 (56%), Gaps = 25/288 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIA-------AVKVISKSVFNAQGSTFVGSNDP 68
            GP+ L  TLG G  GKV L  +  + Q +       A+K+I +S    +GS      + 
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSILPKGS------NK 134

Query: 69  DVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPEN 128
           ++  Y   REI  +K L HPN+++L DV + ++ + +VLEY   GE +  + ++  L E 
Sbjct: 135 EIKVY---REINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEI 191

Query: 129 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETS 187
            A + F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L+ T 
Sbjct: 192 NASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQTNELMLTP 251

Query: 188 CGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEE----DGN-IRNLLLK 241
           CGSP YAAPE+V S  PY   ++D+WSCG+ILYA+L G LP+D++    DGN I  L   
Sbjct: 252 CGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDIARLYYY 311

Query: 242 VQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
           + +   + P  + I P  RDL+ +IL    ++RI  R I+ H  L+ +
Sbjct: 312 ITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  185 bits (470), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 160/285 (56%), Gaps = 19/285 (6%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSV--FNAQGSTFVGSNDPDV------ 70
           W   ET+GAGS GKV LA+N  + ++ A+K++ ++   +  +        D +       
Sbjct: 67  WDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAKERQK 126

Query: 71  -LPYGIER------EIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123
            L   I R      E  + ++L HPNV +LY++   +   YM  E++  G+L + ++Q G
Sbjct: 127 RLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYIIQHG 186

Query: 124 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 183
            L EN A +  R I+  + Y HA  IVHRDLK EN++L     IKL DFG++ +    K 
Sbjct: 187 SLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYDPRKS 246

Query: 184 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243
           L+T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+E  N   L  K++
Sbjct: 247 LQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALHEKIK 304

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
            GK   P    +S +   L+ +IL V+P++R   ++++ H  + K
Sbjct: 305 KGKVTYP--QFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  182 bits (463), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/274 (37%), Positives = 148/274 (54%), Gaps = 21/274 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T +   +K   K             NDP+V+    
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDK-------------NDPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  ++  + RLY+V  T   ++M LEY    EL+  L+    +  +E  R F 
Sbjct: 77  -REVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRLFA 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  I Y H+L  VHRDLK EN+LLD K N KL DFG          L+T CG+  Y A
Sbjct: 136 QIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE+     Y GF+ D+W+ GVILY ++ G +PFDE+D        K+ +   EI  ED +
Sbjct: 196 PELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDE--AKTKWKIVNEMPEI-NEDLV 252

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
           SP+A+DLI Q+L  +P +R    +IL HP LQ Y
Sbjct: 253 SPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPY 286

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  179 bits (454), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 159/289 (55%), Gaps = 30/289 (10%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQ-----------NTETGQIAAVKVISKSVFNAQGSTFVG 64
            GP+ +G TLG G  GKV +             +  T +  A+K+I +        T V 
Sbjct: 47  FGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRD-------TIVR 99

Query: 65  SNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGP 124
           ++D +   Y   REI  +K L HPN++ L ++ + ++ + +VLEY   GE +  + ++  
Sbjct: 100 NSDKETKIY---REINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQRKRR 156

Query: 125 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKL 183
           L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      +++ L
Sbjct: 157 LKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNENVL 216

Query: 184 LETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN-----IRN 237
           ++TSCGSP YAAPE +VS   Y G + D+WSCGVILYA+L G LP+D++  N     I  
Sbjct: 217 MKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISK 276

Query: 238 LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           L   + +   + P  D ++P  RDL+ +IL  +P +R     I  H  L
Sbjct: 277 LYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  181 bits (460), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 154/279 (55%), Gaps = 25/279 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +++ + +G GS GKV LA +  T Q   +K  +KS             DP+V+    
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS-------------DPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +   +P + +LY+V  T   ++M LEY    EL++ L+ +  +P +E  R F 
Sbjct: 77  -REVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFA 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H+L  VHRDLK EN+LLD      L DFG     +    LET CG+  Y A
Sbjct: 136 QIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG--ED 253
           PE++    Y G++ D WS G+ILY +L G +PFDE+D  +R   LK+    +E P   ++
Sbjct: 196 PELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRT-GLKIM---HEEPAVLDE 250

Query: 254 EISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
             SP+A+DLIV++L     QR    E+L+HP LQ Y ++
Sbjct: 251 YTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  181 bits (458), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 112/332 (33%), Positives = 175/332 (52%), Gaps = 55/332 (16%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQN-------------------------TETGQIAAVKVI 50
            GP+ +G T+G G  GKV L  +                          E  +  A+K+I
Sbjct: 58  FGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKLI 117

Query: 51  SKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYV 110
            +            S DP      I REI  +K L HPN+++L +V + ++ + +VLEY 
Sbjct: 118 RRDTI---------SKDPR-REIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLEYA 167

Query: 111 EKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLA 170
             GE +  + ++  L E  A + F Q+I G++Y H+ G++HRDLK EN+LLD   N+ + 
Sbjct: 168 SGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLIIT 227

Query: 171 DFGMA-ALESKDKLLETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPF 228
           DFG      + ++L++TSCGSP YAAPE+V S  PY   + D+WSCG+IL+A+L G LP+
Sbjct: 228 DFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYLPW 287

Query: 229 DEE-----DGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
           D++       NI  L   + +   + P  + I+   RDL+ +IL  +P++R+  R ILKH
Sbjct: 288 DDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYILKH 345

Query: 284 -------PLL----QKYPSIKDSKSIRNLPRE 304
                  P L    +++ +I  S+SI  LP+ 
Sbjct: 346 QWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  180 bits (457), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 148/274 (54%), Gaps = 21/274 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T Q   +K+ SK             NDP+V+    
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK-------------NDPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  ++ ++ +LY+V  T   ++M LEY    EL+  L+ +  +P  E    F 
Sbjct: 77  -REVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFS 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H++  VHRDLK EN+LLD K + KL DFG     +   +LET CG+  Y A
Sbjct: 136 QIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++   PY G++ D WS G+ILY ++ G +PFDE D       +   +  Y+    D I
Sbjct: 196 PELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYD---NDYI 252

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
               ++LI Q+L  +P QR    ++L+HP LQ Y
Sbjct: 253 DSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 152/279 (54%), Gaps = 25/279 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +++   +G GS GKV LA +  T +   +K  +KS             DP+V+    
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKS-------------DPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +    P + +LY++  T   ++M LEY    EL+  L++   +P +E  R F 
Sbjct: 77  -REVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRLFA 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI   + Y H+L  VHRDLK EN+LLD   N KL DFG     +   +LET CG+  Y A
Sbjct: 136 QISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE- 254
           PE++    Y GF+ DVWS GVILY LL G +PFDEE    +N   K+ +   E+P  D  
Sbjct: 196 PELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDST 250

Query: 255 -ISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
            + P+A DL+ ++L  +P  R   +E+L+HP LQ Y ++
Sbjct: 251 LLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 170/313 (54%), Gaps = 28/313 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T     +K  +KS             DP+++    
Sbjct: 35  VGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNKS-------------DPNIV---- 77

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  ++P + +LY+V  T   ++M  EY    +L++ ++    +P +  +  F 
Sbjct: 78  -REVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIELFT 136

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 137 QIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTVYMA 196

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE- 254
           PE++    Y GF+ D+WS GVILY +L G +PFDE+D        K+ +   E+P  ++ 
Sbjct: 197 PELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET--KTEWKIMN---EMPVFNDT 251

Query: 255 -ISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDH 313
            +S +A+DL++++L+ +P +R   +EIL HP LQ Y S+   K+ R L ++    N   H
Sbjct: 252 ILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQ---RNGTIH 308

Query: 314 NDGTIDQAILQNL 326
               +++ +L+NL
Sbjct: 309 FHSKLERKLLKNL 321

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  179 bits (454), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 152/289 (52%), Gaps = 21/289 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T +   +K   KS             DP+++    
Sbjct: 34  VGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKS-------------DPNLV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P + +LY+V  T   ++M LEY    EL+  L+    +P +E  + F 
Sbjct: 77  -REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAKLFA 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 136 QIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D+WS GVILY ++ G +PFDE+D       +      +    ++ +
Sbjct: 196 PELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNF---NDNFV 252

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304
           S EA+DLI ++L   P +R    +IL HP LQ Y  I  S++ + + R+
Sbjct: 253 SHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  177 bits (449), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 156/286 (54%), Gaps = 35/286 (12%)

Query: 7   NVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSN 66
           ++T LR   +G +++ + +G GS GKV LA +  T Q   +K+ SK             N
Sbjct: 27  SLTELRD--VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSK-------------N 71

Query: 67  DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP 126
           DP+V+     RE+   +  ++  + +LY+V  T   ++M LEY    EL+  L+ +  +P
Sbjct: 72  DPNVV-----REVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIP 126

Query: 127 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLET 186
            +E    F QI+  + Y H++  VHRDLK EN+LLD K   KL DFG     +   +LET
Sbjct: 127 LDECSHLFSQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILET 186

Query: 187 SCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGK 246
            CG+  Y APE++   PY G++ D WS G+ILY ++ G +PFDEED +I+         K
Sbjct: 187 VCGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKT--------K 237

Query: 247 YEI----PGEDE--ISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           Y I    P  D+  I    +DLI+Q+L  +P QR    ++L+HP +
Sbjct: 238 YRIVNNEPFYDDNFIDANGKDLIMQLLQKDPSQRPSLTQVLQHPFM 283

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/284 (37%), Positives = 159/284 (55%), Gaps = 22/284 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLA---QNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLP 72
            GP+ +G TLG G  GKV L     N++  +  A+K+I +        T   +++ +V  
Sbjct: 53  FGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRD-------TIPKNSEKEVKI 105

Query: 73  YGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVR 132
           Y   REI  +K L HPN++ L +V + ++ + +VL Y   GE +  + ++  L E  A R
Sbjct: 106 Y---REINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACR 162

Query: 133 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCGSP 191
            F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ + DFG      S++ L++TSCGSP
Sbjct: 163 LFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSP 222

Query: 192 HYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRL-----PFDEEDGNIRNLLLKVQSG 245
            YAAPE +V+   Y   ++DVWSCGVILYA+L G L     P + +  +I  L   +   
Sbjct: 223 CYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKT 282

Query: 246 KYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
             + P  + I+P  RD++ +IL  +P +RI    ILKH  LQ +
Sbjct: 283 SLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  169 bits (427), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 151/274 (55%), Gaps = 21/274 (7%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G TLGAGS G V  A+   TG+  AVK++ K     +          DV    +  E+ 
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGK----------DVQLQMLYDELS 97

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN+++  D +E+    Y+V +    GELF+ ++++G   E +AVR   QI+  
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILKA 157

Query: 141 ISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPENLL L  K +  + L DFG+A  L ++D+L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYVAP 217

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GV+ Y LL G  PF  E  ++   L +  SG+Y +    P  
Sbjct: 218 EVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKPYW 274

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             IS +A+D I+Q LTV P  R    E+L H  +
Sbjct: 275 SSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  175 bits (444), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 148/274 (54%), Gaps = 21/274 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T +   +K  SK+             DP+V+    
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKT-------------DPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  +HP + +LY++  T   ++M LEY    EL++ L+    +P +E  R F 
Sbjct: 77  -REVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRLFA 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H+L  VHRDLK EN+LLD + N KLADFG     +    LET CG+  Y A
Sbjct: 136 QIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D+WS GVILY L+ G +PFDEED       +  +   Y    E   
Sbjct: 196 PELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDY---NEKIF 252

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
           +  + +LI  +L  +P++R    EILKH  L+ Y
Sbjct: 253 NANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  174 bits (442), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 152/279 (54%), Gaps = 25/279 (8%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T Q   +K   K              DP+V+    
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEK-------------KDPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P + +LY+V  T   ++M LEY    EL++ L+Q+  +P +E  + F 
Sbjct: 77  -REVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKLFA 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H+L  VHRDLK EN+LLD +    L DFG     +    LET CG+  Y A
Sbjct: 136 QIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG--ED 253
           PE++    Y G++ D WS G+ILY +L G +PFDEED  +    LK+ +   E+P   + 
Sbjct: 196 PELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPIVDA 250

Query: 254 EISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
             +  A+DLI+++L   P +R    ++L+HP LQ Y +I
Sbjct: 251 YTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  174 bits (440), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 153/282 (54%), Gaps = 21/282 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           IG +K+ + +G GS GKV LA +  T Q   +K  +K              DP+V+    
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK-------------RDPNVV---- 76

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P + +LY+V  T   ++MVLEY    EL+  L++   L   E+ + F 
Sbjct: 77  -REVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFS 135

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI   + Y H L  VHRDLK EN+LLD   + KL DFG     +    LET CG+  Y A
Sbjct: 136 QIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVYMA 195

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D+WS G+ILY ++ G +PFDE+D +I+   LK+ + + +   ++ I
Sbjct: 196 PELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQEWI 252

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKS 297
           S +A DLI  +L   P +RI   ++L HP LQ +  +   K+
Sbjct: 253 SDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKT 294

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  174 bits (442), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 150/281 (53%), Gaps = 35/281 (12%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ E +G GS GKV LA +  T +   +K   K             NDP+++    
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIKSSVK-------------NDPNIV---- 85

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +   +  + +LY++  T   ++M LEY    EL++ ++Q   +P  E ++ F 
Sbjct: 86  -REVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLFS 144

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL-LETSCGSPHYA 194
           QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG    E  +K+ LET CG+  Y 
Sbjct: 145 QIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTR-ECMEKVNLETICGTTVYM 203

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254
           APE+    PY GF+ D+WS GVILY +L+G +PFDE+D             K++I  E+ 
Sbjct: 204 APELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDD---------EAKTKWKIINEEP 254

Query: 255 ------ISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
                 ++ E  DL+ ++L  +   R   REIL+H  LQ Y
Sbjct: 255 EYNSKFMTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPY 295

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  174 bits (441), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 150/276 (54%), Gaps = 21/276 (7%)

Query: 14  DRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPY 73
           + +G +K+ + +G GS GKV LA +  T +   +K   K+             DP+V+  
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLKSSDKT-------------DPNVV-- 78

Query: 74  GIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
              REI   +  + P + +LY+V  T   ++MV+EY    EL++ L+ +  +  +E+ R 
Sbjct: 79  ---REIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESARI 135

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHY 193
           F QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG     SK+  LET CG+  Y
Sbjct: 136 FAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTVY 195

Query: 194 AAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGED 253
            APE++    Y G++ D+W+ G++LY ++ G +PFDE+D     L +   S  Y+     
Sbjct: 196 MAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYD---NK 252

Query: 254 EISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
             + ++ DL+ ++L+ +P  R    +IL HP L  Y
Sbjct: 253 YFNDDSIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  166 bits (421), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 160/300 (53%), Gaps = 29/300 (9%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAGS G V  A+   TG   AVK++ K                DV    +  E++
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGN----------DVQLQMLYDELM 97

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ LNHPN+++  D +E+ +  Y+V +    GELF+ ++Q+G   E +AV+   QI+  
Sbjct: 98  ILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQILKA 157

Query: 141 ISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPENLL LD   N  + L DFG+A  L++   L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGYVAP 217

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI Y LL G  PF  E  ++   L +  SG+Y +    P  
Sbjct: 218 EVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKPYW 274

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK--------YPSIKDSKSIRNLPRE 304
           + IS EA+  I+++LT+ P++R    ++L    +           P I+   + RN  RE
Sbjct: 275 NNISKEAKLFILRVLTISPKKRPTATDLLSDAWITSKTQQTNDLLPEIRKGFNARNKFRE 334

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  165 bits (418), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 162/300 (54%), Gaps = 29/300 (9%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAGS G V  A+   TG+  AVK++ K     QG+        +V    +  E+ 
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKAL--QGN--------EVHLQMLYDELS 89

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HP+++   D +E+    Y+V +    GELF+ ++ RG   EN+AV+   Q++  
Sbjct: 90  ILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLLDA 149

Query: 141 ISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMA-ALESKDKLLETSCGSPHYAAP 196
           + Y H+  +VHRDLKPEN+L        ++ +ADFG+A  L++ D ++  + GS  Y AP
Sbjct: 150 VKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYVAP 209

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++ +  HG   D+WS GVI Y LL+G   F  E  ++   L +  S  Y +    P  
Sbjct: 210 EVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAE--SVEGFLEECTSSTYPVTFHRPYW 266

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK--------YPSIKDSKSIRNLPRE 304
           D+IS EA+  I+  LT+EPE+R    ++L HP +           PS+++    R   RE
Sbjct: 267 DKISDEAKKFILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFRE 326

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  172 bits (436), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 145/277 (52%), Gaps = 21/277 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T +   +K   K             NDP+++    
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK-------------NDPNIV---- 80

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P + +LY+V  T   ++M LEY    EL++ L+    +   E    F 
Sbjct: 81  -REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFA 139

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D+WS GVILY L+TG LPFD++D       +  +  KY+      I
Sbjct: 200 PELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYD---AKVI 256

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
             +ARDLI ++L   P +R    ++L+HP LQ Y S+
Sbjct: 257 PDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  164 bits (416), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 102/272 (37%), Positives = 151/272 (55%), Gaps = 17/272 (6%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+   TG+  AVK++ K           G+N    + Y    E+ 
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALK-------GNNVQLQMLYD---ELA 103

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y+V +    GELF+ ++++G   E +AV    Q+I  
Sbjct: 104 ILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLISA 163

Query: 141 ISYCHALGIVHRDLKPENLL-LDHKFNIKL--ADFGMAA-LESKDKLLETSCGSPHYAAP 196
           +SY H+  IVHRDLKPEN+L LD+  N +L  ADFG+A  L+S D L+    GS  Y AP
Sbjct: 164 VSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYVAP 223

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQSGKYEIPGEDE 254
           E+++    HG   D+WS GVI Y LL+G   F  E  +G +          K+  P  D 
Sbjct: 224 EVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYWDN 282

Query: 255 ISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           IS EA+D I++ LT++P  R    E+L+ P +
Sbjct: 283 ISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  162 bits (410), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 149/277 (53%), Gaps = 22/277 (7%)

Query: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKS---VFNAQGSTFVGSNDPDVL 71
           ++  +++G  LG G  GKV   ++  +G I A+KV++K     FN Q             
Sbjct: 114 KLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ----------- 162

Query: 72  PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAV 131
               +REI I   LNH N+ +LY  +  ++++Y+V+EY+  GEL+ LL + GP+ +  A 
Sbjct: 163 ---FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDITAS 219

Query: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 191
            +  Q+   ++Y H   I+HRDLKPEN+L+     IKL DFG +     ++  +T CG+ 
Sbjct: 220 NYVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCGTI 279

Query: 192 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPG 251
            Y +PE++S   Y     DVW+ G++ Y L+ G  PF+E+         ++     + P 
Sbjct: 280 DYLSPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLKFP- 335

Query: 252 EDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
              +S EARDLI  +L V P +R   ++++ HP ++K
Sbjct: 336 -PNVSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  164 bits (414), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 153/274 (55%), Gaps = 21/274 (7%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+NTETG+  AVK++ K              D          E+ 
Sbjct: 39  FGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYD----------ELD 88

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y++ +  + GELF+ ++++G   E +AVR   +I+  
Sbjct: 89  ILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSA 148

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++LL    GS  Y AP
Sbjct: 149 VKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAP 208

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI Y LL G   F  E   +++ L +  +G+Y +    P  
Sbjct: 209 EVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHRPYW 265

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           D +S +A+  I++ L ++P +R    E+L+ P +
Sbjct: 266 DSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 144/277 (51%), Gaps = 21/277 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T +   +K   K             NDP+++    
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK-------------NDPNIV---- 80

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P + +LY+V  T   ++M LEY    EL++ L+    +   E    F 
Sbjct: 81  -REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGELFA 139

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D WS GVILY L+TG LPFD++D       +  +  KY+      I
Sbjct: 200 PELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYD---PKLI 256

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
             +A+DLI ++L   P +R    ++L+HP LQ Y S+
Sbjct: 257 PDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  169 bits (429), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 154/287 (53%), Gaps = 33/287 (11%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
           + E +G G+   V  A    TG+  AVK+ISK          +G+ D      G+ RE+ 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-------KVIGNMD------GVTRELE 246

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           +++ LNHP ++RL   +E A   YMV+E+V  G+L + +   G + E+      RQI+  
Sbjct: 247 VLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTA 306

Query: 141 ISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 199 VSGLPYHG----FES--------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSG 245
           + G         +E         D+WS G ++Y +LTG LPF    G+ ++ L K +  G
Sbjct: 367 IRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRG 423

Query: 246 KY-EIPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYP 290
            Y E P +D  IS EARD I  +L V+P  R+   + L HP ++  P
Sbjct: 424 SYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  169 bits (429), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 145/277 (52%), Gaps = 21/277 (7%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T +   +K   K             NDP+++    
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK-------------NDPNIV---- 80

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P + +LY+V  T   ++M LEY    EL++ L+    L   E    F 
Sbjct: 81  -REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELFA 139

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           PE++    Y GF+ D+WS GVILY L+TG LPFD++D       +  +  KY+      I
Sbjct: 200 PELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYD---SKFI 256

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
             +A+DLI ++L   P +R    ++L+HP LQ Y S+
Sbjct: 257 PDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  162 bits (410), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 150/276 (54%), Gaps = 21/276 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +  G+TLGAGS G V  A+   TG+  AVK++ K              D          E
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALKGNCVQIEMLYD----------E 87

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I++ L+HPN++     +E+    Y+  +    GELF+ ++ RG   E +AVR   Q++
Sbjct: 88  LSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIVQLL 147

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPHYA 194
            GI Y H+  IVHRDLKPEN+L   K +   + +ADFG+A  L+S D L+  + GS  Y 
Sbjct: 148 QGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSLGYV 207

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----P 250
           APE+++ +  HG   D+WS GVI Y LL G  PF  E  ++   L +  SGKY +    P
Sbjct: 208 APEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFHRP 264

Query: 251 GEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             D IS EA++ I++ L +EP +R    E+L+ P +
Sbjct: 265 YWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  169 bits (428), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 155/295 (52%), Gaps = 33/295 (11%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +K+ + +G GS GKV LA +  T +   +K   K             NDP+++    
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKTSDK-------------NDPNIV---- 80

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  + P + +LY+V  T   ++M LEY    EL++ L+    +   E    F 
Sbjct: 81  -REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAELFA 139

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE- 254
           PE++    Y GF+ D+WS GVILY L+TG LPFD++D        +V++ K++I  E+  
Sbjct: 200 PELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD--------EVKT-KWKIVNEEPN 250

Query: 255 -----ISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304
                I  +A+DLI ++L   P++R    ++L H  LQ Y S+   ++ + L R+
Sbjct: 251 YDSTLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  168 bits (426), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 165/310 (53%), Gaps = 37/310 (11%)

Query: 2   GDKNNNVTSLRGDRIGPWK----LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNA 57
           G  ++  +S+  ++ G +K    + E +G G+   V  A    TG+  AVK+ISK     
Sbjct: 177 GLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR---- 232

Query: 58  QGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFN 117
                +G+ D      G+ RE+ +++ LNHP ++RL   +E  +  YMV+E+V  G+L +
Sbjct: 233 ---KVIGNMD------GVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMD 283

Query: 118 LLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMA 175
            +   G + E+      RQI+  I Y H++GI HRDLKP+N+L+  D    +K+ DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 176 ALESKDKLLETSCGSPHYAAPEIVSG----LPYHGFES--------DVWSCGVILYALLT 223
            ++     ++T CG+  Y APE++ G    +    +E         D+WS G ++Y +LT
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILT 403

Query: 224 GRLPFDEEDGNIRNLLLK-VQSGKY-EIPGED-EISPEARDLIVQILTVEPEQRIKTREI 280
           G LPF    G+ ++ L K +  G Y E P +D  IS EARD I  +L V+P  R    + 
Sbjct: 404 GHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKA 460

Query: 281 LKHPLLQKYP 290
           L HP ++  P
Sbjct: 461 LNHPWIKMSP 470

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  168 bits (425), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 100/287 (34%), Positives = 155/287 (54%), Gaps = 33/287 (11%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
           + E +G G+   V  A    TG+  AVK+ISK          +G+ D      G+ RE+ 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-------KVIGNMD------GVTRELE 246

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           +++ LNHP ++RL   +E A+  YMV+E+V  G+L + +   G + E+      RQI+  
Sbjct: 247 VLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILAA 306

Query: 141 ISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 199 VSG-----LPYHGFES-------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSG 245
           + G      P    E        D+WS G ++Y +LTG LPF    G+ ++ L K +  G
Sbjct: 367 IRGKDSSVSPDECEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRG 423

Query: 246 KY-EIPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYP 290
            Y E P +D  IS EARD I  +L V+P  R+   + L HP ++  P
Sbjct: 424 SYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIKMNP 470

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  161 bits (408), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 154/276 (55%), Gaps = 21/276 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +  G+TLGAG+ G V  A+NTETG+  AVK++ K              D          E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------E 86

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I++ L+HPN++   D +E+    Y++ +  + GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 194
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++L+    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYV 206

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----P 250
           APE+++    HG   D+WS GVI Y LL G   F  E   +++ L +  +G+Y +    P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRFHRP 263

Query: 251 GEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             D +S +A+  I++ L ++P +R    ++L+ P +
Sbjct: 264 YWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  160 bits (406), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/274 (34%), Positives = 152/274 (55%), Gaps = 21/274 (7%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+N+ETG+  AVK++ K              D          E+ 
Sbjct: 39  FGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLEALYD----------ELD 88

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y++ +  + GELF+ ++++G   E +AVR   +I+  
Sbjct: 89  ILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEILSA 148

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++L+  + GS  Y AP
Sbjct: 149 VKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLGYVAP 208

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI Y LL G   F  E   + + L +  +GKY +    P  
Sbjct: 209 EVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFHRPYW 265

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           D +S +A+  I++ L + P +R    E+L+ P +
Sbjct: 266 DSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  166 bits (421), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 150/277 (54%), Gaps = 28/277 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+I+K          +G+ D      G+ RE+ ++
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKR-------KVMGNMD------GVTRELEVL 238

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + LNHP ++ L   +E  +  Y+V+E+V  G+L + +   G + E+      RQ++  + 
Sbjct: 239 RRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVK 298

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y HA+GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVIS 358

Query: 201 GLPYHGFES-------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-EIPG 251
           G      E        D+WS G ++Y +LTG LPF    G+ +  L K + +G Y E P 
Sbjct: 359 GKNSEEKEGNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHEGPL 415

Query: 252 ED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           +D  IS +ARD I   L V P  R+   + LKHP ++
Sbjct: 416 KDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  160 bits (405), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 149/276 (53%), Gaps = 21/276 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           ++ G+T+GAG+ G V  A    TG+  AVK+I K                D+    +  E
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGN----------DIQLQMLYDE 90

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I++ L HPN++     +E+   +Y+V +    GELF+ +++RG   E +AV    QI+
Sbjct: 91  LAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQIL 150

Query: 139 IGISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYA 194
             + Y H+  +VHRDLKPEN+L      K  I +ADFG+A  LE +  L+  + GS  Y 
Sbjct: 151 KAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLGYV 210

Query: 195 APEIV--SGLPYHGFESDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQSGKYEIP 250
           APE++  SG   HG   D+WS G+I Y LL G  PF  E  DG +  ++   +   +  P
Sbjct: 211 APEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHSP 267

Query: 251 GEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             DEIS EA+  I++ +T++P QR    E+LK P +
Sbjct: 268 YWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  159 bits (403), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 151/274 (55%), Gaps = 21/274 (7%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+   + +  AVK++ K+               DV    +  E+ 
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKGN----------DVQLQMLYDELS 89

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y+V +    GELF+ ++++G   E +AV    Q++  
Sbjct: 90  ILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDA 149

Query: 141 ISYCHALGIVHRDLKPENLL-LD--HKFNIKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPEN+L LD   +  + +ADFG+A  L+S D L+    GS  Y AP
Sbjct: 150 VKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAP 209

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI Y LL+G  PF  E  ++   L +    +Y +    P  
Sbjct: 210 EVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAE--SVEGFLEECTRSRYPVQFHKPYW 266

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           D IS EA+D I++ LT++PE+R    E++  P +
Sbjct: 267 DSISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score =  157 bits (398), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 145/274 (52%), Gaps = 28/274 (10%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIE-- 76
           +++G+ LG G  GKV   ++ ETG I A+K + K                +++ Y I+  
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKK---------------EIVQYTIQKQ 144

Query: 77  --REIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFF 134
             RE+ I     H N+ +LY  +   + +Y+++EYV  GEL+  L   GPL E  A  F 
Sbjct: 145 FRREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFV 204

Query: 135 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYA 194
            Q+   + Y H+  I+HRD+KPEN+L+     IKL DFG +      +  +T CG+  Y 
Sbjct: 205 YQMANALDYMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKTLCGTIDYL 264

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQSGKYEIPGE 252
           +PE++    Y+  + DVW+ GV+ Y LL G  PF+E+  +   R +L      + ++   
Sbjct: 265 SPELIKSREYNN-KVDVWALGVLTYELLVGSPPFEEDTKEMTYRRIL------RCDLKFP 317

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             +SP+ARDLIV++L  EP +RI   E+  H  +
Sbjct: 318 LNVSPQARDLIVRLLQFEPSKRIPLSEVKSHAWI 351

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  159 bits (403), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 146/270 (54%), Gaps = 21/270 (7%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAGS G V  A+   +G+  A+K++ K     +          DV    +  E+ 
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGK----------DVELQMLYDELS 97

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN+++  D +E+    Y+V +    GELF+ ++++G   E +AVR   QI+  
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 141 ISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPENLL         + L DFG+A  L++ D+L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGK----YEIPGE 252
           E+V+    HG   D+WS GV+ Y LL G  PF  E  ++   L +   G+    +  P  
Sbjct: 218 EVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTIGRTPVTFHKPYW 274

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILK 282
             IS EA+D I++ LTV P  R    E+L+
Sbjct: 275 SNISNEAKDFILRALTVNPHDRPTATELLQ 304

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  165 bits (418), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 156/284 (54%), Gaps = 36/284 (12%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A  T TG+  AVK+I+K          +G+ D      G+ RE+ ++
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKR-------KVMGNLD------GVTRELTVL 252

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP+++ L   +E   + YMV+E+V  G+L + +   GP+ E+      RQI+  + 
Sbjct: 253 QKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAVK 312

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     + T CG+  Y APE+V+
Sbjct: 313 YIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVVN 372

Query: 201 G--------LP-----YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGK- 246
           G        +P     ++    D+WS G ++Y +LTG LPF    G+    L + Q GK 
Sbjct: 373 GRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF---SGSTPQQLYE-QIGKA 428

Query: 247 --YEIPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
             +E+P +D  IS +ARD I  +L V+P  R+     L+HP +Q
Sbjct: 429 SYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  165 bits (417), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 151/277 (54%), Gaps = 28/277 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A   +TG+  AVK+ISK          VG  D      G+ RE+ ++
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKR-------KVVGVMD------GVARELEVL 238

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP ++ L   +E     Y+V+E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 239 QRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 298

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVIS 358

Query: 201 GLPYHGFES-------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-EIPG 251
           G      E        D+WS G ++Y +LTG LPF    G+ +N L K + +G Y E P 
Sbjct: 359 GKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPF---SGSTQNDLYKQITAGSYHEGPL 415

Query: 252 ED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           +D  IS +ARD I   L V+P  R+   + L+HP ++
Sbjct: 416 KDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  164 bits (415), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 153/267 (57%), Gaps = 20/267 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISK-SVFNAQGSTFVGSNDPDVLPYGIER 77
           ++ G  LG G   +    ++ E+G+I A K ++K S+   +    + S            
Sbjct: 92  YRRGHFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKTEKTKKKLLS------------ 138

Query: 78  EIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQI 137
           EI I K + HPN++   D +E   ++Y++LE    G L +L+ +R  L E E VRFF   
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 138 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAA 195
           I G + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + ++  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 196 PEIVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254
           PE++ G    H FE D+WS GV++YALL G+ PF  +D N+  +  ++++ +Y  P +  
Sbjct: 258 PEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 255 ISPEARDLIVQILTVEPEQRIKTREIL 281
           +S EA+ LI  IL V+P +R   REI+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  165 bits (417), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 157/292 (53%), Gaps = 33/292 (11%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
           + E +G G+   V  A    TG+  AVK+ISK          +G+ D      G+ RE+ 
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-------KVIGNMD------GVTRELE 246

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           +++ L+HP ++RL   +E  +  YMV+E+V  G+L + +   G + E+      RQI+  
Sbjct: 247 VLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEA 306

Query: 141 ISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 199 VSG----LPYHGFES--------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSG 245
           + G    +    +E         D+WS G ++Y +LTG LPF    G+ ++ L K +  G
Sbjct: 367 IRGKDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRG 423

Query: 246 KY-EIPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDS 295
            Y E P +D  IS EARD I  +L V+P  R+   + L HP ++  P +  S
Sbjct: 424 SYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  159 bits (401), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 93/274 (33%), Positives = 152/274 (55%), Gaps = 21/274 (7%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+NTETG+  AVK++ K              D          E+ 
Sbjct: 39  FGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------ELD 88

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y++ +  + GELF+ ++++G   E +AVR   +I+  
Sbjct: 89  ILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEILSA 148

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++L+    GS  Y AP
Sbjct: 149 VKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYVAP 208

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI Y LL G   F  E   +++ L +  +G++ +    P  
Sbjct: 209 EVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFHRPYW 265

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           D +S +A+  I++ L ++P +R    ++L  P +
Sbjct: 266 DSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  163 bits (413), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 161/285 (56%), Gaps = 19/285 (6%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ + G+I A K ++K    ++ +              +  EI I
Sbjct: 82  GHFLGEGGFARCFQIKD-DGGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 129

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG- 140
            K + H N+++  D +E   ++Y++LE    G L +LL +R  L E E VRFF   I+G 
Sbjct: 130 HKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQIVGA 188

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 189 VKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 248

Query: 200 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           +G    H +E D+WSCGV++YALL G+ PF  ++ NI  +  +++ G +  P +  ISPE
Sbjct: 249 TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKFISPE 306

Query: 259 ARDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIKDSKSIRNLP 302
           A  LI  IL+++P +R    EI+ +   +  +PS  D+  + + P
Sbjct: 307 ALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 155/300 (51%), Gaps = 29/300 (9%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+ + T +  AVK++ K                DV    +  E+ 
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGN----------DVQLQMLYDELS 96

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I+++L HPN++   D +E+    Y+V +    GELF+ ++ +G   E +AV    QI+  
Sbjct: 97  ILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSA 156

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPHYAAP 196
           + Y H+  +VHRDLKPEN+L   K +   + +ADFG+A  L+  D L+  + GS  Y AP
Sbjct: 157 VDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAP 216

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI+Y LL G   F  E   +   L +    KY +    P  
Sbjct: 217 EVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAE--TVDGFLEECTQNKYPVTFHKPYW 273

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK--------YPSIKDSKSIRNLPRE 304
           D IS EA++ I++ LT++P +R    E++K P +          YP I+    +R   R+
Sbjct: 274 DNISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRD 333

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 155/285 (54%), Gaps = 35/285 (12%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+ISK          +GSN       G+ RE+ ++
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKR-------KVMGSNMD-----GVSRELEVL 253

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP ++RL   +E  ++ YM++E+V  G+L + +   G + E+      RQI+  I 
Sbjct: 254 QRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAIK 313

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APEI+S
Sbjct: 314 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEIIS 373

Query: 201 G-------------LPYHGFES--DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQS 244
           G                + + S  D+WS G ++Y +LTG LPF    G+ +  L K +  
Sbjct: 374 GKNDGELRENADANSERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQKQLYKQISR 430

Query: 245 GKY-EIPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           G Y E P +D  IS EARD I  +L V+P  R+   + L+HP ++
Sbjct: 431 GSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  157 bits (397), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 145/262 (55%), Gaps = 21/262 (8%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+   +G+  AVK++ K     Q        D          E+ 
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYD----------ELS 97

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ LNHPN++R  D +E+ +  Y+V +    GELF+ ++++G   E +AV   +QI+ G
Sbjct: 98  ILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQG 157

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H   IVHRDLKPEN+L  +K +   + + DFG+A  L+  ++L+  + GS  Y AP
Sbjct: 158 VQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAP 217

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI Y LL G  PF  E  +    + +  SG+Y +    P  
Sbjct: 218 EVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESAD--GFIEECTSGQYPVVFHKPYW 274

Query: 253 DEISPEARDLIVQILTVEPEQR 274
           + +S  A++ I+  LTV P++R
Sbjct: 275 NNVSKTAKEFILWALTVSPKRR 296

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  159 bits (401), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 155/309 (50%), Gaps = 39/309 (12%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           + LG+ LG+G    V  A+N  TG+  AVK+     F+ Q       ND          E
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKI-----FHPQ------QNDDQKKNKQFREE 241

Query: 79  IIIMKLLNHPNVLRLYDVW-----ETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
             I+  ++HPN++ L D +     +T    Y+VLE ++ GELF+ +V++  LP+ E+   
Sbjct: 242 TTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAI 301

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGM 174
           F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +K+ADFG+
Sbjct: 302 FKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGL 361

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGN 234
           A    + +   T CG+P Y APE++    Y   + D+WS GVILY  L G  PF ++ G 
Sbjct: 362 AKFTGEMQFTNTLCGTPSYVAPEVLVKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 420

Query: 235 IRNLLLKVQSGKYEI--PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
             +L  ++ S KY    P  DEI   A  LI  +L ++PE R        HP L     +
Sbjct: 421 -PSLKEQIMSAKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSVSHL 479

Query: 293 KDSKSIRNL 301
             S +++ L
Sbjct: 480 DVSHNLKRL 488

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  161 bits (407), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 160/285 (56%), Gaps = 19/285 (6%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ ++G+I A K ++K    ++ +              +  EI I
Sbjct: 82  GHFLGEGGFARCFQIKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 129

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG- 140
            K + H N+++  D +E   ++Y++LE    G L +LL +R  L E E VRFF   I+G 
Sbjct: 130 HKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQIVGA 188

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 189 VKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 248

Query: 200 SGLPY-HGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           +G    H +E D+WSCGV++YALL G+ PF  ++ NI  +  +++ G Y  P +  IS E
Sbjct: 249 TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKCISQE 306

Query: 259 ARDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIKDSKSIRNLP 302
           A  LI  IL+++P +R    EI+ +   +  +P   D+  + + P
Sbjct: 307 ALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRIDASVLSSAP 351

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  162 bits (409), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 149/280 (53%), Gaps = 31/280 (11%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+I+K          +G+ D      G+ RE+ ++
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKR-------KVMGNLD------GVTRELEVL 237

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           K LNHP ++ L   +E  +  YMV+E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 238 KRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAVK 297

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 298 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 357

Query: 201 GLPYHGFES----------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-E 248
               +  E           D+WS G ++Y +LTG LPF    G+ +  L K +  G Y E
Sbjct: 358 SSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHE 414

Query: 249 IPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
            P +D  IS EARD I  +L V+P  R+     L+HP ++
Sbjct: 415 GPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score =  154 bits (389), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/292 (30%), Positives = 150/292 (51%), Gaps = 38/292 (13%)

Query: 8   VTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSND 67
           ++ L+  ++  +++G+ LG G  G+V   ++ E+G + A+K + K               
Sbjct: 98  LSKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKK-------------- 143

Query: 68  PDVLPYGIE----REIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRG 123
            D++ Y IE    RE+ I   L HPN+ +LY  +   + +Y+++EY+  GEL+  L  R 
Sbjct: 144 -DIIQYNIEKQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRS 202

Query: 124 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 183
              +  A  +  Q+   + Y H   I+HRD+KPEN+++     IKL DFG + +  K   
Sbjct: 203 HFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSK 262

Query: 184 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNI-------R 236
            +T CG+  Y +PE++    Y+  + DVW+ GV+ Y LL G  PF+EE   +       R
Sbjct: 263 RKTLCGTVDYLSPELIRSREYNE-KVDVWALGVLTYELLVGSPPFEEESKELTYKRILKR 321

Query: 237 NLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           NL+             D +  EAR LI ++L  +P  RI  +E+ KHP ++K
Sbjct: 322 NLIF-----------PDHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEK 362

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  156 bits (394), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 148/276 (53%), Gaps = 18/276 (6%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLGAGS G V  A+   + +  AVK++ K      G       +P      I  E+ I++
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGL-----EP------IYDELNIIQ 118

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
            L+HPN+++  D +ET    Y+V +    GELF+ ++  G   E +AV    QI+  + Y
Sbjct: 119 HLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEY 178

Query: 144 CHALGIVHRDLKPENLL-LDHKFN--IKLADFGMA-ALESKDKLLETSCGSPHYAAPEIV 199
            H+  I+HRDLKPENLL LD   +  I LADFG+A  LE+ D ++    GS  Y APE+ 
Sbjct: 179 LHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVF 238

Query: 200 SGLPYHGFESDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQSGKYEIPGEDEISP 257
           +    HG  SD+WS GVI Y LL G  PF  E  DG +  +       K++ P  D IS 
Sbjct: 239 TS-DGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISE 297

Query: 258 EARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIK 293
            A++ I++IL ++P  R    E+L  P +Q   S++
Sbjct: 298 LAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  154 bits (390), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 140/260 (53%), Gaps = 24/260 (9%)

Query: 33  VLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIER----EIIIMKLLNHP 88
           V   ++ +TG I A+K++ KS               ++L Y + +    EI I   LNH 
Sbjct: 140 VYCCRHIKTGFICAIKIMDKS---------------EILTYNVTKQFRNEIEIQSNLNHE 184

Query: 89  NVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALG 148
           N+ +LY  +  ++ +Y+++EY+  GEL+++L + GP  +  A  F  Q+   I Y H   
Sbjct: 185 NLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKR 244

Query: 149 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 208
           I+HRDLKPEN+L+D    IK+ DFG +         +T CG+  Y +PE+++   Y G  
Sbjct: 245 IIHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGL- 303

Query: 209 SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILT 268
            DVW+ G+I Y L+ G  PF+E+   +     ++++     P    +S +A++LI  +L 
Sbjct: 304 IDVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCDLNFPA--HVSQDAKNLISSLLK 359

Query: 269 VEPEQRIKTREILKHPLLQK 288
           + P +RI   ++LKHP + K
Sbjct: 360 LNPSERITLTDVLKHPWINK 379

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  155 bits (393), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 153/284 (53%), Gaps = 21/284 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +  G+TLGAG+ G V  A+   T +  AVK++ K                DV    +  E
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGN----------DVQLQLLYDE 89

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I++ L+HPN+++  D +E+    Y+V +    GELF+ ++ +G   E +AV+   QI+
Sbjct: 90  LKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQIL 149

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 194
             + Y H+  IVHRDLKPEN+L     +   + LADFG+A  L+S D+L+  + GS  Y 
Sbjct: 150 SAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLGYV 209

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG----KYEIP 250
           APE+++    HG   D+WS GV+ Y LL+G  PF  E  ++   L +   G    K+  P
Sbjct: 210 APEVLT-TSGHGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKFHKP 266

Query: 251 GEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKD 294
             D IS +A++ I++ L + P +R    E+L+ P +    S K+
Sbjct: 267 YWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  161 bits (408), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 154/279 (55%), Gaps = 30/279 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A   +TG+  AVK+ISK          +G+ D      G+ RE+ ++
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKR-------KVMGNID------GVTRELEVL 238

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + LNHP ++RL   +E  +  Y+++E+V  G+L + +   G + E+      +Q++  + 
Sbjct: 239 RRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEAVK 298

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H +GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVIS 358

Query: 201 G-------LPYHGFES--DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-EI 249
           G          + + S  D+WS G ++Y +LTG LPF    G+ ++ L K +  G Y E 
Sbjct: 359 GKNSEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSYHEG 415

Query: 250 PGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           P +D  IS EAR+ I  +L V P+ R+   + L HP ++
Sbjct: 416 PLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  154 bits (388), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 142/260 (54%), Gaps = 24/260 (9%)

Query: 33  VLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIE----REIIIMKLLNHP 88
           V   ++  TG I A+K + KS               +++ Y ++    RE+ I   L HP
Sbjct: 137 VYCVKHKRTGFICALKAMKKS---------------EIVQYNVQKQFRREVEIQSSLKHP 181

Query: 89  NVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALG 148
           N+ RLY  +   + +Y+++EY+  GEL+  L   GP  +  A  F  Q+   ++Y H+  
Sbjct: 182 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKN 241

Query: 149 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 208
           I+HRD+KPEN+LL  +  +KL DFG +     +   +T CG+  Y +PE++    Y   +
Sbjct: 242 ILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDN-K 300

Query: 209 SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILT 268
            DVW+ GV+ Y LL G  PF+E+    + L  K +  K ++   D++SP ARDLI ++L 
Sbjct: 301 VDVWALGVLTYELLVGSPPFEED---TKELTYK-RIIKRDLRFPDQVSPHARDLISRLLE 356

Query: 269 VEPEQRIKTREILKHPLLQK 288
            +P+ RI  +++ +HP ++K
Sbjct: 357 YDPQNRIPLKDVKRHPWIKK 376

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 155/287 (54%), Gaps = 25/287 (8%)

Query: 7   NVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSN 66
           N+ S    +   +++G  LG G  GKV   ++ ++G I+A+KV+ K              
Sbjct: 163 NINSKNKLQFSDFEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKK------------- 209

Query: 67  DPDVLPYGIE----REIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELF-NLLVQ 121
             +++ Y  E    RE+ +   LNHPN+++++  ++    +Y+++EY+  GEL+ +L   
Sbjct: 210 --EIVSYNAEKQFKREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNN 267

Query: 122 RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKD 181
            GP  +  A  +  QI   + Y H+  I+HRD+KPEN++L     IKLADFG +     +
Sbjct: 268 NGPFNDILASNYIYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPN 327

Query: 182 KLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241
              +T CG+  Y APE+V+   Y  +  D+W+ G++ Y L+ G  PF+EE  ++     +
Sbjct: 328 LRRKTICGTIDYLAPELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKDL--TYKR 384

Query: 242 VQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
           + +     P    +S +ARDLI ++L  +P +R+   +++KHP + K
Sbjct: 385 IINVDLNFP--QTVSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 152/265 (57%), Gaps = 18/265 (6%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ ++G++ A K ++K    ++ +              +  EI I
Sbjct: 76  GMFLGEGGFARCFQMKD-DSGKVFAAKTVAKISIKSEKTR-----------KKLLSEIQI 123

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG- 140
            K + HPN+++  D +E   ++Y++LE    G L +LL QR  L E E VRFF   I+G 
Sbjct: 124 HKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQIVGA 182

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           I Y H+  I+HRDLK  N+  D  FN+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 183 IKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVL 242

Query: 200 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           +G    H FE D+WS GV++YALL G+ PF  ++ N   +  +++   +  P +  IS E
Sbjct: 243 TGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKPISSE 300

Query: 259 ARDLIVQILTVEPEQRIKTREILKH 283
           A+ LI  IL+++P +R    EI+++
Sbjct: 301 AKVLIKDILSLDPLERPSLAEIMEY 325

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/265 (35%), Positives = 152/265 (57%), Gaps = 18/265 (6%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ ++G+I A K ++K    ++ +              +  EI I
Sbjct: 76  GMFLGEGGFARCFQMKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 123

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG- 140
            K + HPN+++  D +E   ++Y++LE    G L +LL QR  L E E VRFF   I+G 
Sbjct: 124 HKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQIVGA 182

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           I Y H+  I+HRDLK  N+  D  FN+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 183 IKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVL 242

Query: 200 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           +G    H FE DVWS GV++YALL G+ PF  ++ N   +  +++   +  P +  IS E
Sbjct: 243 TGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKPISSE 300

Query: 259 ARDLIVQILTVEPEQRIKTREILKH 283
           A+ LI  IL+++P +R    EI+++
Sbjct: 301 AKVLIKDILSLDPLERPSLTEIMEY 325

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 154/279 (55%), Gaps = 30/279 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  A K+ISK          +G+ D      G+ RE+ ++
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKR-------KVMGNMD------GVTRELEVL 243

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + LNHP ++RL   +E  +  Y+++E+V  G+L + +   G + E+      RQ++ G+ 
Sbjct: 244 RKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEGVK 303

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE+++
Sbjct: 304 YIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIA 363

Query: 201 GLP-------YHGFES--DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-EI 249
           G          + + S  D+WS G ++Y +LTG LPF    G+ +  L K +++G Y E 
Sbjct: 364 GKANAEENEKRNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSYHEG 420

Query: 250 PGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           P +D  IS EARD I  +L V P  R   ++ L+HP ++
Sbjct: 421 PLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  160 bits (404), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 150/275 (54%), Gaps = 27/275 (9%)

Query: 25  LGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMKL 84
           +G G+   V  A    TG+  AVK+I K     +               G++RE+ +++ 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-------------GVKRELDVLQK 244

Query: 85  LNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYC 144
           LNHP +++L D +E   + YM++E+V  G+L + +   G + E+      RQ++  + Y 
Sbjct: 245 LNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYM 304

Query: 145 HALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSG- 201
           H  GI HRDLKP+N+++  D    IK+ DFG+A +++++  L T CG+  Y APE++ G 
Sbjct: 305 HDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDGK 364

Query: 202 -------LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKY-EIPGED 253
                     +    D+WS G ++Y +LTG LPF  +  N   L  +++ G Y E P +D
Sbjct: 365 NAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLKD 422

Query: 254 -EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
             IS EAR+ I  +L V+P++R+   + L+HP ++
Sbjct: 423 YRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 155/294 (52%), Gaps = 34/294 (11%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+I+K          VG+ D      G+ RE+ ++
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKR-------KVVGNMD------GVSRELEVL 238

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + LNHP ++ L   +E   + YMV+E++  G+L + +   G + E       RQI+  I 
Sbjct: 239 QKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQ 298

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++    +++T CG+  Y APE++ 
Sbjct: 299 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIG 358

Query: 201 GLP-------------YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLL-KVQSGK 246
           G                +    D+WS G +++ +LTG LPF    G+ +  L  +++ G 
Sbjct: 359 GFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRKGS 415

Query: 247 Y-EIPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSI 298
           Y E P +D  IS EARD I  +L V+  +R+   + L HP +++  S  D+ S+
Sbjct: 416 YHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 100/306 (32%), Positives = 166/306 (54%), Gaps = 27/306 (8%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +     N ++G+I A K ++K    ++ +              +  EI I
Sbjct: 86  GHFLGEGGFARCF-QFNDDSGKIFAAKTVAKLSIKSEKTR-----------RKLLSEIQI 133

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG- 140
            K + + N+++  D +E   ++Y++LE    G L +LL +R  L E E VRFF   I G 
Sbjct: 134 HKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGA 192

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 193 IKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 252

Query: 200 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
            G    H +E D+WS GV+LYALL G+ PF  +D N   +  +++   +  P +  ISPE
Sbjct: 253 MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKYISPE 310

Query: 259 ARDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIKDSKSIRNLPREDTYLNPLDHNDGT 317
           A+ LI  +L+++P +R    EI+ +   +  +P   +S  + N+P  D  L        T
Sbjct: 311 AKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL--------T 362

Query: 318 IDQAIL 323
           ++Q+I+
Sbjct: 363 MEQSIV 368

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 157/287 (54%), Gaps = 17/287 (5%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ ++G+I A K ++K    ++ +              +  EI I
Sbjct: 80  GHFLGEGGFARCFQMKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 127

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGI 141
            K + HPN+++  D +E   ++Y++LE    G L +LL +R  L E E   F  QI+  I
Sbjct: 128 HKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQIVGAI 187

Query: 142 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIVS 200
            Y H   ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE+++
Sbjct: 188 KYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLA 247

Query: 201 G-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEA 259
           G    H +E D+WS GV++YALL G+ PF  ++ NI  +  +++SG Y  P E   S E 
Sbjct: 248 GKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPTSKEV 305

Query: 260 RDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIKDSKSIRNLPRED 305
             LI  IL+++P +R    EI+ +   +  +P+  +   + ++P  D
Sbjct: 306 MVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD 352

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  152 bits (385), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 151/273 (55%), Gaps = 23/273 (8%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER 
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQI-IKMKQIEHTND--------ERR 143

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  +KL+ HP ++RL+  ++ +++L+MV++Y+E GELF+LL +    P   A  +  +++
Sbjct: 144 M--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVV 201

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y HA  I++RDLKPEN+LLD   +IK+ADFG A   S   +  T CG+P Y APE+
Sbjct: 202 LALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFAKEVS--SVTWTLCGTPDYIAPEV 259

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           ++  PY+    D WS GV++Y +L G  PF   D        K+  GK   P      P+
Sbjct: 260 IATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFP--QGFHPD 314

Query: 259 ARDLIVQILTVEPEQRI-----KTREILKHPLL 286
             DL+ +++T +  +R+      +R++  HP  
Sbjct: 315 VIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  153 bits (387), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 94/275 (34%), Positives = 148/275 (53%), Gaps = 17/275 (6%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +  G+TLGAGS G V  A+   T +  AVK+I K                DV    +  E
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGN----------DVQLQMLYDE 96

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I++ L+HPN+++  D +E+ +  Y+V +    GELF+ +++RG   E +AV+   Q++
Sbjct: 97  LSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIIIQML 156

Query: 139 IGISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYA 194
             I Y H+  IVHRDLKPEN+L         + +ADFG+A  L+  D L+  + GS  Y 
Sbjct: 157 KAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSLGYV 216

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQSGKYEIPGE 252
           APE+++    HG   D+WS GVI Y LL G   F  E  +G +      +   K+  P  
Sbjct: 217 APEVLT-TNGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHEPYW 275

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           + +S EA++ I++ LT+ P++R    E+L  P ++
Sbjct: 276 NNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  155 bits (391), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 146/293 (49%), Gaps = 43/293 (14%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G+ LG G    V  A N ETGQIAAVK+     F+ Q       ND          E  I
Sbjct: 192 GKELGTGHYAVVKEAINKETGQIAAVKI-----FHPQ------QNDDQKKTKQFRDETKI 240

Query: 82  MKLLNHPNVLRLYD-----VWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQ 136
           +  + H N+++L D     V ++    Y+VLE +  GELF+ +V++  L ++E    F+Q
Sbjct: 241 LMRIQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAIFKQ 300

Query: 137 IIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGMAAL 177
           ++ G+ Y H+  I+HRD+KPEN+LL  +                     +K+ADFG+A  
Sbjct: 301 LLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGLAKF 360

Query: 178 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG--NI 235
             + K   T CG+P Y APE+++   Y   + D+WS GV+LY  L G  PF E+    ++
Sbjct: 361 TGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSPPSM 419

Query: 236 RNLLLKVQSGKYEI--PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           +  +L+   GKY    P  DEI   A  LI  +L V P QR    + + HP  
Sbjct: 420 KEQILQ---GKYAFYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWF 469

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 165/312 (52%), Gaps = 29/312 (9%)

Query: 10  SLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
           SL   R   +  G  LG G   +    ++ ++G+I A K ++K+   ++ +         
Sbjct: 73  SLIKTRGKDYHRGHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTR-------- 123

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                +  EI I K + HPN+++  D +E   ++Y++LE    G L  LL +R  L E E
Sbjct: 124 ---KKLLSEIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE 180

Query: 130 AVRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLE 185
            VRFF   I G I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   
Sbjct: 181 -VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY-- 237

Query: 186 TSCGSPHYAAPEIVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
           T CG+P+Y APE++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++ 
Sbjct: 238 TICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKC 295

Query: 245 GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY--PSI-----KDSKS 297
             +  P +  IS E + LI  IL+++P +R    EI+ +   +    PSI      ++ +
Sbjct: 296 RDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASN 355

Query: 298 IRNLPREDTYLN 309
             N+P E + +N
Sbjct: 356 FDNIPEEQSLIN 367

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 159/296 (53%), Gaps = 19/296 (6%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           ++ G+ LG G   +    ++ E+G+I A K ++K     + +              +  E
Sbjct: 142 YRRGQFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKTEKTR-----------RKLLSE 189

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR-QI 137
           I I K + H N+++  D +E   ++Y++L     G L  LL +R  L E E VRFF  QI
Sbjct: 190 IQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQI 248

Query: 138 IIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAP 196
              I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y AP
Sbjct: 249 CGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 308

Query: 197 EIVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255
           E++ G    H +E D+WS GV+++ALL G+ PF  +D N   +  ++++ +Y  P    I
Sbjct: 309 EVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKSI 366

Query: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQ-KYPSIKDSKSIRNLPREDTYLNP 310
           S EA+ LI  IL  +P  R    EI+++   +  +PS+  +     +P  D +L P
Sbjct: 367 SQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTP 422

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  152 bits (385), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 150/276 (54%), Gaps = 21/276 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           ++ G+TLGAGS G V  A      +  A+K++ K              D          E
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYD----------E 76

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I+K L+HPN++   + +ET   +Y+V +    GELF+ ++++G   E++AV+   QI+
Sbjct: 77  LTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQIL 136

Query: 139 IGISYCHALGIVHRDLKPENLL-LDHKFNIKL--ADFGMAA-LESKDKLLETSCGSPHYA 194
             + Y H+  IVHRDLKPENLL L  K + +L  ADFG+A  L+  ++L+  + GS  Y 
Sbjct: 137 SAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYV 196

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----P 250
           APE+++ +  HG   D+WS GVI Y LL+G   F  E   +   L +  SG Y +    P
Sbjct: 197 APEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKFHKP 253

Query: 251 GEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             D IS +A++ I++ L + P++R    E+L  P +
Sbjct: 254 YWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {ON}
           Anc_1.182 YJL164C
          Length = 424

 Score =  152 bits (385), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 145/268 (54%), Gaps = 23/268 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+K++ K +   +      +ND          E +++ 
Sbjct: 119 TLGTGSFGRVHLIRSNHNGRFYALKILKKRLI-VKLKQVEHTND----------ERLMLS 167

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           L++HP ++R++  ++ +  LYMV++YVE GELF+LL +    P   A  +  ++ + + Y
Sbjct: 168 LVSHPFIVRMWGTFQDSVHLYMVMDYVEGGELFSLLRKSQRFPNPVAKFYAAEVCLSLEY 227

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H+  I++RDLKPEN+LLD   +IKL DFG A       +  T CG+P Y APE+VS  P
Sbjct: 228 LHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 285

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS G+++Y +L G  PF   D N       + + K + P      P+ RDL+
Sbjct: 286 YNK-SVDWWSFGILIYEMLAGHTPF--YDSNTVKTYENILNAKLKFPA--FFHPDVRDLL 340

Query: 264 VQILTVEPEQRI-----KTREILKHPLL 286
            Q++T +   R+      + ++ +HP  
Sbjct: 341 SQLITKDLSNRLGNLQNGSEDVKRHPWF 368

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  152 bits (385), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 151/269 (56%), Gaps = 23/269 (8%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+N++  Q  A+K++ K             N+  +L      E+ 
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKG--------NELQML----YDELS 105

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN+++  D +E+ +  Y+V +    GELF+ ++++G   E +AV+   Q++  
Sbjct: 106 ILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTA 165

Query: 141 ISYCHALGIVHRDLKPENLL-LD--HKFNIKLADFGMA-ALESKDKLLETSCGSPHYAAP 196
           + Y H+  +VHRDLKPEN+L LD   +  + ++DFG+A  L S+ +L+  + GS  Y AP
Sbjct: 166 VEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAP 225

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGK----YEIPGE 252
           E+++    HG   D+WS GVI Y LL G  PF  E  +    L +V SG     +  P  
Sbjct: 226 EVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFIAE--STEGFLEEVFSGSDPVTFHSPYW 282

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREIL 281
           + IS EA+  I++ LT+ P +R    E+L
Sbjct: 283 NNISKEAKQFILRALTLTPARRPTAAELL 311

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  157 bits (397), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 162/302 (53%), Gaps = 22/302 (7%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ ++G+I A K ++K    ++ +              +  EI I
Sbjct: 85  GHFLGEGGFARCFQIKD-DSGKIFAAKTVAKLSIKSEKTR-----------KKLLSEIQI 132

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG- 140
            K + H NV++  D +E   ++Y++LE    G L +LL +R  L E E VRFF   I G 
Sbjct: 133 HKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQICGA 191

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 251

Query: 200 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
            G    H +E D+WS GV+LYALL G+ PF  +D N   +  +++   +  P E  IS E
Sbjct: 252 MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKHISNE 309

Query: 259 ARDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIKDSKSIRNLPREDTYLNPLDHNDGT 317
           A+ LI  +L+++P +R    EI+ +   +  +P   +S  +  +P  D     L H +  
Sbjct: 310 AKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYD---KTLTHQESI 366

Query: 318 ID 319
           I+
Sbjct: 367 IN 368

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  152 bits (385), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 148/270 (54%), Gaps = 17/270 (6%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           ++ G+TLGAGS G V  A+   + +  AVK++ K                 +    + +E
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENA----------IQLRMLYQE 80

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I+K L+H N++   + +ET   LY+V +    GELF+ ++  G   E++AV+   QI+
Sbjct: 81  LSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIVQIL 140

Query: 139 IGISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYA 194
             + Y H+  IVHRDLKPENLL    +    + +ADFG+A  L+S ++L+  + GS  Y 
Sbjct: 141 SAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSLGYV 200

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQSGKYEIPGE 252
           APE+++ +  HG   D+WS GVI Y LL G   F  E  +G +   +   Q  +++ P  
Sbjct: 201 APEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQKPYW 259

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILK 282
           D IS  A++ I++ L + PEQR    E+LK
Sbjct: 260 DNISQSAKNFILKCLDLTPEQRPTATELLK 289

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  151 bits (381), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 135/260 (51%), Gaps = 24/260 (9%)

Query: 33  VLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIE----REIIIMKLLNHP 88
           V   ++ +TG I A+K + K                +++ Y +E    RE+ I   L HP
Sbjct: 154 VYCVKHKQTGFICALKAMKKK---------------EIIQYNVEKQFRREVEIQSSLKHP 198

Query: 89  NVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALG 148
           N+ RLY  +   + +Y+++EY+  GEL+  L   GP  +  A  F  Q+   + Y H+  
Sbjct: 199 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKH 258

Query: 149 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 208
           I+HRD+KPEN+LL  +  +KL DFG +     +    T CG+  Y +PE++    Y   +
Sbjct: 259 IIHRDIKPENILLGFQNTLKLTDFGWSVTNLNNSRRRTLCGTMDYLSPELIKSREYDN-K 317

Query: 209 SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILT 268
            DVW+ GV+ Y LL G  PF E+   +    +K +  K+     D IS +ARD+I ++L 
Sbjct: 318 VDVWALGVLTYELLVGTPPFLEDSKEMTYKRIKRRDLKF----PDHISSQARDIISKLLE 373

Query: 269 VEPEQRIKTREILKHPLLQK 288
            EP  RI  R++ KHP + K
Sbjct: 374 YEPNARIALRDVKKHPWILK 393

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 145/272 (53%), Gaps = 17/272 (6%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+   T +  AVK++ K              D          E+ 
Sbjct: 34  FGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALEGNSVQLQMLYD----------ELS 83

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ LNHPN++   D +ET +  ++V +    GELF+ +V++G   E +A++   QI+  
Sbjct: 84  ILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTEEDAIKILVQILGA 143

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYAAP 196
           + Y H+  IVHRDLKPENLL   + +   + LADFG+A  L+S D+L+  + GS  Y AP
Sbjct: 144 VEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDELIFKAAGSLGYVAP 203

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEE--DGNIRNLLLKVQSGKYEIPGEDE 254
           E+++    HG   D+WS GVI Y LL G   F  E  +G +       +   +  P  D 
Sbjct: 204 EVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQNDKPVVFHKPYWDN 262

Query: 255 ISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           +S +AR  I++ LT++P +R     +L+ P +
Sbjct: 263 VSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  150 bits (379), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 150/273 (54%), Gaps = 23/273 (8%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER 
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VKMKQVEHTND--------ERR 120

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  +KL+ HP ++R++  ++ A++++MV++Y+E GELF+LL +    P   A  +  ++I
Sbjct: 121 M--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVI 178

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y HA  I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+
Sbjct: 179 LALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEV 236

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           ++  PY+    D WS GV++Y +L G  PF   D        K+  GK   P      P+
Sbjct: 237 ITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYP--PYFHPD 291

Query: 259 ARDLIVQILTVEPEQRI-----KTREILKHPLL 286
             DL+ +++T +  +RI      +R+I  HP  
Sbjct: 292 VVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/315 (33%), Positives = 167/315 (53%), Gaps = 29/315 (9%)

Query: 10  SLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
           SL   R   +  G  LG G   +    ++ ++G+I A K ++K+   ++ +         
Sbjct: 73  SLIKTRGKDYHRGHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTR-------- 123

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                +  EI I K ++HPN+++  D +E   ++Y++LE    G L  LL +R  L E E
Sbjct: 124 ---KKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE 180

Query: 130 AVRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLE 185
            VRFF   I G I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   
Sbjct: 181 -VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY-- 237

Query: 186 TSCGSPHYAAPEIVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
           T CG+P+Y APE++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++ 
Sbjct: 238 TICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKC 295

Query: 245 GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY--PSI-----KDSKS 297
             +  P +  IS E + LI  IL+++P +R    EI+ +   +    PSI      ++ +
Sbjct: 296 RDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPN 355

Query: 298 IRNLPREDTYLNPLD 312
             ++P E + +N  D
Sbjct: 356 FEDIPEEQSLVNFKD 370

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  150 bits (378), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 150/273 (54%), Gaps = 23/273 (8%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER 
Sbjct: 72  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VKMKQVEHTND--------ERR 122

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  +KL+ HP ++R++  ++ A++++MV++Y+E GELF+LL +    P   A  +  ++I
Sbjct: 123 M--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVI 180

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y HA  I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+
Sbjct: 181 LALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEV 238

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           ++  PY+    D WS GV++Y +L G  PF   D        K+  GK   P      P+
Sbjct: 239 ITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYFHPD 293

Query: 259 ARDLIVQILTVEPEQRI-----KTREILKHPLL 286
             DL+ +++T +  +RI      +R+I  HP  
Sbjct: 294 VVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 148/270 (54%), Gaps = 23/270 (8%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G+TLGAG+ G V  A+N+   +  AVK++ K              D   + Y    E++
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALKG---------DELNMLYD---ELM 103

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HP++++  D +E+    Y+V +    GELF+ ++++G   E +AV+   Q++  
Sbjct: 104 ILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQMLEA 163

Query: 141 ISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMA-ALESKDKLLETSCGSPHYAAP 196
           I Y H+  +VHRDLKPEN+L         + ++DFG+A  L S+D L+  + GS  Y AP
Sbjct: 164 IEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGYVAP 223

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI----PGE 252
           E+++    HG   D+WS GVI Y LL G  PF  E       L +V   KY +    P  
Sbjct: 224 EVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFVAESS--EGFLEEVTRSKYPVTFHKPYW 280

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILK 282
           + IS EA++ I++ LT++P +R    E+L+
Sbjct: 281 NSISVEAKEFILKALTLDPSERPTATELLQ 310

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  157 bits (397), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 150/279 (53%), Gaps = 30/279 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+ISK          +G+ D      G+ RE+ ++
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKR-------KVMGNMD------GVTRELEVL 247

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP ++RL   +E  +  Y+++E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 248 RKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 307

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H+  I HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APEI+S
Sbjct: 308 YIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEIIS 367

Query: 201 G---------LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-EI 249
           G            +    D+WS G ++Y +LTG LPF    G+ +  L K V++G Y E 
Sbjct: 368 GSNNLEENEERNEYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGSYHEG 424

Query: 250 PGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           P +D  IS EAR+ I  +L V P  R+     L+HP ++
Sbjct: 425 PLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  153 bits (386), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 149/294 (50%), Gaps = 39/294 (13%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           + LG+ LGAG    V  A+N +TGQ  AVK+     F+AQ       ND          E
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 248

Query: 79  IIIMKLLNHPNVLRLYDVW-----ETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
             I+  + HPN++ L D +     ++    Y+VLE ++ GELF  +V++  L ++E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGM 174
           F+Q++ G+ Y H   I+HRD+KPEN+LL+                       +K+ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG- 233
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF ++ G 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 427

Query: 234 -NIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
            +++  +L+ +   Y  P  D+I      LI  +L + P++R    E L HP  
Sbjct: 428 PSLKEQILQAKYAFYS-PYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 142/260 (54%), Gaps = 24/260 (9%)

Query: 33  VLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIER----EIIIMKLLNHP 88
           V   ++ E+G I A+K + KS               +++ Y ++R    E+ I   LNHP
Sbjct: 168 VYCVKHKESGFICALKAMDKS---------------EIIQYNLQRQFRREVEIQTSLNHP 212

Query: 89  NVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALG 148
           N+ +LY  +   + +Y+++EY+  GEL+ LL   GP  +  A RF  QI   +++ H  G
Sbjct: 213 NLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFVYQIADALNHLHEKG 272

Query: 149 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 208
           I+HRDLKPEN+L+     +KL DFG + +  K    +T CG+  Y +PE++    Y    
Sbjct: 273 IIHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYLSPEMIRSREYDD-T 331

Query: 209 SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILT 268
            DVW+ GV+ Y L+ G  PF+E+   +     ++  G+   PG   +S + RDLI ++L 
Sbjct: 332 VDVWALGVLTYELVAGDPPFEEDSKEL--TYKRILKGEIRFPG--TVSQDVRDLISRLLK 387

Query: 269 VEPEQRIKTREILKHPLLQK 288
            +P++RI  +E++ HP + +
Sbjct: 388 NDPKERILLKEVMVHPWIMR 407

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 149/284 (52%), Gaps = 30/284 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+I+K          +G+ D      G+ RE+ ++
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKR-------KVMGNVD------GVTRELEVL 267

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + LNHP ++ L   +E  +  Y+++E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H  GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIG 387

Query: 201 GLPYHGFES---------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-EI 249
           G    G  +         D+WS G ++Y +LTG LPF    G+ +  L K + +G Y E 
Sbjct: 388 GKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYHEG 444

Query: 250 PGEDE-ISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSI 292
           P +D  IS EARD I  +L + P  R+     L+HP L    SI
Sbjct: 445 PLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  157 bits (397), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 149/280 (53%), Gaps = 33/280 (11%)

Query: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75
           +G +++ + +G GS GKV LA +  T +   +K   K             NDP+++    
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLKTSDK-------------NDPNIV---- 80

Query: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135
            RE+   +  ++P + ++Y++  T   ++M LEY    EL++ L+    +P  E    F 
Sbjct: 81  -REVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTELFA 139

Query: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195
           QI+  + Y H+L  VHRDLK EN+LLD     KL DFG          LET CG+  Y A
Sbjct: 140 QIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVYMA 199

Query: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE- 254
           PE++    Y GF+ D+W+ GVILY ++ G +PFDE+D        +V++ K++I  ED  
Sbjct: 200 PELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD--------EVKT-KWKIVNEDPD 250

Query: 255 -----ISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289
                 S + +DLI ++L  +P +R   REILKH  L+ Y
Sbjct: 251 FTNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPY 290

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  149 bits (377), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 150/273 (54%), Gaps = 23/273 (8%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER 
Sbjct: 71  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VKMKQVEHTND--------ERR 121

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  +KL+ HP ++R++  ++ A++++MV++Y+E GELF+LL +    P   A  +  ++I
Sbjct: 122 M--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVI 179

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y HA  I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+
Sbjct: 180 LALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEV 237

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           ++  PY+    D WS GV++Y +L G  PF   D        K+  GK   P      P+
Sbjct: 238 ITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYFHPD 292

Query: 259 ARDLIVQILTVEPEQRI-----KTREILKHPLL 286
             DL+ +++T +  +RI      +R+I  HP  
Sbjct: 293 VVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  149 bits (375), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/258 (33%), Positives = 142/258 (55%), Gaps = 24/258 (9%)

Query: 33  VLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIE----REIIIMKLLNHP 88
           V   ++ ETG I A+KV+ K+               +++ Y ++    RE+ I   LNHP
Sbjct: 105 VYCVRHKETGFICALKVMDKA---------------EIVQYNLQKQFRREVEIQTSLNHP 149

Query: 89  NVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALG 148
           N+ +LY  +   + +Y+++EY+  GEL+ LL   GP  +  A RF  QI   ++Y H   
Sbjct: 150 NLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQ 209

Query: 149 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 208
           I+HRDLKPEN+L+     IKL DFG + +  +    +T CG+  Y +PE++    Y   +
Sbjct: 210 IIHRDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-K 268

Query: 209 SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILT 268
            DVW+ GV+ Y L+ G  PF+E+    + L  K +  K +I   + +S + +DLI ++L 
Sbjct: 269 VDVWALGVLTYELIVGSPPFEED---TKELTYK-RILKNDIKFPETVSHDVKDLISKLLK 324

Query: 269 VEPEQRIKTREILKHPLL 286
             P +RI  R+++KHP +
Sbjct: 325 YNPSERISMRDVMKHPWI 342

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 152/279 (54%), Gaps = 22/279 (7%)

Query: 10  SLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
           SL   R   +  G  LG G   +    ++ ++G+I A K ++K+   ++ +         
Sbjct: 73  SLIKTRGKDYHRGHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTR-------- 123

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                +  EI I K ++HPN+++  D +E   ++Y++LE    G L  LL +R  L E E
Sbjct: 124 ---KKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE 180

Query: 130 AVRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLE 185
            VRFF   I G I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   
Sbjct: 181 -VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY-- 237

Query: 186 TSCGSPHYAAPEIVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
           T CG+P+Y APE++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++ 
Sbjct: 238 TICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKC 295

Query: 245 GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283
             +  P +  IS E + LI  IL+++P +R    EI+ +
Sbjct: 296 RDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 154/279 (55%), Gaps = 20/279 (7%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ ++G+I A K ++K    ++ +              +  EI I
Sbjct: 98  GHFLGEGGFARCFQIRD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 145

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG- 140
            K + H N+++  D +E   ++Y++LE    G L +LL +R  L E E VRFF   I G 
Sbjct: 146 HKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGA 204

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           I Y H+  ++HRDLK  N+  D K+N+K+ DFG+AA  + D+  + T CG+P+Y APE++
Sbjct: 205 IKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIAPEVL 264

Query: 200 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
            G    H +E D+WS GV++YAL+ GR PF  +D N   +  +++   +  P +  IS E
Sbjct: 265 MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKLISSE 322

Query: 259 ARDLIVQILTVEPEQRIKTREILKHPLLQKY--PSIKDS 295
           A+ LI  IL+++P +R    EI+ +   +    PS K+S
Sbjct: 323 AKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKES 361

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score =  149 bits (375), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 143/285 (50%), Gaps = 38/285 (13%)

Query: 15  RIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYG 74
           ++  +++G+ LG G  GKV   ++  +G I A+K + K                +++ Y 
Sbjct: 104 KLADFEMGKILGKGKFGKVYCVRHIPSGFICALKAMEKK---------------EIIQYN 148

Query: 75  IE----REIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA 130
           IE    RE+ I   L HPN+ +LY  +   + +Y+V+EY+  GEL+  L  R    +  A
Sbjct: 149 IEKQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLVMEYLVNGELYKHLKGRNHFSDEVA 208

Query: 131 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGS 190
             +  Q+   + Y H   I+HRD+KPEN+++     IKL DFG + + SK    +T CG+
Sbjct: 209 SYYVYQMAGALDYMHERNILHRDIKPENIIIGFNNVIKLTDFGWSVINSKGFKRKTLCGT 268

Query: 191 PHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNI-------RNLLLKVQ 243
             Y +PE++    Y   + DVW+ GV+ Y LL G  PF+EE   +       RNL+    
Sbjct: 269 VDYLSPELIKSREYDE-KVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLVF--- 324

Query: 244 SGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK 288
                    D I P+AR LI ++L  +P  RI  +++  H  + K
Sbjct: 325 --------PDHIDPDARHLISRLLEYDPANRIALKDVRGHSWILK 361

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 164/315 (52%), Gaps = 29/315 (9%)

Query: 10  SLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPD 69
           SL   R   +  G  LG G   +    ++ ++G I A K ++K+   ++ +         
Sbjct: 73  SLIKTRGKDYHRGHFLGEGGFARCFQIKD-DSGDIFAAKTVAKASIKSEKTR-------- 123

Query: 70  VLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENE 129
                +  EI I K + HPN+++  D +E   ++Y++LE    G L  LL +R  L E E
Sbjct: 124 ---KKLLSEIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE 180

Query: 130 AVRFFRQIIIG-ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLE 185
            VRFF   I G I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   
Sbjct: 181 -VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY-- 237

Query: 186 TSCGSPHYAAPEIVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244
           T CG+P+Y APE++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++ 
Sbjct: 238 TICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKC 295

Query: 245 GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY--PSIKDS-----KS 297
             +  P +  IS E + LI  IL+++P +R    EI+ +   +    PSI  +      +
Sbjct: 296 RDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVPN 355

Query: 298 IRNLPREDTYLNPLD 312
             N+P E + +N  D
Sbjct: 356 FGNIPEEQSLVNFKD 370

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  155 bits (393), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 150/291 (51%), Gaps = 31/291 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+ISK          +G+ +      G+ RE+ ++
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKR-------KVMGNME------GVSRELEVL 245

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP ++RL   +E     YMV+E+V  G+L + +   G + E       RQI+  + 
Sbjct: 246 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 305

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 306 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIG 365

Query: 201 GLPYHGFES-------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-EIPG 251
           G      E        D+WS G ++Y +LTG LPF    G+ +  L K +  G Y E P 
Sbjct: 366 GKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEGPL 422

Query: 252 ED-EISPEARDLIVQILTVEPEQRIKTREILKHPLL---QKYPSIKDSKSI 298
           +D  IS EAR  I  +L V P  R+     L+HP +   Q   S K++  I
Sbjct: 423 KDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIKMAQYSQSFKEASQI 473

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  155 bits (393), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 149/280 (53%), Gaps = 32/280 (11%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+I+K          +G+ D      G+ RE+ ++
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKR-------KVMGNMD------GVTRELDVL 243

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP ++RL   +E     Y+++E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 244 RKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 303

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H  GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 304 YIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 363

Query: 201 G----------LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK-VQSGKY-E 248
           G          + Y     D+WS G ++Y +LTG LPF    G+ ++ L K +  G Y E
Sbjct: 364 GKNSAEENEDRIEYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYHE 419

Query: 249 IPGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
            P +D  IS EARD I  +L V P +R+   + L HP ++
Sbjct: 420 GPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  152 bits (383), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 142/291 (48%), Gaps = 39/291 (13%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G+ LG G    V  A+N ETG+  AVK+     F+ Q       ND D        E  I
Sbjct: 201 GKELGTGHYAIVKEARNKETGETVAVKI-----FHPQ------QNDDDKRTKKFTEETKI 249

Query: 82  MKLLNHPNVLRLYD-----VWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQ 136
           +  + HPN+++L D     V +T    Y+VLE +  GELF  +V++  L E+E    FRQ
Sbjct: 250 LLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFRQ 309

Query: 137 IIIGISYCHALGIVHRDLKPENLLL-----------------DHKFNI--KLADFGMAAL 177
           ++ G+ Y H+  I+HRD+KPEN+LL                 D + +I  K+ADFG+A  
Sbjct: 310 LLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKF 369

Query: 178 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG--NI 235
             + K   T CG+P Y APE++    Y     D+WS GV+LY  L G  PF E+    ++
Sbjct: 370 TGEMKFTNTLCGTPSYVAPEVLVKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAPPSM 428

Query: 236 RNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           +  +L+ +   Y  P  D I      LI  +L V P  R    + L HP  
Sbjct: 429 KEQILQGKFAFYS-PYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  150 bits (378), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 149/278 (53%), Gaps = 21/278 (7%)

Query: 17  GPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIE 76
           G +  G+TLGAG+ G V  A+   T +  AVK+I K                D+    + 
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKALKGN----------DIQLQMLY 86

Query: 77  REIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQ 136
            E+ I++ L+HPN++   D +E+    Y+V +    GELF+ ++ +G   E +AV+   Q
Sbjct: 87  DELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKIVVQ 146

Query: 137 IIIGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPH 192
           I+  I Y H+  +VHRDLKPEN+L     +   I +ADFG+A  L++K+ L+  + GS  
Sbjct: 147 ILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAGSLG 206

Query: 193 YAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI--- 249
           Y APE+++    HG   D+WS GVI Y LL G   F  E   +   L +    K+ +   
Sbjct: 207 YVAPEVLTE-GGHGKPCDIWSLGVITYTLLCGYSAFIAE--TVEGFLEECTRSKFPVKFH 263

Query: 250 -PGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
            P  D IS EA++ I++ LT+ P++R    E+L+ P +
Sbjct: 264 KPYWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/298 (31%), Positives = 158/298 (53%), Gaps = 24/298 (8%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ E+G+I A K ++K    ++ +              +  EI I
Sbjct: 94  GHFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 141

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGI 141
            K + H NV++  D +E   ++Y++LE    G L  LL +R  + E E   F  QI   I
Sbjct: 142 HKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQICGAI 201

Query: 142 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIVS 200
            Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++ 
Sbjct: 202 KYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLM 261

Query: 201 G-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEA 259
           G    H +E D+WS GV++YALL G+ PF  +D N+  +  ++++  +  P +  IS EA
Sbjct: 262 GKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYISNEA 319

Query: 260 RDLIVQILTVEPEQRIKTREILKHPLLQK-YPSIKDSKSIRNLPR-------EDTYLN 309
           + LI  IL+ +P +R    EI+ +   +  +PS   S  +   P        E++Y+N
Sbjct: 320 KTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQIISAEESYIN 377

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  155 bits (391), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 147/265 (55%), Gaps = 18/265 (6%)

Query: 22  GETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIII 81
           G  LG G   +    ++ ++G+I A K ++K     + +              +  EI I
Sbjct: 104 GHFLGEGGFARCFQIKD-DSGKIFAAKTVAKLSIKTEKTR-----------KKLLSEIQI 151

Query: 82  MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR-QIIIG 140
            K + H N+++  D +E   ++Y++LE    G L  LL +R  L E E VRFF  QI  G
Sbjct: 152 HKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQICGG 210

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 199
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 211 IKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 270

Query: 200 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
            G    H +E D+WS GV++YALL G+ PF  +D N   +  +++   +  P E  IS E
Sbjct: 271 MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKYISSE 328

Query: 259 ARDLIVQILTVEPEQRIKTREILKH 283
           AR L+  +L+++P +R    E+L +
Sbjct: 329 ARILVQDLLSLDPLERPSIMEVLDY 353

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  151 bits (382), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 96/303 (31%), Positives = 156/303 (51%), Gaps = 42/303 (13%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           + LG+ LGAG    V  A+N +TGQ  AVK+     F+AQ       ND          E
Sbjct: 201 YLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 249

Query: 79  IIIMKLLNHPNVLRLYDVW-----ETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
             I+  ++HPN++ L D +     ++    Y+VLE ++ GELF  +V++  L ++E+   
Sbjct: 250 TNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLGQDESRAL 309

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGM 174
           F+Q++ G+ Y H   I+HRD+KPEN+LL+                       +K+ADFG+
Sbjct: 310 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQVQLGPWDEDEIDIQVKIADFGL 369

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG- 233
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF ++ G 
Sbjct: 370 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 428

Query: 234 -NIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPL---LQKY 289
            +++  +++ +   Y  P  D+I      LI  +L + P++R    E + HP    L+K+
Sbjct: 429 PSLKEQIMQAKYAFYS-PYWDKIDDSVLHLISNLLVLNPDERYNIDEAMNHPWFKDLKKH 487

Query: 290 PSI 292
            S+
Sbjct: 488 NSV 490

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  150 bits (380), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 145/276 (52%), Gaps = 21/276 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +  G TLGAG+ G V  A+   T Q  AVK++ K                DV    +  E
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKALKGN----------DVQLQMLYDE 108

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           + I++ L HPN++R  D +E+    Y+V +    GELF+ ++ +G   E +AV+   Q++
Sbjct: 109 LSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVVQML 168

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 194
             + Y H+  IVHRDLKPEN+L     +   + +ADFG+A  L + D+L+  + GS  Y 
Sbjct: 169 NAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSLGYV 228

Query: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254
           APE+++    HG   D+WS GVI Y LL G  PF  E  ++   L +V   +Y +   ++
Sbjct: 229 APEVLT-TNGHGKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKFHEQ 285

Query: 255 ----ISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
               IS EAR  I++ L + P+ R    E+L  P +
Sbjct: 286 YWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  148 bits (374), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 90/273 (32%), Positives = 149/273 (54%), Gaps = 23/273 (8%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER 
Sbjct: 73  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQI-VKMKQVEHTND--------ERR 123

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  +KL+ HP ++R++  ++ A++++MV++Y+E GELF+LL +    P   A  +  ++I
Sbjct: 124 M--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVI 181

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y H   I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+
Sbjct: 182 LALEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEV 239

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           ++  PY+    D WS GV++Y +L G  PF   D        K+  GK   P      P+
Sbjct: 240 ITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYFHPD 294

Query: 259 ARDLIVQILTVEPEQRI-----KTREILKHPLL 286
             DL+ +++T +  +RI      +R+I  HP  
Sbjct: 295 VVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  154 bits (390), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 143/253 (56%), Gaps = 18/253 (7%)

Query: 25  LGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMKL 84
           LG G   +    ++ E+G+I A K ++K    ++ +              +  EI I K 
Sbjct: 101 LGEGGFARCFQIKD-ESGKIFAAKTVAKISIKSEKTK-----------RKLLSEIQIHKS 148

Query: 85  LNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG-ISY 143
           + H N+++  D +E   ++Y++LE    G L +LL +R  L E E VRFF   I G I Y
Sbjct: 149 MKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGAIKY 207

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIVSG- 201
            H+  I+HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++ G 
Sbjct: 208 LHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMGK 267

Query: 202 LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARD 261
              H FE D+WS GV++YALL G+ PF  +D N+  +  +++  KY  P +  +S EA  
Sbjct: 268 HSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKYVSKEAEI 325

Query: 262 LIVQILTVEPEQR 274
           LI  IL++ P QR
Sbjct: 326 LIHDILSLNPLQR 338

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  155 bits (392), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 115/186 (61%), Gaps = 4/186 (2%)

Query: 103 LYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLD 162
            YM+ EYV  G+L + ++Q G L E  A +F R I   + Y H   IVHRDLK EN+++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 163 HKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALL 222
               IK+ DFG++ + +  K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+
Sbjct: 68  TSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVLV 127

Query: 223 TGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282
            G++PFD+E+ ++  L  K++ GK E P    +S E   L+ ++L V+P +R   ++++ 
Sbjct: 128 CGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQVVN 183

Query: 283 HPLLQK 288
           H  +Q+
Sbjct: 184 HQWMQR 189

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  154 bits (390), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 147/277 (53%), Gaps = 27/277 (9%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  A K+ISK          +G+ D      G++RE+ ++
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKR-------KLMGNWD------GVDRELAVL 236

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP ++RL   +E  +  Y+++E+V  G+L + +   G + E+      RQ++  ++
Sbjct: 237 RKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVA 296

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 297 YIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 356

Query: 201 GLPYHGFES--------DVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKY-EIPG 251
           G   +  E         D+WS G ++Y +LTG LPF         L  ++  G Y E P 
Sbjct: 357 GKNDNTEEEKNEYSSLVDMWSMGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYHEGPL 414

Query: 252 ED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           +D  IS EARD I  +L V P  R    + L+HP ++
Sbjct: 415 KDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  155 bits (392), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 89/279 (31%), Positives = 146/279 (52%), Gaps = 30/279 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A    TG+  AVK+I+K       S             G+ RE+ I+
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKRKVMGNLS-------------GVTRELEIL 247

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
           + L+HP ++RL   +E  +  Y+V+E+V  G+L + +   G + E+      RQI+  ++
Sbjct: 248 RKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVA 307

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H  GI HRD+KP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 308 YMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIS 367

Query: 201 G----------LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKY-EI 249
           G          + Y     D+WS G ++Y +LT  LPF       + L  ++  G Y E 
Sbjct: 368 GKNAATENDDRIEYSSL-VDMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYHEG 424

Query: 250 PGED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
           P +D  +S EARD I  ++ V+P  R+  ++ LKH  ++
Sbjct: 425 PLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  147 bits (371), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 148/268 (55%), Gaps = 23/268 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER +  +K
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV-IRMKQIEHTND--------ERRM--LK 96

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           L++HP ++R++  ++ +++L+MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 97  LVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 156

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            HA  I++RDLKPEN+LLD   +IK+ DFG A  +  D +  T CG+P Y APE+++  P
Sbjct: 157 LHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATKP 214

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS G++++ +L G  PF   D        K+  GK   P      P+  DL+
Sbjct: 215 YNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDLL 269

Query: 264 VQILTVEPEQRIKT-----REILKHPLL 286
            +++T +  +R+       +++  HP  
Sbjct: 270 SKLITADLTRRLGNLQSGPQDVKSHPWF 297

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 155/300 (51%), Gaps = 29/300 (9%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G TLGAGS G V  A+   T +  A+K++ K           G+N    + Y    E+ 
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-------GNNVQLQMLY---EELS 98

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y+V +    GELF+ ++ RG   E +AV    QI+  
Sbjct: 99  ILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILGA 158

Query: 141 ISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMA-ALESKDKLLETSCGSPHYAAP 196
           + Y H+  +VHRDLKPEN+L +D   N  + +ADFG+A  L+ K+ L+  + GS  Y AP
Sbjct: 159 VEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAP 218

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKY----EIPGE 252
           E+++    HG   D+WS GVI Y LL G  PF  E  ++   + +  + +Y     IP  
Sbjct: 219 EVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTFHIPYW 275

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK--------YPSIKDSKSIRNLPRE 304
           D IS +A+  I++ L + P +R    E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISIDAKRFILKALRLNPTERPTATELLDDPWITSKRIGTSNILPDVKKGFSLRKKLRD 335

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  146 bits (369), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 148/268 (55%), Gaps = 23/268 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER +  +K
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV-IRMKQIEHTND--------ERRM--LK 96

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           L++HP ++R++  ++ +++L+MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 97  LVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 156

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H+  I++RDLKPEN+LLD   +IK+ DFG A  +  D +  T CG+P Y APE+++  P
Sbjct: 157 LHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATKP 214

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS G++++ +L G  PF   D        K+  GK   P      P+  DL+
Sbjct: 215 YNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDLL 269

Query: 264 VQILTVEPEQRIKT-----REILKHPLL 286
            +++T +  +R+       +++  HP  
Sbjct: 270 CKLITSDLTRRLGNLQSGPQDVKSHPWF 297

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 140/260 (53%), Gaps = 24/260 (9%)

Query: 33  VLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIE----REIIIMKLLNHP 88
           V   ++ ++G I A+K + K+               +++ Y ++    REI I  +LNHP
Sbjct: 116 VYCVKHKKSGFICALKAMEKN---------------EIIQYNLQKQVRREIEIQTILNHP 160

Query: 89  NVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALG 148
           N+ +LY  +   + +Y+V+EY+ +GEL+ LL   GP  +  A  +  QI   + Y H   
Sbjct: 161 NLTKLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYVYQIADALDYLHQKH 220

Query: 149 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 208
           I+HRD+KPEN+L+     +KL DFG + +  K    +T CG+  Y +PEI++   Y    
Sbjct: 221 IIHRDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYLSPEIITSKEY-DHT 279

Query: 209 SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILT 268
            D+W+ GV+ Y L+ G   F+EE   +     ++  G+ + P  + +    RDLI +IL 
Sbjct: 280 VDIWALGVLAYELVVGSPAFEEETKEMT--YKRIVKGELKFP--EHLPNIVRDLIQRILV 335

Query: 269 VEPEQRIKTREILKHPLLQK 288
           +EP +R+  +EI +HP + K
Sbjct: 336 IEPSKRMSLKEIKRHPWILK 355

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 151/273 (55%), Gaps = 23/273 (8%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KV+ K+    +      +ND        ER 
Sbjct: 84  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKTQV-VRMKQIEHTND--------ERR 134

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  +KL+ HP ++R++  ++ A +L+MV++Y+E GELF+LL +    P   A  +  +++
Sbjct: 135 M--LKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVV 192

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y H   I++RDLKPEN+LLD   +IK+ DFG A  +  + +  T CG+P Y APE+
Sbjct: 193 LALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVESVTWTLCGTPDYIAPEV 250

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           ++  PY+    D WS G++++ +L G  PF   D        K+  GK   P      P+
Sbjct: 251 IATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYP--PFFHPD 305

Query: 259 ARDLIVQILTVEPEQRI-----KTREILKHPLL 286
             DL+ +++T +  +RI      +++I +HP  
Sbjct: 306 VVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  149 bits (375), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 153/300 (51%), Gaps = 29/300 (9%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G TLGAGS G V  A+   T +  A+K++ K           G+N    + Y    E+ 
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-------GNNIQLQMLY---EELS 98

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y+V +    GELF+ ++ RG   E +AV    QI+  
Sbjct: 99  ILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQILGA 158

Query: 141 ISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPHYAAP 196
           + Y H+  +VHRDLKPEN+L   K +   + +ADFG+A  L+ K+ L+  + GS  Y AP
Sbjct: 159 VEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAP 218

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKY----EIPGE 252
           E+++    HG   D+WS GVI Y LL G  PF  E  ++   + +  + +Y     +P  
Sbjct: 219 EVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAE--SVEGFMEECTASRYPVTFHMPYW 275

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQK--------YPSIKDSKSIRNLPRE 304
           D IS +A+  I++ L + P  R    E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISVDAKRFILKALILNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 149/267 (55%), Gaps = 16/267 (5%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +  G+ LG G   +    ++ ++G+I A K ++K    ++ +              +  E
Sbjct: 81  YHRGQFLGEGGFARCFQIKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSE 128

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           I I K ++H N+++  D +E   ++Y++LE    G L  L+ +R  + E E   F  QI 
Sbjct: 129 IQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQIC 188

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPE 197
            GI Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE
Sbjct: 189 GGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPE 248

Query: 198 IVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEIS 256
           ++ G    H +E D+WS GV+LYALL G+ PF  +D N   +  +++   +  P + +IS
Sbjct: 249 VLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKIS 306

Query: 257 PEARDLIVQILTVEPEQRIKTREILKH 283
            +A+ LI  IL++ P +R   +EI+ +
Sbjct: 307 QDAKYLIDDILSLNPMERPSIQEIMDY 333

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 147/268 (54%), Gaps = 23/268 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER +  +K
Sbjct: 49  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VRMKQIEHTND--------ERRM--LK 97

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           L+ HP ++R++  ++ +++L+MV++Y+E GELF+LL +    P   A  +  ++ +G+ Y
Sbjct: 98  LVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEY 157

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H+  I++RDLKPEN+LLD   +IK+ DFG A  +  D +  T CG P Y APE+++  P
Sbjct: 158 LHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGPPDYIAPEVIATKP 215

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS GV+++ +L G  PF   D        K+  GK   P      P+  DL+
Sbjct: 216 YNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYP--TFFHPDVVDLL 270

Query: 264 VQILTVEPEQRI-----KTREILKHPLL 286
            +++T +  +RI      +++I  HP  
Sbjct: 271 GKLITADLTRRIGNLQSGSKDIKCHPWF 298

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K +   +      +ND          E +++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-VRLKQVEHTND----------ERLMLS 140

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           ++ HP ++R++  ++ AQ ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H+  I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 258

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS G+++Y +L G  PF   D N      K+ + +   P     + + +DL+
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLL 313

Query: 264 VQILTVEPEQRI-----KTREILKHPLLQK 288
            +++T +  QR+      T ++  HP  ++
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 160/302 (52%), Gaps = 27/302 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER +  + 
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTI-VKLKQVEHTND--------ERRM--LS 161

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           +++HP  +R++  ++ AQ ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 162 VVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 221

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H++ I++RDLKPEN+LLD   +IKL DFG A  +    +  T CG+P Y APE+VS  P
Sbjct: 222 LHSMDIIYRDLKPENILLDKNGHIKLTDFGFA--KYVPDVTYTLCGTPDYIAPEVVSTKP 279

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS G++++ +L G  PF   D N       + + + + P      P+A+DL+
Sbjct: 280 YNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFPS--IFHPDAQDLL 334

Query: 264 VQILTVEPEQRI-----KTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHNDGTI 318
            +++T +  +R+      + ++ +HP   +   + D    RN+  E  Y  P+    G  
Sbjct: 335 CRLITRDLSKRLGNLQNGSEDVKRHPWFSE--VVWDKLLCRNI--ETPYEPPIQPGQGDT 390

Query: 319 DQ 320
            Q
Sbjct: 391 SQ 392

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  149 bits (376), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 150/295 (50%), Gaps = 39/295 (13%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           + LG+ LG+G    V  A+N +TGQ  AVK+     F+AQ       ND          E
Sbjct: 200 YLLGKELGSGHYALVKEAKNKKTGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 248

Query: 79  IIIMKLLNHPNVLRLYDVW-----ETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
             I+  + HPN++ L D +     ++    Y+VLE ++ GELF  +V++  L ++E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGM 174
           F+Q++ G+ Y H   I+HRD+KPEN+LL+                       +K+ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG- 233
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF ++ G 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 427

Query: 234 -NIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
            +++  +L+ +   Y  P  D+I      LI  +L + P++R    + + HP  +
Sbjct: 428 PSLKEQILQAKYAFYS-PYWDKIDDSVLHLISNLLVLNPDERYNIDDAMNHPWFK 481

>KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 aa]
           {ON} 
          Length = 511

 Score =  149 bits (376), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 144/294 (48%), Gaps = 39/294 (13%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           + LG  LG+G    V   +N +TGQ  AVK+     F+ Q       ND          E
Sbjct: 197 YTLGRELGSGHYAIVKEGKNKQTGQTVAVKI-----FHPQ------QNDDQKKSKQFREE 245

Query: 79  IIIMKLLNHPNVLRLYDVW-----ETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
             I+  ++HPN++ L D +     +     Y+VLE ++ GELF+ +V++  L ++E    
Sbjct: 246 TNILMRIHHPNIVNLLDSFVEPISKQQTQKYLVLEKIDNGELFDRIVKKTCLRQDETKAI 305

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLL--------DHK-----------FNIKLADFGM 174
           F QI+ G+ Y H   I+HRD+KPEN+LL        D K             +K+ADFG+
Sbjct: 306 FTQILHGLKYLHGQNIIHRDIKPENILLNITKRTSPDQKQLGPWDDDEIDVQVKIADFGL 365

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG- 233
           A    + +   T CG+P Y APE++    Y   + D+WS GVILY  L G  PF ++ G 
Sbjct: 366 AKFTGEMQFTNTLCGTPSYVAPEVLIKKGYTS-KVDMWSSGVILYVCLCGFPPFSDQLGP 424

Query: 234 -NIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
             ++  +L+ +   Y  P  D I      LI  +L ++PEQR    +   HP L
Sbjct: 425 PALKEQILQAKFAFYT-PYWDNIDDSILHLISHLLVLDPEQRYSVSDAFNHPWL 477

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  153 bits (386), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 147/278 (52%), Gaps = 28/278 (10%)

Query: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82
           E +G G+   V  A   +TG+  AVK+ISK          +G+ +      G+ RE+ ++
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKR-------KVMGNVE------GVTRELEVL 240

Query: 83  KLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGIS 142
             LNHP ++ L   +E  +  Y+++E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 241 HRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 300

Query: 143 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 200
           Y H   I HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 301 YIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVID 360

Query: 201 G-------LPYHGFES--DVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKY-EIP 250
           G       +  + + S  D+WS G ++Y +LTG LPF         L  ++  G Y E P
Sbjct: 361 GKSLEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYHEGP 418

Query: 251 GED-EISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
            +D +IS EARD I  +L V P  R+   + LKHP +Q
Sbjct: 419 LKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K +   +      +ND          E +++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-VRLKQVEHTND----------ERLMLS 140

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           ++ HP ++R++  ++ AQ ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H+  I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 258

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS G+++Y +L G  PF   D N      K+ + +   P     + + +DL+
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLL 313

Query: 264 VQILTVEPEQRI-----KTREILKHPLLQK 288
            +++T +  QR+      T ++  HP  ++
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  147 bits (372), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 147/274 (53%), Gaps = 21/274 (7%)

Query: 21  LGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREII 80
            G TLGAGS G V  A+   T +  A+K++ K           G+N    + Y    E+ 
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-------GNNVQLQMLY---EELS 98

Query: 81  IMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIG 140
           I++ L+HPN++   D +E+    Y+V +    GELF+ ++ RG   E +AV    QI+  
Sbjct: 99  ILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILGA 158

Query: 141 ISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMA-ALESKDKLLETSCGSPHYAAP 196
           + Y H+  +VHRDLKPEN+L +D   N  + +ADFG+A  L+ K+ L+  + GS  Y AP
Sbjct: 159 VEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAP 218

Query: 197 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKY----EIPGE 252
           E+++    HG   D+WS GVI Y LL G  PF  E  ++   + +  + +Y     +P  
Sbjct: 219 EVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVEGFMEECTAYRYPVTFHMPYW 275

Query: 253 DEISPEARDLIVQILTVEPEQRIKTREILKHPLL 286
           D IS +A+  I++ L ++P  R    E+L  P +
Sbjct: 276 DSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  145 bits (366), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 148/273 (54%), Gaps = 23/273 (8%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KV+ K     +      +ND        ER 
Sbjct: 63  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQI-VKMKQIEHTND--------ERR 113

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  +KL+ HP ++R++  ++ + +L+MV++Y+E GELF+LL +    P   A  +  +++
Sbjct: 114 M--LKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVV 171

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y H   I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+
Sbjct: 172 LALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFA--KEVTTVTWTLCGTPDYIAPEV 229

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPE 258
           ++  PY+    D WS G+++Y +L G  PF   D        K+  G+   P     + +
Sbjct: 230 IATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYPS--FFNSD 284

Query: 259 ARDLIVQILTVEPEQRI-----KTREILKHPLL 286
             DL+ +++T +  +RI      T+EI  HP  
Sbjct: 285 VVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit and to YJL164C uniprot|P06244 Saccharomyces
           cerevisiae YJL164C TPK1 putative catalytic subunit of
           cAMP- dependent protein kinase
          Length = 455

 Score =  147 bits (371), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 146/268 (54%), Gaps = 23/268 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K+    +      +ND        ER +  + 
Sbjct: 150 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTV-VKLKQVEHTND--------ERNM--LS 198

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           +++HP ++R++  ++ +Q L+M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 199 IVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 258

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H+ GI++RDLKPEN+LLD   +IKL DFG A  +    +  T CG+P Y APE+VS  P
Sbjct: 259 LHSKGIIYRDLKPENILLDKNGHIKLTDFGFA--KYVPDVTYTLCGTPDYIAPEVVSTKP 316

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS GV++Y +L G  PF   D N       + +     P       +A+DLI
Sbjct: 317 YNK-SVDWWSFGVLIYEMLAGYTPF--YDSNTIKTYENILNAPVRFP--PFFHSDAQDLI 371

Query: 264 VQILTVEPEQRI-----KTREILKHPLL 286
            +++T +  QR+      + ++  HP  
Sbjct: 372 SKLITRDLSQRLGNLQNGSEDVKNHPWF 399

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  145 bits (367), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 83/270 (30%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 24  TLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMK 83
           TLG GS G+V L ++   G+  A+KV+ K +   +      +ND          E +++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-VRLKQVEHTND----------ERLMLS 140

Query: 84  LLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISY 143
           ++ HP ++R++  ++ +Q ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 203
            H+  I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 258

Query: 204 YHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLI 263
           Y+    D WS G+++Y +L G  PF   D N      K+ + +   P     + + +DL+
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLL 313

Query: 264 VQILTVEPEQRI-----KTREILKHPLLQK 288
            +++T +  QR+      T ++  HP  ++
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  148 bits (374), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 151/295 (51%), Gaps = 39/295 (13%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           + LG+ LGAG    V  A+N ++GQ  AVK+     F+AQ       ND          E
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKSGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 248

Query: 79  IIIMKLLNHPNVLRLYDVW-----ETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRF 133
             I+  ++HPN++ L D +     ++    Y+VLE ++ GELF  +V++  L ++E+   
Sbjct: 249 TNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 134 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGM 174
           F+Q++ G+ Y H   I+HRD+KPEN+LL+                       +K+ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQAQLGPWDEDEIDIQVKIADFGL 368

Query: 175 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG- 233
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF ++ G 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYSS-KVDLWSAGVILYVCLCGFPPFSDQLGP 427

Query: 234 -NIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287
            +++  +L+ +   Y  P  D+I      LI  +L + P++R    E + HP  +
Sbjct: 428 PSLKEQILQAKYAFYS-PYWDKIDDLVLHLISNLLVLNPDERYNIDEAMDHPWFK 481

>Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa]
           {ON} complement(126043..127197) [1155 nt, 385 aa]
          Length = 384

 Score =  145 bits (365), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 146/258 (56%), Gaps = 20/258 (7%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKS-VFNAQGSTFVGSNDPDVLPYGIER 77
           +++  TLG GS G+V L ++    +  A+KV+ K  +F  +      +ND        ER
Sbjct: 74  FQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMK--QIEHTND--------ER 123

Query: 78  EIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQI 137
           +I  +K++ HP ++R++  ++ +++L+MV++Y+E GELF+LL +    P   A  +  ++
Sbjct: 124 KI--LKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV 181

Query: 138 IIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPE 197
           I+ + Y H+  I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE
Sbjct: 182 ILALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVSTVTWTLCGTPDYIAPE 239

Query: 198 IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISP 257
           +++  PY+    D WS G+++Y +L G  PF   D        K+  GK   P      P
Sbjct: 240 VIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGKVNYPS--FFHP 294

Query: 258 EARDLIVQILTVEPEQRI 275
           +  DL+ +++T +  +R+
Sbjct: 295 DVIDLLARLITADLTRRL 312

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  145 bits (367), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 126/210 (60%), Gaps = 14/210 (6%)

Query: 19  WKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIERE 78
           +++  TLG GS G+V L ++   G+  A+KVI K+    +      +ND        ER 
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKKNTV-VRLKQIEHTND--------ERR 148

Query: 79  IIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQII 138
           +  + ++NHP ++R++  ++ ++ ++M+++Y+E GELF+LL +    P   A  +  ++ 
Sbjct: 149 M--LSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYAAEVC 206

Query: 139 IGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEI 198
           + + Y H+L I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+
Sbjct: 207 LALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEV 264

Query: 199 VSGLPYHGFESDVWSCGVILYALLTGRLPF 228
           VS  PY+    D WS G+++Y +L+GR PF
Sbjct: 265 VSSKPYNK-SVDWWSFGILIYEMLSGRTPF 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,804,598
Number of extensions: 4567243
Number of successful extensions: 19938
Number of sequences better than 10.0: 2143
Number of HSP's gapped: 15964
Number of HSP's successfully gapped: 2472
Length of query: 1142
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1021
Effective length of database: 39,606,813
Effective search space: 40438556073
Effective search space used: 40438556073
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)