Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR671W1.80ON48848822750.0
Ecym_10841.80ON49548212631e-170
Kwal_33.133861.80ON46942811721e-157
SAKL0C02574g1.80ON47345111531e-154
KLTH0F02332g1.80ON46944611121e-148
KLLA0C02277g1.80ON46537510881e-144
ZYRO0F16720g1.80ON49245810171e-133
TDEL0C062101.80ON4794889961e-130
Suva_5.31.80ON4833709671e-126
NCAS0J018401.80ON4454719361e-122
YEL064C (AVT2)1.80ON4803709361e-121
Skud_5.251.80ON4833709081e-117
Smik_5.231.80ON4834888841e-113
NDAI0I001301.80ON4443928661e-111
KNAG0C007801.80ON5133967723e-96
ZYRO0B04026g7.420ON4363301632e-11
NCAS0B062102.295ON4811271445e-09
TDEL0G022502.295ON4672831437e-09
NDAI0B035102.295ON4961291392e-08
TPHA0C034602.295ON4731171383e-08
CAGL0M06611g2.295ON4851221383e-08
Kpol_1003.442.295ON4702811357e-08
Smik_9.972.295ON4901081358e-08
KNAG0B021907.420ON4613281348e-08
Kpol_505.52.177ON6872381359e-08
Kwal_27.107027.420ON4672371331e-07
ZYRO0A02112g2.295ON4672851331e-07
Suva_9.1122.295ON4911081331e-07
KAFR0L019107.420ON4453131276e-07
KNAG0A053802.295ON4741221277e-07
KLTH0C06006g7.420ON4453061268e-07
Ecym_71337.420ON4572491242e-06
YIL088C (AVT7)2.295ON4901081242e-06
NDAI0E040107.420ON4712341213e-06
KLLA0E13795g5.252ON5731741205e-06
Skud_9.862.295ON4901081171e-05
KAFR0J013202.295ON4791321161e-05
KLTH0G10604g2.295ON4681111161e-05
YKL146W (AVT3)5.252ON6921791162e-05
SAKL0E07392g2.295ON4721201152e-05
NCAS0F023105.252ON6681831143e-05
Suva_2.287.420ON4592411124e-05
Smik_11.905.252ON6801821126e-05
TBLA0F01390singletonON4282031107e-05
Kwal_23.28395.252ON6141711108e-05
Skud_11.815.252ON7122091108e-05
CAGL0H04587g7.420ON4452211091e-04
YBL089W (AVT5)7.420ON4592161091e-04
Suva_5.2407.420ON4482451091e-04
Kwal_27.114852.295ON4711221091e-04
Smik_2.317.420ON4592161081e-04
TBLA0C030305.252ON5231861081e-04
KLLA0E08559g2.295ON460901072e-04
Skud_5.2607.420ON4482181062e-04
KLTH0D09042g2.177ON7182351062e-04
Suva_11.795.252ON7191801063e-04
YER119C (AVT6)7.420ON4482451053e-04
CAGL0G03619g7.420ON4603031035e-04
SAKL0G11462g5.252ON6161721028e-04
Kpol_1032.885.252ON5751881010.001
Kpol_1045.207.420ON4662071000.001
TPHA0K006707.420ON4643411000.001
Kwal_26.84012.177ON7201971000.001
Skud_2.197.420ON459240990.001
KLLA0E06931g7.420ON456262980.002
CAGL0E06468g5.252ON681209970.003
TDEL0F013202.177ON715213970.004
TPHA0F017002.177ON444162950.005
KLTH0G07502g5.252ON601188950.005
TBLA0B072102.295ON497123940.007
TDEL0C028207.420ON454341930.007
KNAG0H023305.252ON643216930.008
NDAI0C037905.252ON721178930.009
AGL285C7.420ON440204920.010
ADL205C2.295ON46890920.011
Smik_5.2647.420ON448243920.012
KAFR0H036605.252ON646209920.012
CAGL0G06622g2.177ON733229910.015
TPHA0B029802.177ON749183910.016
SAKL0F13134g7.420ON510338890.025
TDEL0E037405.252ON613213890.025
ZYRO0B09548g2.177ON718211890.032
NCAS0E024407.420ON495198880.033
TBLA0F014007.420ON453228880.038
TPHA0B025305.252ON596188850.081
ZYRO0A10538g5.252ON608207840.10
TBLA0C056302.177ON742171830.14
TBLA0F03230singletonON561107830.14
AAL028W1.391ON1044127840.14
ACR051C5.252ON678157820.19
KLTH0H11902g1.391ON104479820.24
NCAS0G026302.177ON705231810.25
KAFR0I021101.391ON104579810.31
Ecym_33352.295ON474121800.32
Ecym_82495.252ON627153800.32
NDAI0G008101.391ON1049129770.97
KAFR0H032001.391ON104979770.97
Kpol_1029.62.177ON767177760.98
Suva_14.2382.177ON716176751.5
NDAI0E011508.679ON236148731.7
KAFR0D020002.177ON714202741.7
Ecym_13121.391ON104481741.9
KNAG0C033807.420ON545101732.1
KLLA0C13277g2.177ON721212732.3
TBLA0D044101.391ON104481732.3
TDEL0B061501.391ON104479732.8
AER380C2.177ON716206713.9
Smik_14.2242.177ON715253714.1
CAGL0B03487g1.391ON104581714.6
Skud_14.2292.177ON713176704.9
SAKL0A09702g2.541ON103674714.9
SAKL0E10362g2.177ON733181696.7
Suva_11.3235.684ON34549687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR671W
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   880   0.0  
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   491   e-170
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   456   e-157
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   448   e-154
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   432   e-148
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   423   e-144
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   396   e-133
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   388   e-130
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   377   e-126
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   365   e-122
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   365   e-121
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   354   e-117
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   345   e-113
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   338   e-111
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   301   3e-96
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    67   2e-11
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    60   5e-09
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    60   7e-09
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     58   2e-08
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    58   3e-08
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    58   3e-08
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    57   7e-08
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    57   8e-08
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    56   8e-08
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    57   9e-08
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    56   1e-07
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    56   1e-07
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    56   1e-07
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    54   6e-07
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    54   7e-07
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    53   8e-07
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    52   2e-06
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    52   2e-06
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     51   3e-06
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    51   5e-06
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    50   1e-05
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    49   1e-05
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    49   1e-05
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    49   2e-05
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    49   2e-05
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    49   3e-05
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    48   4e-05
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    48   6e-05
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    47   7e-05
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    47   8e-05
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    47   8e-05
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    47   1e-04
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    47   1e-04
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    47   1e-04
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    47   1e-04
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    46   1e-04
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    46   1e-04
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    46   2e-04
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    45   2e-04
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    45   2e-04
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    45   3e-04
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    45   3e-04
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    44   5e-04
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    44   8e-04
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    44   0.001
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    43   0.001
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    43   0.001
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    43   0.001
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    43   0.001
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    42   0.002
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    42   0.003
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    42   0.004
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    41   0.005
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    41   0.005
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    41   0.007
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    40   0.007
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    40   0.008
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    40   0.009
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    40   0.010
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    40   0.011
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    40   0.012
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    40   0.012
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    40   0.015
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    40   0.016
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    39   0.025
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    39   0.025
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    39   0.032
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     39   0.033
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    39   0.038
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    37   0.081
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    37   0.10 
TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON} Anc_2...    37   0.14 
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               37   0.14 
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    37   0.14 
ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON} S...    36   0.19 
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    36   0.24 
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     36   0.25 
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    36   0.31 
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    35   0.32 
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    35   0.32 
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    34   0.97 
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    34   0.97 
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    34   0.98 
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    33   1.5  
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    33   1.7  
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    33   1.7  
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    33   1.9  
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    33   2.1  
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    33   2.3  
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    33   2.3  
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    33   2.8  
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    32   3.9  
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    32   4.1  
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    32   4.6  
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    32   4.9  
SAKL0A09702g Chr1 complement(852429..855539) [3111 bp, 1036 aa] ...    32   4.9  
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    31   6.7  
Suva_11.323 Chr11 complement(587638..588675) [1038 bp, 345 aa] {...    31   7.8  

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/488 (89%), Positives = 438/488 (89%)

Query: 1   MSVPNIQYSRLDGDETGKEGTSVQSPFHTVQLNREWGDPSSSNGDRIELIDYPTKSSTLS 60
           MSVPNIQYSRLDGDETGKEGTSVQSPFHTVQLNREWGDPSSSNGDRIELIDYPTKSSTLS
Sbjct: 1   MSVPNIQYSRLDGDETGKEGTSVQSPFHTVQLNREWGDPSSSNGDRIELIDYPTKSSTLS 60

Query: 61  SGFDLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCXXXXXXXXX 120
           SGFDLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNC         
Sbjct: 61  SGFDLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCGLLGGLVLT 120

Query: 121 XXXXXIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXX 180
                IVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFA          
Sbjct: 121 MLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAFGGCVGFCII 180

Query: 181 XXDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXX 240
             DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRN                  
Sbjct: 181 IGDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNISKLSKASMLALVSLLLI 240

Query: 241 XXXXXXRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLR 300
                 RGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLR
Sbjct: 241 VVIIVVRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLR 300

Query: 301 RFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           RFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT
Sbjct: 301 RFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360

Query: 361 TFPLEIFVLRDVIRDLISTETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLE 420
           TFPLEIFVLRDVIRDLISTETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLE
Sbjct: 361 TFPLEIFVLRDVIRDLISTETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLE 420

Query: 421 LVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIHS 480
           LVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIHS
Sbjct: 421 LVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIHS 480

Query: 481 DKSSQCDA 488
           DKSSQCDA
Sbjct: 481 DKSSQCDA 488

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  491 bits (1263), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 254/482 (52%), Positives = 315/482 (65%), Gaps = 34/482 (7%)

Query: 7   QYSRLDGDETGKEGTSVQSPFHTVQLNREWGDPSSSNGDRIELIDYPTKSSTLSSGFDLE 66
            Y  L      +   +VQ   + V+LN ++ DP+ S     +L +     S +   F   
Sbjct: 48  DYELLPTTSGARNNKNVQ---NNVELNLQFEDPNVS-----QLTNPNRGKSNMYMAFMNM 99

Query: 67  EDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCXXXXXXXXXXXXXXI 126
            +S+LGA V                           G    +KNC              I
Sbjct: 100 ANSILGAGVI--------------------------GQPFAIKNCGLIGGVCLIVLLTII 133

Query: 127 VDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSIP 186
           VDWTIRLI+INLKLTGKTTYQD+VEFAMG  GK  +LF NG+FA            DSIP
Sbjct: 134 VDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFGGCVGFCIIIGDSIP 193

Query: 187 HVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXX 246
           HVL+AFFP++ E F RN++I++VT+F+SYPLSLNRN                        
Sbjct: 194 HVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIVALVII 253

Query: 247 RGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLT 306
           R P V ++Y+G F  EE F+ PR+FQGIS+ISFALVC HNTSFI+FSL+ PSL+RF +LT
Sbjct: 254 RAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLT 313

Query: 307 HISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEI 366
           HISC ISM+VCLIAGY GFLTFK KTKGNILNNFPS+DN+INFARFCFGFNMLTTFPLEI
Sbjct: 314 HISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEI 373

Query: 367 FVLRDVIRDLISTETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTT 426
           FVLRDV+RDL+  ++   E + L+TK HFI+T+ LV  +M ISLTTCNLGALLELVGSTT
Sbjct: 374 FVLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTT 433

Query: 427 ASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIHSDKSSQC 486
           ASL+AYILPP T L LTG+ +  KE+ P+YACI+FGFSIM++SSTQ I++AI+  +   C
Sbjct: 434 ASLTAYILPPATTLALTGKTKTLKERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHC 493

Query: 487 DA 488
           +A
Sbjct: 494 EA 495

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  456 bits (1172), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 228/428 (53%), Positives = 282/428 (65%), Gaps = 6/428 (1%)

Query: 64  DLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCXXXXXXXXXXXX 123
           D  ED    A ++E++ K             + L     G    +KNC            
Sbjct: 45  DGSEDESTTAFLRENRSKSNIFMAFMNMANSI-LGAGVIGQPFAIKNCGLVGGIFAVILL 103

Query: 124 XXIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXD 183
             +VDWTIRLI++N+K+TGKTTYQD+VEFAMGR GK  +L +NG+FA            D
Sbjct: 104 SVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGD 163

Query: 184 SIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXXX 243
           +IPHVLRAFFP +   F+RN+II +VT F+S+PLSLNRN                     
Sbjct: 164 TIPHVLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVI 223

Query: 244 XXXRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFN 303
              +GP + + Y+GSF+  ELF  PR+FQGISVISFALVC HNTSFIYFSL+ PSL+RF+
Sbjct: 224 VLVKGPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFD 283

Query: 304 SLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFP 363
            LTH SC ++M+ C + GY+GFL FK +TKGNILNNFP SDN +N ARFCFGFNMLTTFP
Sbjct: 284 RLTHFSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFP 343

Query: 364 LEIFVLRDVIRDLI---STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLE 420
           LEIFVLRDVIRD +   S +T + +   LS K H I+TT LV++TM ISLTTCNLGAL E
Sbjct: 344 LEIFVLRDVIRDFMFFNSKDTNQSQ--ELSLKLHVILTTILVMTTMLISLTTCNLGALFE 401

Query: 421 LVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIHS 480
           L G+TTASL AYILPP  NL+L G+R   +EKLPHYACI+FGF+IMV+SS+Q II  I  
Sbjct: 402 LTGATTASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRG 461

Query: 481 DKSSQCDA 488
                C+ 
Sbjct: 462 GDQKHCEV 469

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  448 bits (1153), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 237/451 (52%), Positives = 296/451 (65%), Gaps = 6/451 (1%)

Query: 38  DPSSSNGDRIELIDYPTKSSTLSSGFDLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSL 97
            P+ ++G      D   ++  + +G D+E D ++  IV E++ K             + L
Sbjct: 27  QPAHASGSAA---DEDDETKFVDTGADVE-DPLVSGIVTENQTKSNIYMAFMNMANSI-L 81

Query: 98  ELVWSGSRLRLKNCXXXXXXXXXXXXXXIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRP 157
                G    + NC              +VDWTIRLI++NLKLTGKTTYQD+VEFAMGR 
Sbjct: 82  GAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRR 141

Query: 158 GKYAVLFANGMFAXXXXXXXXXXXXDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPL 217
           GK  +L ANG+FA            D+IPHVLRAFFP +   F+RN II  VT+FVSYPL
Sbjct: 142 GKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPL 201

Query: 218 SLNRNXXXXXXXXXXXXXXXXXXXXXXXXRGPTVGNDYRGSFDLEELFVKPRLFQGISVI 277
           SLNR+                        +GP +   Y+GS    +LF+ PR+FQGISVI
Sbjct: 202 SLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKGSLTASKLFITPRIFQGISVI 261

Query: 278 SFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNIL 337
           SFALVC HNTSFIYFSL+ PSL+RFN LTH+SC +SMVVC + GYSGFL FK KTKGNIL
Sbjct: 262 SFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNIL 321

Query: 338 NNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKG-EPLRLSTKRHFI 396
           NNFPS DN IN ARFCFGFNMLTTFPLEIFVLRDV+RDL    + +   P  LSTK+H  
Sbjct: 322 NNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVA 381

Query: 397 ITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHY 456
           +T+ALV  TM +SLTTCNLGAL EL+G+TTAS+ AYILPP+TNL+LTG  +  ++KLP+Y
Sbjct: 382 VTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYY 441

Query: 457 ACILFGFSIMVISSTQAIITAIHSDKSSQCD 487
            CI+FGF++MVISSTQ I+ AI+  +   C+
Sbjct: 442 GCIVFGFAVMVISSTQTILAAINGGEQKHCE 472

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  432 bits (1112), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 219/446 (49%), Positives = 279/446 (62%), Gaps = 3/446 (0%)

Query: 44  GDRIELIDYPTKSSTLSSGFDLE-EDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWS 102
           GD  EL  +   +        ++ ED      + E + K   +         + L     
Sbjct: 24  GDNFELSSFDRSTEVRPERLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSI-LGAGII 82

Query: 103 GSRLRLKNCXXXXXXXXXXXXXXIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAV 162
           G    +KNC              +VDWTIRLI++NL+++GKTTYQD+VE AMGR GK  +
Sbjct: 83  GQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLI 142

Query: 163 LFANGMFAXXXXXXXXXXXXDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRN 222
           L +NG+FA            D+IPHVLRAFF  +   F+RN++I +VT  +S+PLSLNR+
Sbjct: 143 LLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRD 202

Query: 223 XXXXXXXXXXXXXXXXXXXXXXXXRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALV 282
                                   +GP   + Y+GSF+   L + PR+FQG+SVISFALV
Sbjct: 203 ISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALV 262

Query: 283 CLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPS 342
           C HNTSFIYFSL+ PSL+RF+ LTH SC I+M+ C + G++GFL FK KTKGNILNNFP 
Sbjct: 263 CHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPG 322

Query: 343 SDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI-STETPKGEPLRLSTKRHFIITTAL 401
           +DN +N ARFCFGFNMLTTFPLEIFVLRDVI+DL+     PK +P  LS K H II+TAL
Sbjct: 323 NDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTAL 382

Query: 402 VLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILF 461
           V  TM ISLTTCNLGAL EL+G+TTASL AYILPP  NL L G     ++++PHY CI F
Sbjct: 383 VFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGF 442

Query: 462 GFSIMVISSTQAIITAIHSDKSSQCD 487
           GF+IM+ISSTQ II+ I+      C+
Sbjct: 443 GFAIMLISSTQTIISYINGGDQKHCE 468

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  423 bits (1088), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/375 (55%), Positives = 263/375 (70%)

Query: 103 GSRLRLKNCXXXXXXXXXXXXXXIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAV 162
           G    +KNC              +VDWTIRLI+INLKLTGK+TYQ +VE AMG+ G   +
Sbjct: 89  GQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLI 148

Query: 163 LFANGMFAXXXXXXXXXXXXDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRN 222
           L +NG+FA            DSIPHVL AFFP++ + F+RN+IIT+VT+F+S+PLSLNR+
Sbjct: 149 LVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRD 208

Query: 223 XXXXXXXXXXXXXXXXXXXXXXXXRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALV 282
                                   + P V  +Y+G+F L +LF+ PR+FQGISVISFALV
Sbjct: 209 ISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKGTFHLHQLFITPRIFQGISVISFALV 268

Query: 283 CLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPS 342
           C HNTSFI+FSLR PSL+RFN LTH+S  +S +VCL   YSGFL FK KT GNILNNFPS
Sbjct: 269 CHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPS 328

Query: 343 SDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGEPLRLSTKRHFIITTALV 402
            DN INFAR   GFNMLTTFPLEIFVLRDVIRD+I       EP++L+TK H +IT+ LV
Sbjct: 329 DDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLV 388

Query: 403 LSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFG 462
           L  M I+L+T NLGALLE++G+T+ASL AYILPP+TNL++TG++++ KEKLP+  CI+FG
Sbjct: 389 LIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVFG 448

Query: 463 FSIMVISSTQAIITA 477
             +M +S+ Q I+ A
Sbjct: 449 VILMFVSTAQTILEA 463

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  396 bits (1017), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 271/458 (59%), Gaps = 31/458 (6%)

Query: 33  NREWG-DPSSSNGDRI--ELIDYPTKSSTLSSGFDLEEDSVLGAIVQESKGKVQYVYGLH 89
           N E+G D +  N D    ++I    K ST+   F    +S+LGA V              
Sbjct: 62  NLEYGIDDNYDNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVI------------- 108

Query: 90  EHGEQVSLELVWSGSRLRLKNCXXXXXXXXXXXXXXIVDWTIRLIIINLKLTGKTTYQDT 149
                        G  + +KN               +VDWT+RLI+INL L GK TYQDT
Sbjct: 109 -------------GQPIAIKNSGIVGAIIAYLVLFVLVDWTLRLIVINLTLAGKKTYQDT 155

Query: 150 VEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSIPHVLRAFFPNYIEYFNRNMIITIV 209
           V FAMG+ G+ AVL ANG+FA            D++PHV RAF      + +R +IITIV
Sbjct: 156 VAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGDTLPHVFRAFIHQNSVFLSRRLIITIV 215

Query: 210 TIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRGPTVGNDYRGSFDLEELFVKPR 269
           TI +SYPL+L RN                        RGP + +  R     E++ V PR
Sbjct: 216 TICISYPLALQRNIAALSKASFLALISMVIIVFTVIIRGPEI-HAKRDPLTWEDILVTPR 274

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           +F+GISVISFALVC HNTSFIYFS++  SLR+FN LTHIS +IS+V C+I G+SGF  F 
Sbjct: 275 IFRGISVISFALVCHHNTSFIYFSIKNRSLRKFNRLTHISTSISVVFCMIMGFSGFAAFG 334

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGEPLRL 389
             TKGN+LNNF + D  +N AR CFGFNMLTTFPLEIFVLRDVI   I    P G+P  L
Sbjct: 335 QNTKGNVLNNFSADDKAVNIARLCFGFNMLTTFPLEIFVLRDVIASFIGGHQPNGDPNVL 394

Query: 390 STKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAA 449
           S   HFIITT LV  TM ISL TCNLGA+ EL+G+TTAS+ AYILPP  NL+LT + +  
Sbjct: 395 SKSNHFIITTILVFGTMSISLLTCNLGAIFELIGATTASMMAYILPPWVNLLLTSD-KTF 453

Query: 450 KEKLPHYACILFGFSIMVISSTQAIITAIHSDKSSQCD 487
           ++KLPH+ACI FGFSIM+ISS Q I+  ++     QC+
Sbjct: 454 RQKLPHFACIAFGFSIMLISSIQTILDTMNGTDEKQCE 491

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  388 bits (996), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 216/488 (44%), Positives = 287/488 (58%), Gaps = 18/488 (3%)

Query: 5   NIQYSRLDGDETGKEGTSVQSPFHTVQLNREWG--DPSSSNGDRIELIDYPTKSSTLSSG 62
           N  YSRL   E   E   ++  F  V  + + G  D +  N           K+S+ +S 
Sbjct: 4   NDGYSRL---EEQSERIPLELEFELVDFDAKPGASDETEENDSN------EAKASSSNSA 54

Query: 63  FDLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCXXXXXXXXXXX 122
            D   +S++  +++++  K    +        + L     G    ++NC           
Sbjct: 55  ID---ESMVINLLRDNDKKSTMRWAFMNMANSI-LGAGVVGQPFAIRNCGIIGGILAYII 110

Query: 123 XXXIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXX 182
              +VDWT+RLI+INL L GK TYQDTVEFA+GR G+  VL +NG+FA            
Sbjct: 111 LVLLVDWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIG 170

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXX 242
           D+IPH L++ F +   +F RN++ITIVT+F+SYPLSL RN                    
Sbjct: 171 DTIPHFLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVF 230

Query: 243 XXXXRGPTVGNDYRGS-FDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRR 301
               +GP V    +G  + L ++F+   +F+GISVISFALVC HNTSFI+FS++  SL++
Sbjct: 231 SVVVQGPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQK 290

Query: 302 FNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTT 361
           F  LTHIS  ISM+ C++ GYSG+  F+ KTKGNILNNFP  D  IN AR CFGFNMLTT
Sbjct: 291 FARLTHISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTT 350

Query: 362 FPLEIFVLRDVIRDLI--STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALL 419
           FPLEIFVLRDVI   +    E  + E   LST++ FIITT  V+STM ISLTTCNLGAL 
Sbjct: 351 FPLEIFVLRDVIAAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALF 410

Query: 420 ELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIH 479
           EL+G+TTAS  AYILPP TNL+L+ E    ++K+PHY CI FGF +M++SSTQ II  + 
Sbjct: 411 ELIGATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVK 470

Query: 480 SDKSSQCD 487
                 C+
Sbjct: 471 GSDQRHCE 478

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 196/370 (52%), Positives = 246/370 (66%), Gaps = 8/370 (2%)

Query: 126 IVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSI 185
           IVDWT+RLI+INL L GK TYQ TVE+ MG+ GK  +LF NG+FA            D+I
Sbjct: 113 IVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTI 172

Query: 186 PHVLRAFFP-NYIE---YFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXX 241
           PHVLRA F  N  E   +  RN+II +VTIF+S+PLSL RN                   
Sbjct: 173 PHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIV 232

Query: 242 XXXXXRGPTVGNDYRG-SFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLR 300
                RGP +  D+RG +  L ++F+K  +F+ +SVISFALVC HNTSFI+FS+R  S+ 
Sbjct: 233 LTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 292

Query: 301 RFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           +F  LTHIS  IS++ C + GYSGF  FK KTKGN+LN+FP +D  IN AR CFGFNMLT
Sbjct: 293 KFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLT 352

Query: 361 TFPLEIFVLRDVIRDLIST---ETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGA 417
           TFP+EIFVLRDV+ +L+          E  +LS K+H IIT+ LV  TMGISLTTCNLGA
Sbjct: 353 TFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGA 412

Query: 418 LLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITA 477
           L EL+G+TTAS  AYILPP TNL+LT +++  K KLP+Y CI FGF IM++SSTQ I+ A
Sbjct: 413 LFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDA 472

Query: 478 IHSDKSSQCD 487
           ++      C 
Sbjct: 473 VNGPDGQHCQ 482

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  365 bits (936), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 267/471 (56%), Gaps = 39/471 (8%)

Query: 27  FHTVQLNREWGDPSSSNGDRIELIDYPTKSSTLSSGFDLEEDSVLGA-IVQESKGKVQYV 85
           +  + L+ E   P +S     ELI+   K S +   F    +S+LGA I+ +        
Sbjct: 3   YSMIPLDEESQLPDTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQP------- 55

Query: 86  YGLHEHGEQVSLELVWSGSRLRLKNCXXXXXXXXXXXXXXIVDWTIRLIIINLKLTGKTT 145
                               L +KN               IVDWT+RL++IN+ L+ K T
Sbjct: 56  --------------------LAVKNAGILGSIICYILLGFIVDWTLRLLVINITLSSKQT 95

Query: 146 YQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSIPHVLRAFFPNYIEYFNRNMI 205
           YQDTVE  MG+ GK+ +L  NG+FA            D+IPHVLR FF +  E   RNM+
Sbjct: 96  YQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIGDTIPHVLRIFFNS--EKITRNMV 153

Query: 206 ITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRGPTVGNDYRGS-FDLEEL 264
           I + T+F+SYPLSL RN                        RGP + ++ +G       L
Sbjct: 154 IFLTTLFISYPLSLLRNIAALSKASFLALVSMVVIVFTVVIRGPALPSELKGEPLSHSSL 213

Query: 265 FVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSG 324
           F  P LF+ +S+ISFALVC HNTSFI+ S+R  SL +F  LTHIS  IS+  C++ GYSG
Sbjct: 214 FFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKSLTKFTKLTHISVFISVAFCMLMGYSG 273

Query: 325 FLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI----STE 380
           F  F  KTKGNILNNFP+ DN IN AR CFGFNMLTTFPLEIFVLRDV+  ++       
Sbjct: 274 FFIFTDKTKGNILNNFPAKDNIINIARICFGFNMLTTFPLEIFVLRDVVAVILLECHLVP 333

Query: 381 TPKGEPL--RLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMT 438
           + +  PL   LS K HF ITT LV  +MGISL TCNLGAL EL+GSTTAS+ AYILPP  
Sbjct: 334 SEENNPLLPYLSRKWHFCITTGLVFLSMGISLMTCNLGALFELIGSTTASVMAYILPPYV 393

Query: 439 NLILTGERR--AAKEKLPHYACILFGFSIMVISSTQAIITAIHSDKSSQCD 487
           NL+L  +R   +   KLPHY CI FGF++M+ISST+ I+ A+   +   C+
Sbjct: 394 NLLLRQQRNELSFTTKLPHYFCIFFGFTVMIISSTETILDAVFGTEQKHCE 444

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  365 bits (936), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 245/370 (66%), Gaps = 8/370 (2%)

Query: 126 IVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSI 185
           IVDWT+RLI+INL L GK TYQ TVE  MG+ GK  +LF NG+FA            D+I
Sbjct: 110 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTI 169

Query: 186 PHVLRAFFP----NYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXX 241
           PHVLRA F     N   +  RN+II +VT F+S+PLS+ RN                   
Sbjct: 170 PHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIV 229

Query: 242 XXXXXRGPTVGNDYRG-SFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLR 300
                RGP +  D++G S  L + F+K  +F+ +SVISFALVC HNTSFI+FS+R  S+ 
Sbjct: 230 LTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 289

Query: 301 RFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           +F  LTHIS  IS++ C + GYSGF  FK KTKGN+LN+FP +D  IN AR CFGFNMLT
Sbjct: 290 KFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLT 349

Query: 361 TFPLEIFVLRDVIRDLI---STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGA 417
           TFP+EIFVLRDV+ +L+   +      E  +LS K+H +IT++LV  TMGISLTTCNLGA
Sbjct: 350 TFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGA 409

Query: 418 LLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITA 477
           L EL+G+TTAS  AYILPP TNL+LT ++++ KE+LP Y CI FGF IM+ISSTQ II A
Sbjct: 410 LFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDA 469

Query: 478 IHSDKSSQCD 487
           ++      C 
Sbjct: 470 VNGSDGQHCQ 479

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  354 bits (908), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 242/370 (65%), Gaps = 8/370 (2%)

Query: 126 IVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSI 185
           IVDWT+RLI+INL L GK TYQ TVE  MG+ GK  +LF NG+FA            D+I
Sbjct: 113 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTI 172

Query: 186 PHVLRAFFP-NYIE---YFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXX 241
           PHVLRA F  N  E   +  RN+II +VTIF+S+PLSL RN                   
Sbjct: 173 PHVLRAVFSQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIV 232

Query: 242 XXXXXRGPTVGNDYRG-SFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLR 300
                RGP +  D++G S    +  VK  +F+ +SVISFALVC HNTSFI+FS+R  S+ 
Sbjct: 233 LTVVIRGPMLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 292

Query: 301 RFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           +F  LTHIS  IS++ C + G+SGF  FK KTKGN+LNNFP +D  IN AR CFGFNMLT
Sbjct: 293 KFTRLTHISIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLT 352

Query: 361 TFPLEIFVLRDVIRD-LISTETPKG--EPLRLSTKRHFIITTALVLSTMGISLTTCNLGA 417
           TFP+EIFVLRDV+ + L      K   E  +LS K+H IIT+ LV  TM ISLTTCNLGA
Sbjct: 353 TFPMEIFVLRDVVGNSLHECHLIKSYDEHTQLSDKQHTIITSLLVFITMSISLTTCNLGA 412

Query: 418 LLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITA 477
           L EL+GSTTAS  AYILPP TNL+LT +++  K KLP+Y CI FGF IM++SSTQ I+ A
Sbjct: 413 LFELIGSTTASTMAYILPPYTNLLLTSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDA 472

Query: 478 IHSDKSSQCD 487
           I+      C+
Sbjct: 473 INGADEQHCE 482

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  345 bits (884), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 216/488 (44%), Positives = 280/488 (57%), Gaps = 20/488 (4%)

Query: 8   YSRLDGDETGKEGTSVQSPFHTVQLNREWGDPSSSNGDRIELIDYPTKSSTLSSGFDLEE 67
           Y++L+  E   E      P   +  N    D  S   D ++ I YP  S T        +
Sbjct: 7   YTKLENKELRTEFELTDFPLPGITDNNS--DDRSQGKDSLKAI-YPIASDT--------D 55

Query: 68  DSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCXXXXXXXXXXXXXXIV 127
           D+++  ++ E+  K             +    + +     +KN               IV
Sbjct: 56  DTLVNKVLLENDKKSSMRMAFMNLANSILGAGIIT-QPFAIKNAGILGGLISYIALGFIV 114

Query: 128 DWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSIPH 187
           DWT+RLI+INL L GK TYQ TVE  MG+ GK  +LF NG+FA            D+IPH
Sbjct: 115 DWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPH 174

Query: 188 VLRAFFP----NYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXXX 243
           VLRA F     +   +  RN+II IVTIF+S+PLSL RN                     
Sbjct: 175 VLRAIFSQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMIIIVVT 234

Query: 244 XXXRGPTVGNDYRG-SFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRF 302
              RGP +  D++G S  L + FVK  +F+ +SVISFALVC HNTSFI+FS+R  S+ +F
Sbjct: 235 VVIRGPMLPYDWKGHSLQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294

Query: 303 NSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTF 362
             LTHIS  IS++ C + GYSGF  FK KTKGNILN+FP +D  IN AR CFGFNMLTTF
Sbjct: 295 TRLTHISIIISVICCGLMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFNMLTTF 354

Query: 363 PLEIFVLRDVIRDLI-STETPKG--EPLRLSTKRHFIITTALVLSTMGISLTTCNLGALL 419
           P+EIFVLRDV+ +L+   +  K   E  +LS K+H +IT+ LV  TMGISLTTCNLGAL 
Sbjct: 355 PMEIFVLRDVVGNLLHECKIIKNYDEHTQLSGKQHIVITSLLVFITMGISLTTCNLGALF 414

Query: 420 ELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIH 479
           EL+G+TTAS  AYILPP TNL+LT ++++   KLP Y CI FGF IM+ISSTQ I+ A++
Sbjct: 415 ELIGATTASTMAYILPPYTNLLLTSKKKSWSAKLPFYLCICFGFMIMIISSTQTILDAVN 474

Query: 480 SDKSSQCD 487
                 C 
Sbjct: 475 GSDGQHCQ 482

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  338 bits (866), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/392 (46%), Positives = 239/392 (60%), Gaps = 13/392 (3%)

Query: 106 LRLKNCXXXXXXXXXXXXXXIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFA 165
           L +KN               IVDWT+RL+I N+ L+ K TY DTVE+ MGR GKY +L  
Sbjct: 55  LAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCC 114

Query: 166 NGMFAXXXXXXXXXXXXDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXX 225
           NG+FA            D+IPHVLR F  ++  +  RN +I   T+F+SYPLSL R+   
Sbjct: 115 NGLFALGGCIGFCIIIGDTIPHVLRIFIHSH--FVTRNSVIFFSTLFISYPLSLLRDISA 172

Query: 226 XXXXXXXXXXXXXXXXXXXXXRGPTVGNDYRGSFDLEELFVK-PRLFQGISVISFALVCL 284
                                 GP++  + +GS      +V  P LF+ +S++SFALVC 
Sbjct: 173 LSSTSFLALISMTVIVMTVVVFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCH 232

Query: 285 HNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSD 344
           HNTSFI+ S+R  SL +F  LTH+S  IS++ C+I GY+GF  F  KTKGNILNNFP + 
Sbjct: 233 HNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNG 292

Query: 345 NYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI-------STETPKGEPLRLSTKRHFII 397
             IN AR CFGFNMLTT PLE+FVLRDVI  ++       S E   G P+ L+ K HFI+
Sbjct: 293 VAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPI-LTRKWHFIV 351

Query: 398 TTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERR--AAKEKLPH 455
           TT +V  TM +SL TCNLGAL ELVG+TTAS+ AYILPP  NL+L  E+     K K+PH
Sbjct: 352 TTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPH 411

Query: 456 YACILFGFSIMVISSTQAIITAIHSDKSSQCD 487
           Y CILFGF++M++SS Q I+ A+  ++   C+
Sbjct: 412 YFCILFGFTVMIVSSFQTIVEALADNEQKHCE 443

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  301 bits (772), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 167/396 (42%), Positives = 234/396 (59%), Gaps = 48/396 (12%)

Query: 126 IVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAXXXXXXXXXXXXDSI 185
           +VDWT+RLI+ NL +TG  TYQ++V  A+G PG+ A+L ANG+FA            D+I
Sbjct: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140

Query: 186 PHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXX 245
           PHVLR   P   +Y  RN +I +VT+ +S PLSL++                        
Sbjct: 141 PHVLRTVCPP--QYIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAVIVVTVA 198

Query: 246 XRGPTVGNDYRGSFDL--EELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFN 303
            RGP + ++ +    L   + + +  +F+ +S++SFALVC HNTSFI+ SLR  S+ +FN
Sbjct: 199 VRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFN 258

Query: 304 SLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFP 363
            LTH SC +S+ VC++ GY+GF TFK KTKGN+LNNF   D +IN AR  FGFNMLTTFP
Sbjct: 259 RLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFP 318

Query: 364 LEIFVLRDVIRDLISTET----------------------PKGEPLRLSTKR-------- 393
           LEIFVLR+V+ D+ +  T                      P  EP   S  R        
Sbjct: 319 LEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGPAGPHPG 378

Query: 394 -----------HFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLIL 442
                      H  +T  LVL+TMG++L TCNLGALLE++GSTT +L+AYILPP+T+++L
Sbjct: 379 LPPDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPPLTHVLL 438

Query: 443 TGER---RAAKEKLPHYACILFGFSIMVISSTQAII 475
           T  R     A+E+L H  C++FG ++M++S+TQ ++
Sbjct: 439 TRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLL 474

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/330 (23%), Positives = 131/330 (39%), Gaps = 39/330 (11%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXX 242
           D IP +   F  N I    RN  IT+V +F+  PL   +                     
Sbjct: 104 DLIPQIFTTFTSNKI-LLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCC 162

Query: 243 XXXXR--GPTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSL 299
                   P+   D R G   +     +P     + +  FA  C HN   +Y   +  S 
Sbjct: 163 LVVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTST 222

Query: 300 RRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNML 359
           R+ N +     +I+ V+  I G +G+LTF     GNI+  +P S +     R      ++
Sbjct: 223 RQLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYPPSLS-TTIGRVAIVLLVM 281

Query: 360 TTFPLEIFVLRDVIR--------------------DLISTE-----TPKGEPL-RLSTKR 393
             FPL+    R  I                     +LIS E        G P+  L  KR
Sbjct: 282 LAFPLQCHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKR 341

Query: 394 HFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKE-- 451
             +IT  +++++  ++++  +L  LL +VGST ++  ++ILP +    L G     +E  
Sbjct: 342 FTVITLVILIASYLLAISVTSLARLLAIVGSTGSTSISFILPGIFGYWLIGSEYTPEELP 401

Query: 452 ---KLPHYACIL---FGFSIMVISSTQAII 475
              K   +A +L   +GF +M+ S   +I+
Sbjct: 402 RNLKFAKFAGLLLAIWGFIVMIASLAASIL 431

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 61/127 (48%), Gaps = 1/127 (0%)

Query: 252 GNDY-RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISC 310
           GN + RG      ++    L    S+I FA V   N   I   L   S+     + + S 
Sbjct: 170 GNTFARGEISWIRIYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSI 229

Query: 311 TISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLR 370
            IS +  L+ G SG+LTF S  +GNI+ N+  +  +I   +FC  F +L +FPL    LR
Sbjct: 230 GISSIFFLLVGISGYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLR 289

Query: 371 DVIRDLI 377
             + +L+
Sbjct: 290 IAVNNLV 296

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/283 (21%), Positives = 111/283 (39%), Gaps = 68/283 (24%)

Query: 255 YRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISM 314
           YRG     +++    L    S+I FA     N   I   L++ S+    S+ + S TIS 
Sbjct: 175 YRGEVCWFKVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITIST 234

Query: 315 VVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIR 374
            V L  G  G+LTF S T GNI+ N+     ++   + C G  ++ +FPL     R  I 
Sbjct: 235 AVFLAVGICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAIN 294

Query: 375 DLI--------------------STETPKGEPLRLSTK---------------------- 392
           +L+                     +   +G P+RLS +                      
Sbjct: 295 NLVVWSEIHFKKDPIMPSQQAQARSRPGEGSPIRLSIQDEDNESLAGFDNDIESVDGDDT 354

Query: 393 ----------------RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPP 436
                           R + I+  L++    ++L   +   +L LVG+T ++  ++ILP 
Sbjct: 355 QVIRGNNVETTPFPNSRFYAISAILLILMYSLALKVKSFAFVLALVGATGSTSISFILPG 414

Query: 437 M-------TNLILTGERRAAKEKLPHYACIL---FGFSIMVIS 469
           +       T+ +  G+  + +++      +L   +G S+M +S
Sbjct: 415 LFGYKLIGTDSLAVGQSISPRDRFYKRCSVLLVWYGLSVMALS 457

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (48%)

Query: 249 PTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHI 308
           P  G+  RG      ++    L    S+I FA     N   +   L   S++   ++ + 
Sbjct: 171 PNEGDSTRGEVYWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIKNVING 230

Query: 309 SCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFV 368
           S  IS  + L+ G SG+LTF S  +GNI+ N+  + N+I   +FC G  ++ +FPL    
Sbjct: 231 SIIISTGLFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFPLLFHP 290

Query: 369 LRDVIRDLI 377
           LR  + +L+
Sbjct: 291 LRIAVNNLV 299

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 62/117 (52%), Gaps = 4/117 (3%)

Query: 265 FVKPRLFQGI----SVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIA 320
           ++K R ++G     ++I FA     N   I   L + S++  + + + S  IS ++ L  
Sbjct: 181 WIKIRDYKGFVTTFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTILFLSV 240

Query: 321 GYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI 377
           G +G+LTF S T GNI+ N+  +  + N   FC G  ++ +FPL    LRD + ++I
Sbjct: 241 GITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNNII 297

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 372 VIRDLISTETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSA 431
           ++ D+   +   G     S  R +IIT AL+      +LT  +   +L  VG+T ++  +
Sbjct: 356 ILEDVNENQFTSGIKSDFSQSRFYIITFALLAVIYITALTVTSFSLILAFVGATGSTSIS 415

Query: 432 YILPPM-------TNLILTGE----RRAAKEKLPHYACILFGFSIMVIS 469
           +ILP         T+ ++ GE    R    +K     C  FG  IMV S
Sbjct: 416 FILPGYFGFKLIGTDSLIVGEMIPKRDMFYKKCSQGLC-FFGLFIMVFS 463

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 56/122 (45%)

Query: 256 RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMV 315
           RG     +++    L    S+I FA V   N   I   L+  S+     +   S  IS +
Sbjct: 178 RGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVDSSILISTI 237

Query: 316 VCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRD 375
           + L  G  G+LTF S T GNIL N+ S    I   +FC    ++ TFPL    LR  I +
Sbjct: 238 LFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFHPLRTAINN 297

Query: 376 LI 377
           ++
Sbjct: 298 IV 299

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query: 380 ETPKG------EPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYI 433
           E PKG        +     R +IIT  L++S   ++L   +   +L LVG+T ++  ++I
Sbjct: 371 EPPKGGLNGVEHDVPFPETRFYIITALLLVSMYAMALNVKSFALVLSLVGATGSTSISFI 430

Query: 434 LPPMTNLILTGERRAA------KEK----LPHYACILFGFSIMVIS 469
           LP +    L G    A      KE           I FGF++M +S
Sbjct: 431 LPGLFGYKLIGTDALAIGHTMTKEDRLYRRLSLLLIYFGFAVMFLS 476

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 104/281 (37%), Gaps = 67/281 (23%)

Query: 256 RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMV 315
           RG  +   ++    L    S+I FA     N   I   L   S+R    + + S  IS  
Sbjct: 179 RGDVNWFSVYDWTGLCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGISTF 238

Query: 316 VCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRD 375
           + L+ G SG+LTF S T GNI+ N+     +    +FC G  ++ +FPL    LR  + +
Sbjct: 239 LFLLVGISGYLTFGSNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAVNN 298

Query: 376 L------------------ISTETPKGEPLRLSTK------------------------- 392
           +                  I + T    P+ L+                           
Sbjct: 299 MVIFYQINYGSNKENTSPNIRSNTSDLSPISLTINDDDIRSMPDDNVDDVLLSNEVTEIE 358

Query: 393 --------------RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMT 438
                         R + I+  L+L    +SLT  +   +L +VG+T  +  ++ILP + 
Sbjct: 359 ELDNVLCETPFPNHRFYTISLLLLLVMYSVSLTVTSFAYVLAIVGATGGTSISFILPGIF 418

Query: 439 NLILTGERRAAKEKLP------HYAC----ILFGFSIMVIS 469
              L G    A  ++       +  C     LFGFS+M  S
Sbjct: 419 GYKLIGSDSLAIGQMISDSDKFYKKCSLYLALFGFSVMFFS 459

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (52%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           L    S+I FA     N   +   L+  S+    S+ + S ++S  + LI G SG+LTF 
Sbjct: 190 LLSTFSIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFLIVGLSGYLTFG 249

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI 377
           +KT GN++ N+  +  +I   +FC G  ++ +FPL    LR  + ++I
Sbjct: 250 NKTLGNLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAVNNVI 297

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 125/328 (38%), Gaps = 61/328 (18%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLS----LNRNXXXXXXXXXXXXXXXX 238
           D +P +   +  N +   NR+  IT+V IF+  PL     LN                  
Sbjct: 104 DLLPQIWSVWTSNKL-LLNRDFHITMVMIFIVAPLCFMKKLNSLRYASMIAISAVAYLCV 162

Query: 239 XXXXXXXXRGP--TVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRK 296
                   + P  T   D +G   +     +P +   + +  FA  C HN   ++  + +
Sbjct: 163 LVIYHFIFQDPNDTHFQDLKGRISIGLPRDEPPILTTLPIFVFAYTCHHN---MFSVINE 219

Query: 297 PSLRRFNSLTHI---SCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFC 353
              ++FN +T I   S +++ ++ ++ GYSG+LTF  K  GNI+  +P++ +     R  
Sbjct: 220 QVDQKFNVITKIAKYSMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYPNNASS-TIGRIA 278

Query: 354 FGFNMLTTFPLEIFVLRDVIRDLI------------------------------------ 377
               +  TFPL+    R  I  +I                                    
Sbjct: 279 IAILVTLTFPLQCHPARASIHHIIHFFQARSAENGNGSAMVLNQMEGVSPELETTPLTDA 338

Query: 378 ------STETPKGEP-----LRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTT 426
                  T   +G P     + L  KR   IT  ++  +  ++++  +L  +L +VG+T 
Sbjct: 339 ANCAEVDTAIEEGSPEELQVMPLEGKRFIFITCTILFCSYLLAVSVTSLAKVLAIVGATG 398

Query: 427 ASLSAYILPPMTNLILTGERRAAKEKLP 454
           ++  ++ILP +    L G       +LP
Sbjct: 399 STSISFILPGIFGYKLIGSECETGAELP 426

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 104/238 (43%), Gaps = 46/238 (19%)

Query: 270 LFQGISVISFA----LVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGF 325
           LF G ++ +F     ++ L N      S+R PS  +F  +  +    + V+ +I    G+
Sbjct: 461 LFIGTAIFAFEGIGLIIPLQN------SMRDPS--KFPLVLGLVMICTTVMFIIIATIGY 512

Query: 326 LTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGE 385
           L++ S T+  IL NFP  +  +N  +  +   +L + PL+IF   +++ D I  + P  +
Sbjct: 513 LSYGSSTETIILQNFPQKNIVVNLIQLFYALAILLSTPLQIFPAIEIVEDKIFPK-PGSD 571

Query: 386 P------------------LRLSTK------RHFIITTALVLSTMGISLTTCNLGALLEL 421
           P                  L    K      R  I+T  ++L+  G    + NL  L+ +
Sbjct: 572 PECKDEIPITTIYNANSGGLDWRIKWFKNMIRTMIVTCVILLAYFG----SNNLDKLVAI 627

Query: 422 VGSTTASLSAYILPPMTNLI-----LTGERRAAKEKLPHYACILFGFSIMVISSTQAI 474
           +GS       Y+ PPM +L      ++  +R    K   Y  I+FG   MV ++ Q+I
Sbjct: 628 IGSLACIPLVYMYPPMLHLKTYSIPMSKGKRFTWSKSFDYILIVFGGVSMVYTTYQSI 685

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 97/237 (40%), Gaps = 39/237 (16%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           L     +  FA  C HN   I   LR  SL+    +  IS  +SM + L+ G SG+ TF 
Sbjct: 217 LLSCFPIFVFAYTCHHNMFSIINELRDNSLKGIYKVCAISVALSMTLYLLIGGSGYATFG 276

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVI---------------- 373
               GNI+  +P S       R      ++  FPL+    R  I                
Sbjct: 277 DNVPGNIITLYPQSTT-TTIGRVAIALLVMLAFPLQCHPARASIDHIIQYFSKASDNPLQ 335

Query: 374 --------------RDLISTETPKGEP--LRLSTKRHFIITTALVLSTMGISLTTCNLGA 417
                          D+++ E    +P  + L  KR   IT  +++ +  ++++  +L  
Sbjct: 336 NSEASHLISSPRVSEDVMAEEDSPQQPQVVPLEGKRFIAITAGILIFSFLLAISVTSLAR 395

Query: 418 LLELVGSTTASLSAYILPPMTNLIL------TGERRAAKEKLPHYACILFGFSIMVI 468
           +L +VG+T ++  ++ILP +    L      TG+  A  + L + + +L  + I V+
Sbjct: 396 VLAVVGATGSTSISFILPGIFGYQLIGSEHTTGQMPAQTKALKNLSLVLACWGIFVL 452

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 107/285 (37%), Gaps = 69/285 (24%)

Query: 254 DYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTIS 313
           + RG      ++    L    S+I FA     N   I   LR  ++    ++ + S  I+
Sbjct: 173 EVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIAIA 232

Query: 314 MVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVI 373
            V  +    +G+LTF S T GNI+ N+  +  Y++  +FC G  ++ TFPL     R  +
Sbjct: 233 TVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHPCRIAV 292

Query: 374 RDL--------------------ISTETPKG-EPLRLSTK-------------------- 392
            +L                    ++  TP    P+ LS +                    
Sbjct: 293 NNLCVWAQLQREKRAESHQECEPLNPNTPSSVRPISLSVQDSDSRSLVNSYGATQGNEEI 352

Query: 393 ------------------RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYIL 434
                             R +IIT  L+++   ++L   +   +L  VG+T ++  ++ L
Sbjct: 353 EDLEVAGNGSPHVNIPDGRFYIITALLLIAMYALALNVNSFATVLAFVGATGSTSISFTL 412

Query: 435 PPMTNLILTG-ERRAAKEKLP---------HYACILFGFSIMVIS 469
           P +    L G +  AA + +P          +    FG  +M +S
Sbjct: 413 PGLFGYKLIGTDYLAAGQVIPSLEVFYKRCSFLLTWFGLGVMFLS 457

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (52%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           L    S+I FA     N   +   L+  S+     + + S T+S ++ LI G SG+LTF 
Sbjct: 190 LLSTFSIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLSTILFLIVGLSGYLTFG 249

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI 377
           +KT GN++ N+  +  +I   +FC G  ++ +FPL    LR  + ++I
Sbjct: 250 NKTSGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLRVAVNNVI 297

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 122/313 (38%), Gaps = 41/313 (13%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPL----SLNRNXXXXXXXXXXXXXXXX 238
           D +P +   F  ++I   NR+  I+++ +F+  PL     LN                  
Sbjct: 104 DLMPQIFAVFTTSHI-LLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCV 162

Query: 239 XXXXXXXXRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPS 298
                   +   V +D +G   +     +P     + +  FA  C HN   +       +
Sbjct: 163 LVVAHFIFQTEDV-HDLKGVVSIGLPKHEPSPLTTLPIFVFAYTCHHNFFSVINEQSNIA 221

Query: 299 LRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNM 358
                 +  I+  ++ ++ ++ G+SG+LTF     GNI+  +P + +     R    F +
Sbjct: 222 FTHIKKIPIIAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGRLAIVFLV 280

Query: 359 LTTFPLEIFVLRDVIR--------------------------------DLISTETPKG-E 385
           +  FPL+    R  I                                 +LI  ++PK  E
Sbjct: 281 MLAFPLQCHPCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEEDSPKQPE 340

Query: 386 PLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTG- 444
            + L  KR  IIT  ++L +  ++++  +L  +L +VG+T ++  ++ILP +    L G 
Sbjct: 341 EIPLRGKRFNIITVCILLFSYTLAISVNSLAKVLAIVGATGSTSISFILPGIFGFKLIGS 400

Query: 445 ERRAAKEKLPHYA 457
           E  A    LP  A
Sbjct: 401 EFSATSSPLPKSA 413

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%)

Query: 256 RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMV 315
           RG+    E++    L    S+I FA V   N   I   L   ++   + + + S  IS V
Sbjct: 178 RGTILWFEIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTV 237

Query: 316 VCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRD 375
             L  G +G+LTF S T GNI+ N+  +  ++N  +F     +L +FPL    LR    +
Sbjct: 238 AFLSVGITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLRIACNN 297

Query: 376 LI 377
           L+
Sbjct: 298 LV 299

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 10/88 (11%)

Query: 392 KRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKE 451
            R + IT  L++    I+L   +   +L LVG+T ++  ++ILP +    L G    A  
Sbjct: 378 SRFYSITVGLLVVMYLIALRITSFALVLALVGATGSTSISFILPGLFGYKLIGSDSLAVG 437

Query: 452 KL--PH--------YACILFGFSIMVIS 469
           ++  P          A + FGF++M++S
Sbjct: 438 QMISPRDRFYKKCSLALVWFGFAVMILS 465

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 119/306 (38%), Gaps = 48/306 (15%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXX 242
           D +P +  A F ++    +RN+ IT+V +FV  PL   +                     
Sbjct: 104 DLMPRIF-ATFTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCV 162

Query: 243 XXXXRGPTVGND---YRGSFDLEELFVKP-----RLFQGISVISFALVCLHNTSFIYFSL 294
                     ++    RG   L     KP      L     +  FA  C HN   I   L
Sbjct: 163 LVLVHYVWPSDEIRELRGHVSLG----KPVGSFAALLSCFPIFVFAYTCHHNMFSIVNEL 218

Query: 295 RKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCF 354
           R  SL+    ++ IS  ++M + L+ G SG+ TF     GNI+  +P S       R   
Sbjct: 219 RDNSLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYPQSAA-TTVGRVAI 277

Query: 355 GFNMLTTFPLEIFVLRDVIRDLI------------------------STET-----PKGE 385
              ++  FPL+    R  +  ++                        S++T      +G 
Sbjct: 278 ALLVMLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVEEGG 337

Query: 386 PLRLST-----KRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNL 440
           P +L+      KR   ITT+++L +  ++++  +L  +L +VG+T ++  ++ILP +   
Sbjct: 338 PRQLAVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILPGIFGF 397

Query: 441 ILTGER 446
            L G  
Sbjct: 398 QLIGSE 403

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 104/249 (41%), Gaps = 54/249 (21%)

Query: 279 FALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILN 338
           FA  C HN   I   LR  SL     +  I+  +++ +  + G SG+LTF     GNI+ 
Sbjct: 204 FAYTCHHNMFSIVNELRDNSLTNCVRVVLIAMGLAVSLYTVIGGSGYLTFGDNITGNIVT 263

Query: 339 NFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDL------------ISTE------ 380
            +P S +    AR      ++  FPL+    R  I ++            ++ E      
Sbjct: 264 IYPRSVSS-TLARIAIVLLVMLAFPLQCHPARASINNIWCYFSESKIFSPLANEESGLMR 322

Query: 381 ----------------TPKGEPLRLST-----------KRHFIITTALVLSTMGISLTTC 413
                           +P   PL+ S+           KR F+ITT++++++  ++++  
Sbjct: 323 HEGSPRTPPSNNEFSISPDWSPLQTSSQPIPTTTTIEGKRFFVITTSILIASYTLAVSVS 382

Query: 414 NLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKE--------KLPHYACILFGFSI 465
           +   +L +VG+T ++  ++ILP +      G   +AK+        K   +A  ++G  +
Sbjct: 383 SFARVLAIVGATGSTSISFILPGIFGYHFVGSEYSAKDIPRNLKILKYLAFALTIWGIIV 442

Query: 466 MVISSTQAI 474
           M    T A+
Sbjct: 443 MFTCLTAAV 451

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           L    S+I FA     N   +   L+  S+     + + S ++S  + LI G SG+LTF 
Sbjct: 190 LLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYLTFG 249

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI 377
           ++T GN++ N+  +  +I   +FC G  ++ +FPL    LR  + ++I
Sbjct: 250 NETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVI 297

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 90/234 (38%), Gaps = 47/234 (20%)

Query: 267 KPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFL 326
           +P     + +  FA  C HN   +       S      L  I+ +++  + +I G SG+ 
Sbjct: 204 EPSPLVTLPIFVFAYTCHHNMFSVINEQIDNSFHNIKKLAIIAMSLAFSLYIIIGGSGYY 263

Query: 327 TFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDL---------- 376
           TF     GNI+  +P S +     R    F +   FPL+    R  I  +          
Sbjct: 264 TFGDNIVGNIITLYPQSVSS-TIGRMAIVFLVTLAFPLQCHPARASIHHIILYITMKIND 322

Query: 377 ---ISTETPKGEPLRLST---------------------------------KRHFIITTA 400
              I    P+ EPL LS                                  K+  +ITT+
Sbjct: 323 AKEIKPSNPQQEPLALSANNQERAMLIRSERSDTLIEEESPLQPVTVPLEGKQFILITTS 382

Query: 401 LVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLP 454
           +++ +  ++++  +L  +L +VG+T ++  ++ILP +    L G      E+LP
Sbjct: 383 ILICSYLLAISVSSLAHVLAIVGATGSTSISFILPGVFGYKLIGSEMLTTEQLP 436

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 81/174 (46%), Gaps = 14/174 (8%)

Query: 311 TISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLR 370
           TI  + C +  YS F    +K +  IL NFPS+  + N  +  +   +L + PL++F   
Sbjct: 409 TIIFISCGLICYSAF---GAKVETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFPAI 465

Query: 371 DVIRDLISTETPKGE-----PLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGST 425
            ++ + I  +   G+       R +  R F++  A++++ +G +    +L   + L+GS 
Sbjct: 466 KILENKIFHKNASGKFDAKVKWRKNYFRAFVVLIAVIIAWIGAN----DLDKFVSLIGSF 521

Query: 426 TASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIH 479
                 YI PP+ +  +    +  K +    A ++FG  +M  +S Q I   IH
Sbjct: 522 ACIPLIYIYPPLFHYKVFENNK--KLQAIDLAILIFGALVMSYTSWQTIALWIH 573

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 55/108 (50%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           L    S+I FA     N   +   L+  S+     + + S ++S  + LI G SG+LTF 
Sbjct: 190 LLSTFSIIIFAYTGSMNLFPMINELKDNSMGNITLVINNSISLSTALFLIVGLSGYLTFG 249

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI 377
           + T GN++ N+  +  +I   +FC G  ++ +FPL    LR  + ++I
Sbjct: 250 NSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLFQPLRVAVNNVI 297

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 65/132 (49%), Gaps = 1/132 (0%)

Query: 256 RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMV 315
           RG  +   ++    L    S+I FA     N   I   L+  S+   +S+ + S +IS +
Sbjct: 176 RGQVNWFTVYDFKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTI 235

Query: 316 VCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRD 375
           + L  G +G+LTF   T GNIL N+ +   +++ A+FC    ++ +FPL    LR  + +
Sbjct: 236 LFLTVGIAGYLTFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLRIAVNN 295

Query: 376 LIS-TETPKGEP 386
           L+   E   G P
Sbjct: 296 LVVWLEINYGTP 307

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%)

Query: 254 DYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTIS 313
           ++RG      ++ K  L    ++I FA     N   I   L+  S++  N +   S + S
Sbjct: 174 EFRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSISTS 233

Query: 314 MVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPL 364
             + L  G  G+LTF S   GNI+ N+     +    + C G  ++ +FPL
Sbjct: 234 AALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPL 284

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 10/95 (10%)

Query: 385 EPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTG 444
           E +    +R +IIT  LV+S   ++L   +   +L LVG+T ++  ++ LP +    L G
Sbjct: 365 EVVPFPNQRFYIITAVLVISLYVLALNVSSFALVLALVGATGSTAISFTLPGLFGYKLIG 424

Query: 445 ERRAAKEKLP----------HYACILFGFSIMVIS 469
            + A   +L             A  ++G ++M +S
Sbjct: 425 SQAARNGQLMSRSDKFLKSCSLALAIYGLAVMFLS 459

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 82/179 (45%), Gaps = 14/179 (7%)

Query: 307 HISCTISMVVCLIA------GYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           H   ++S V+C++A      G   +  F S  K  +L NFP   +Y    +  +   +L 
Sbjct: 512 HFRPSLSAVMCIVAVIFISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQLLYALAILL 571

Query: 361 TFPLEIFVLRDVIRDLI--STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGAL 418
           + PL++F    ++ +    S  + K  P ++   +++     +VL+++   +   +L   
Sbjct: 572 STPLQLFPAIRILENWTFPSNASGKYNP-KVKWLKNYFRCAIVVLTSILAWVGANDLDKF 630

Query: 419 LELVGSTTASLSAYILPPMTNL---ILTGERRAAKEKLPHYACILFGFSIMVISSTQAI 474
           + LVGS       YI PP+ +    IL+G  RA    L     I+FG ++M  +S Q I
Sbjct: 631 VSLVGSFACIPLIYIYPPLLHYKASILSGTSRA--RLLLDLIVIVFGVAVMAYTSWQTI 687

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 3/120 (2%)

Query: 248 GPTVGNDY---RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNS 304
           G  + +DY   RG     +++    L    S+I FA  C  N   I   L   S+     
Sbjct: 166 GVVLHDDYKYTRGDVFWVKVYDYNGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTK 225

Query: 305 LTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPL 364
           + + S  I+  + L  G +G+LTF S   GNI+ N+     +    +FC G  ++ +FPL
Sbjct: 226 VANSSIGIATFLILSVGITGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPL 285

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 79/183 (43%), Gaps = 13/183 (7%)

Query: 307 HISCTISMVVCLI------AGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           H S  +SMV+C++       G   +  F SK +  +L NFP    Y    +  +   +L 
Sbjct: 489 HFSKCLSMVMCIVTVIFISCGLLCYSAFGSKVETVVLLNFPHDSPYTLMVQLLYALAILL 548

Query: 361 TFPLEIFVLRDVIRDLI--STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCN-LGA 417
           + PL++F    ++ +     + + K  P     K +F     +VL T  I+    N L  
Sbjct: 549 STPLQLFPAIKILENWCFPISASGKNNPKVKWLKNYF--RCIIVLLTAFIAYVGANDLDK 606

Query: 418 LLELVGSTTASLSAYILPPMTNL-ILTGERRAAKEKLPHYACILFGFSIMVISSTQAIIT 476
            + LVGS       YI PP+ +L    GE+   +  L     I FG ++M  +S Q I  
Sbjct: 607 FVSLVGSFACIPLIYIYPPLLHLKAYWGEQTILRMVLDSLVLI-FGVAVMGYTSWQTIAM 665

Query: 477 AIH 479
            +H
Sbjct: 666 WLH 668

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 105/241 (43%), Gaps = 47/241 (19%)

Query: 274 ISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTK 333
           + +  FA  C HN   +       S +    +  ++ +++ V+ ++ G +G++TF     
Sbjct: 209 LPIFVFAYTCHHNMFSVINEQADKSFKILRRIPILAISLAYVLYVVIGGTGYMTFGDNIV 268

Query: 334 GNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI---------------- 377
           GNI+  +P+S  Y    R      +   FPL+    R  I+++I                
Sbjct: 269 GNIITLYPNSI-YTTIGRLAMLLLVTLAFPLQCHPCRSSIKNMIVFIKNLRKDKTDDSTA 327

Query: 378 --------STETPKGE-----------PLRLSTKRHFIITTALVLSTMGISLTTCNLGAL 418
                   S+E P+ E           P+  S+++  +IT  +++ +  ++++  +L  +
Sbjct: 328 GFIPLDDLSSEDPQEEVAQQNNEQSNLPIE-SSRQTNVITLCILIFSYLLAISITSLAKV 386

Query: 419 LELVGSTTASLSAYILPPMTNLILTG-------ERRAAKEKLPHYACIL---FGFSIMVI 468
           L +VG+T ++  ++ILP +    L G       +R   + KL  Y  +L   +G ++MV 
Sbjct: 387 LAIVGATGSTSISFILPGLFGYKLIGSEFTNSNDRVPTRVKLFKYLGLLLFIWGIAVMVA 446

Query: 469 S 469
           S
Sbjct: 447 S 447

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 20/182 (10%)

Query: 307 HISCTISMVVCLIA------GYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           H   ++S V+C++A      G   +  F S  K  +L NFP   +Y    +  +   +L 
Sbjct: 500 HFRPSLSAVMCIVAVVFISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQLLYALAILL 559

Query: 361 TFPLEIFVLRDVIRDLI--STETPKGEPLRLSTKRHF---IITTALVLSTMGISLTTCNL 415
           + PL++F    ++ +    S  + K  P     K +F   I+    VL+ +G +    +L
Sbjct: 560 STPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVVLTSVLAWVGAN----DL 615

Query: 416 GALLELVGSTTASLSAYILPPMTNLI---LTGERRAAKEKLPHYACILFGFSIMVISSTQ 472
              + LVGS       YI PP+ +     ++G  RA    L     I+FG ++MV +S Q
Sbjct: 616 DKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRA--RLLLDLIVIVFGVAVMVYTSWQ 673

Query: 473 AI 474
            I
Sbjct: 674 TI 675

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 86/203 (42%), Gaps = 31/203 (15%)

Query: 271 FQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKS 330
           F+ + +  FA  C HN   +    +    +R   +  I+ +I+ ++ LI G  G+ TF +
Sbjct: 187 FKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAISIACILYLIVGCLGYATFGA 246

Query: 331 KTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPK------- 383
               NI+  +P++       +      +   +PL+    R  I +++    PK       
Sbjct: 247 NITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPARASILNILYALFPKLKNNKSD 306

Query: 384 --------------------GEPLRL----STKRHFIITTALVLSTMGISLTTCNLGALL 419
                                EP R+    S   H I+T+ ++  +  I+++  +L  +L
Sbjct: 307 VEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSIVTSLILFGSWCIAVSVNSLAQVL 366

Query: 420 ELVGSTTASLSAYILPPMTNLIL 442
            +VG+T ++  ++ILP +  ++L
Sbjct: 367 AIVGATGSTFISFILPGLFAVVL 389

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 77/171 (45%), Gaps = 11/171 (6%)

Query: 309 SCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFV 368
           S +++ +VC +  YS F       K  IL NFP         +  +   +L + PL++F 
Sbjct: 445 SVSVAFIVCGLLCYSAF---GDSVKIVILLNFPRDSAMTATVQLLYALAILLSTPLQLF- 500

Query: 369 LRDVIRDLISTETPKGEPLRLSTKRHFI---ITTALVLSTMGISLTTCN-LGALLELVGS 424
              +IR L ++  PK    + + +  ++      A+VL  M I+    N L   + LVGS
Sbjct: 501 --PIIRILETSIFPKDASGKYNPRVKWMKNYFRVAIVLLNMLIAWLGANDLDKFVSLVGS 558

Query: 425 TTASLSAYILPPMTNLILTGERRAAKEKLPHYACI-LFGFSIMVISSTQAI 474
                  YI PPM +     +  A+K  L     I  FG ++M+ ++ QA+
Sbjct: 559 FACIPLIYIYPPMLHYKTFAQGGASKLALLGDQLIAFFGVAVMIYTTYQAV 609

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 95/209 (45%), Gaps = 10/209 (4%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           LF G ++ +F  + L     I  S+R P+  R  SL+ + C ++ VV +  G   +  F 
Sbjct: 505 LFIGTAIFTFEGIGL--LIPIQESMRHPNHFR-PSLSAVMCIVA-VVFISCGLLCYAAFG 560

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI--STETPKGEPL 387
           +  K  +L NFP + +Y    +  +   +L + PL++F    ++ +    S  + K  P 
Sbjct: 561 ADVKTVVLLNFPQNSSYTLTVQLLYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPK 620

Query: 388 RLSTKRHFIITTALVLSTMGISLTTCN-LGALLELVGSTTASLSAYILPPMTNLILTGER 446
               K +F    A+VL T  ++    N L   + LVGS       YI PP+ +   +   
Sbjct: 621 VKWLKNYF--RCAIVLLTSILAWVGANDLDKFVSLVGSFACVPLIYIYPPLLHFKASSIS 678

Query: 447 RAAKEK-LPHYACILFGFSIMVISSTQAI 474
             ++ + L     I FG ++MV +S Q I
Sbjct: 679 GTSRGRLLLDLIVISFGVAVMVYTSWQTI 707

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 87/221 (39%), Gaps = 34/221 (15%)

Query: 267 KPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFL 326
           +P     + +  FA  C HN   +    +         +  +S  ++ V+ ++ G +G+L
Sbjct: 189 EPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFTYVRYIAIVSILVAFVLYVVIGSTGYL 248

Query: 327 TFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGEP 386
           TF     GNI+  +P + +     R      ++  FPL+    R+ I ++I     +  P
Sbjct: 249 TFGDNITGNIIALYPDTLS-TTIGRIAIVLLVMLAFPLQCHPARESINNMIKYVQDRYSP 307

Query: 387 LR--------------------------------LSTKRHFIITTALVLSTMGISLTTCN 414
                                             + TKR  IIT  ++  +  ++++  +
Sbjct: 308 QTSYELTAVDADNLEINNDVTSINSRANDKEEECMDTKRFMIITACILFCSYLLAISVTS 367

Query: 415 LGALLELVGSTTASLSAYILPPMTNLILTG-ERRAAKEKLP 454
           L  +L +VG+T ++  ++ILP      L G E  +   +LP
Sbjct: 368 LARVLAIVGATGSTTISFILPGYFGWSLIGTEYTSNGNQLP 408

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 92/216 (42%), Gaps = 36/216 (16%)

Query: 274 ISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTK 333
           + +  FA  C HN   +       S +    +   +  ++  + +I G +G++TF     
Sbjct: 209 LPIFVFAYTCHHNMFSVINEQVDKSFKVIRRIPIFAIVLAYFLYIIIGGTGYMTFGENIV 268

Query: 334 GNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI---------------- 377
           GNIL  +P+S +     R      ++  FPL+    R  ++++I                
Sbjct: 269 GNILTLYPNSIS-TTIGRLAMLLLVMLAFPLQCHPCRSSVKNIIIFIENFRKGKLYDNRA 327

Query: 378 --------STETPKGEP---------LRLSTKRHF-IITTALVLSTMGISLTTCNLGALL 419
                   ++E P+  P         LR  + RH  IIT  ++L +  ++++  +L  +L
Sbjct: 328 SFIPLDNFNSEDPQEAPTQQNNEEPNLRSESLRHINIITLCILLFSYLLAISITSLAKVL 387

Query: 420 ELVGSTTASLSAYILPPMTNLILTG-ERRAAKEKLP 454
            +VG+T ++  ++ILP +    L G E     E++P
Sbjct: 388 AIVGATGSTSISFILPGLFGYKLIGSEFTGTNERVP 423

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 92/245 (37%), Gaps = 52/245 (21%)

Query: 279 FALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILN 338
           FA  C HN   I    +         +  IS ++++ + +  G +G+LTF     GNI+ 
Sbjct: 204 FAYTCHHNMFSIINEQKSVRFEHVMKIPLISISLALALYIAIGCAGYLTFGDNIIGNIIM 263

Query: 339 NFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTET----------------- 381
            +P + +     R      ++  FPL+    R  I  ++   T                 
Sbjct: 264 LYPQTVSS-TVGRIAIVLLVMLAFPLQCHPARASIHQILQYFTEENATTSTTSVAGRTVT 322

Query: 382 -------------------------PKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLG 416
                                    PK  PLR   K   IIT  +++++  ++++  +L 
Sbjct: 323 NESSPLIRNNSIDINEVIEEEPIYQPKDTPLR--GKSFIIITCGILVASYCVAISVSSLA 380

Query: 417 ALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPH-------YACILFGFSIMVIS 469
            +L +VG+T ++  ++ILP +    L G    A   LP         A  + G  IMV  
Sbjct: 381 HVLAIVGATGSTSISFILPGLFGYKLIGTEHKADIPLPTRLFKYSGLALFVLGLLIMVTC 440

Query: 470 STQAI 474
            T A+
Sbjct: 441 LTAAL 445

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%)

Query: 256 RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMV 315
           RG      ++    L    +++ FA     N   I   L+  S+   N +   + TIS  
Sbjct: 179 RGDVSWIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVSTTITISSF 238

Query: 316 VCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRD 375
           + L  G  G+LTF S T GNI+ N+  +  +    + C G  ++ +FPL +   R    +
Sbjct: 239 LFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPLLLHPCRIAANN 298

Query: 376 LI 377
           ++
Sbjct: 299 MV 300

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 10/97 (10%)

Query: 383 KGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLIL 442
           K E +    KR +IIT  LV S   ++L   +   +L LVG+T ++  ++ LP +    L
Sbjct: 366 KTEVVPFPNKRFYIITAILVTSLYILALNVSSFALVLALVGATGSTAISFTLPGLFGYKL 425

Query: 443 TGERRAAKEKLP----------HYACILFGFSIMVIS 469
            G + A    L             A  L+G  +M +S
Sbjct: 426 IGSQAARSGMLMSGSDRFYRGCSLALTLYGLGVMFLS 462

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 92/216 (42%), Gaps = 36/216 (16%)

Query: 274 ISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTK 333
           + +  FA  C HN   +       + R    +   + + + ++ LI G +G++TF     
Sbjct: 209 LPIFVFAYTCHHNMFSVINEQTDKTFRILRRIPIFAISFAYILYLIIGGAGYMTFGENIV 268

Query: 334 GNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIR------------------- 374
           GNIL  +P+S +     R      ++  FPL+    R  I+                   
Sbjct: 269 GNILTLYPNSIS-TTIGRLAMLLLVMLAFPLQCHPCRSSIKNIFIFIEDFRKGRLHDNRT 327

Query: 375 --------------DLISTETPKGEPLRLSTKRHF-IITTALVLSTMGISLTTCNLGALL 419
                         D +S ++ +G  LR  ++RH  +IT  +++ +  ++++  +L  +L
Sbjct: 328 GFIPLDDFNSEEPHDELSQQSSEGPTLRSESQRHTNVITLCVLVFSYILAISITSLAKVL 387

Query: 420 ELVGSTTASLSAYILPPMTNLILTG-ERRAAKEKLP 454
            +VG+T ++  ++ILP +    L G E     E++P
Sbjct: 388 AIVGATGSTSISFILPGLFGYKLIGSEFTNRNERVP 423

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 84/186 (45%), Gaps = 5/186 (2%)

Query: 293 SLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARF 352
           S++ P   +  SL  +   I++V   I G  G+  F S     +L NFP  +   +  + 
Sbjct: 336 SMKSPHHFK-KSLILVLVIITLVFITI-GLLGYSAFGSNVDTVLLQNFPQDNPCTSLVQL 393

Query: 353 CFGFNMLTTFPLEIFVLRDVIRDLISTETPKGE-PLRLSTKRHFIITTALVLSTMGISLT 411
            +   +L + PL++F    ++ + I ++   G+    +   +++  +T ++L+++   L 
Sbjct: 394 LYSLAILLSTPLQLFPAIKILENWIFSKDASGKYNHSIKWAKNYFRSTIVILTSLISYLG 453

Query: 412 TCNLGALLELVGSTTASLSAYILPPMTNLILT--GERRAAKEKLPHYACILFGFSIMVIS 469
             +L   + LVGS       Y+ PP+ +   T        K  L  ++ + FG   M+ +
Sbjct: 454 ANDLNKFVALVGSFACIPLIYVYPPLLHYKATQLDNTFTWKTLLADFSLLTFGIITMIYT 513

Query: 470 STQAII 475
           S Q II
Sbjct: 514 SLQTII 519

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%)

Query: 275 SVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKG 334
           S+I FA     N   I   L++ S+     + + S  +S    +I G  G+LTF  +T G
Sbjct: 188 SIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIILGLFGYLTFGKETLG 247

Query: 335 NILNNFPSSDNYINFARFCFGFNMLTTFPL 364
           N++ N+ +    + FARF  G  ++ +FPL
Sbjct: 248 NVILNYDADKLSVRFARFNLGLMVVLSFPL 277

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 90/218 (41%), Gaps = 47/218 (21%)

Query: 279 FALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILN 338
           FA  C HN   I    R         +  I+ ++++++ +  G +G+LTF     GNI+ 
Sbjct: 204 FAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYVAIGCAGYLTFGDNIIGNIIM 263

Query: 339 NFPSSDNYINFARFCFGFNMLTTFPLEIFVLR---------------------------- 370
            +P + +     R      ++  FPL+    R                            
Sbjct: 264 LYPQTTSS-TVGRVAIVLLVMLAFPLQCHPARASIHQILQHFTEENATISTTSTSSPAPT 322

Query: 371 ----DVIRD-------LISTET---PKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLG 416
                +IRD       +I  E+   PK  PL+   K   +IT A+++++  ++++  +L 
Sbjct: 323 NESSPLIRDNSLDINEVIEEESIYQPKETPLK--GKSFIVITCAILIASYFVAISVSSLA 380

Query: 417 ALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLP 454
            +L +VG+T ++  ++ILP +    L G     KE +P
Sbjct: 381 RVLAIVGATGSTSISFILPGLFGYKLIGTEH--KEGIP 416

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 99/235 (42%), Gaps = 38/235 (16%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           LF G ++ +F  + L     I  S++ P   +F  +  +    + V+ +     G+L++ 
Sbjct: 490 LFVGTAIFAFEGIGLIIP--IQSSMKHP--EKFPLVMALVIITATVLFVSVATLGYLSYG 545

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTE--------- 380
           ++T+  IL N P     +N  +F +   +L + PL++F    +I + +  +         
Sbjct: 546 AETQTVILLNLPQDSILVNLIQFFYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRS 605

Query: 381 -------TPKGEPLRLSTK------RHFIITTALVLSTMGISLTTCNLGALLELVGSTTA 427
                   P    L    K      R  I+++ ++ +  G +    +L A + +VGS   
Sbjct: 606 DHTKIQYKPNSGKLDWRIKWLKNFVRSLIVSSVVIAAYFGAN----HLDAFVAIVGSLAC 661

Query: 428 SLSAYILPPMTNLILTGERRAAKEK--------LPHYACILFGFSIMVISSTQAI 474
               YI PPM +L    + R A EK        L  Y  ++FG   MV +S Q+I
Sbjct: 662 IPLVYIYPPMLHLRSCSKPRFAGEKSVWRKWPILLDYVLVVFGAIGMVYTSYQSI 716

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 77/180 (42%), Gaps = 16/180 (8%)

Query: 307 HISCTISMVVCLIA------GYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLT 360
           H   ++S V+C++A      G   +  F +  K  +L NFP   +Y    +  +   +L 
Sbjct: 539 HFQPSLSAVMCIVAVVFISCGLLCYAAFGADVKTVVLLNFPQDSSYTLTVQLLYALAILL 598

Query: 361 TFPLEIFVLRDVIRDLI--STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCN-LGA 417
           + PL++F    ++ +    S  + K  P     K +F    A+VL T  ++    N L  
Sbjct: 599 STPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYF--RCAIVLLTSVLAWVGANDLDK 656

Query: 418 LLELVGSTTASLSAYILPPMTN---LILTGERRAAKEKLPHYACILFGFSIMVISSTQAI 474
            + LVGS       YI PPM +     L+G  RA    L     + FG  +M  +S Q I
Sbjct: 657 FVSLVGSFACIPLIYIYPPMLHYKAFSLSGISRA--RLLLDLVVLSFGVVVMAYTSWQTI 714

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 101/245 (41%), Gaps = 52/245 (21%)

Query: 279 FALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILN 338
           FA  C HN   I    R         +  I+ ++++++ +  G +G+LTF     GNI+ 
Sbjct: 204 FAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYIAIGCAGYLTFGDNIIGNIIM 263

Query: 339 NFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDL--------------------IS 378
            +P + +     R      ++  FPL+    R  I  +                    ++
Sbjct: 264 LYPQAVSS-TIGRIAIVLLVMLAFPLQCHPARASIHQILQHFAEENVSISATSADEPTVA 322

Query: 379 TET----------------------PKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLG 416
           TE+                      PK  PLR   K   +IT ++++++  ++++  +L 
Sbjct: 323 TESSPLIRDSSLDLNEVIEEESIYQPKETPLR--GKSFIVITCSILVASYLVAISVSSLA 380

Query: 417 ALLELVGSTTASLSAYILPPMTNLILTG-ERRAA---KEKLPHYACIL---FGFSIMVIS 469
            +L +VG+T ++  ++ILP +    L G E + A     K+  Y  +L   +G  IM+  
Sbjct: 381 RVLAIVGATGSTSISFILPGLFGYKLIGTEHKTAVPLTTKIFKYTGLLLFIWGLIIMITC 440

Query: 470 STQAI 474
            T A+
Sbjct: 441 LTAAL 445

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/303 (19%), Positives = 106/303 (34%), Gaps = 55/303 (18%)

Query: 200 FNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRGPTVGND---YR 256
            NR+  IT+V IFV  PL L +                            +   D    +
Sbjct: 121 LNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIHLVSSDGDIEQMK 180

Query: 257 GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVV 316
           G   +      P     + +  FA  C HN   +    +    +    +  IS +++ ++
Sbjct: 181 GHVSIGLPHHGPSPLTTLPIFVFAYTCHHNMFSVINEQKDNRFKTTKYIPLISTSLACIL 240

Query: 317 CLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIR-- 374
            ++ G  G++TF  K  GNI+  +P S + I   R      +   FPL+    R  I   
Sbjct: 241 YILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFPLQCHPARSSIHNI 299

Query: 375 ----------DLISTETP---------------------------------------KGE 385
                     DL +T+ P                                       K  
Sbjct: 300 LAFFYPSLNPDLKNTQEPTANADTMSSSQLLATERTPLVRSISSIEDNELAEEQGSIKDV 359

Query: 386 PLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGE 445
           P+ +  K    IT A+++ +  ++++  +L  +L +VG+T ++  ++ILP +    L G 
Sbjct: 360 PIEMERKLFLAITAAILIPSYLVAMSVHSLDKVLAIVGATGSTSISFILPGIFGYRLIGS 419

Query: 446 RRA 448
             A
Sbjct: 420 DGA 422

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 9/172 (5%)

Query: 308 ISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIF 367
           +  T+  + C    YS F    +  K  IL NFP    +    +F +   +L + PL++F
Sbjct: 446 LGITVIFISCGCLCYSAF---GADVKTVILLNFPQDSIFTGGVQFSYALAILLSTPLQLF 502

Query: 368 VLRDVIRDLI--STETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCN-LGALLELVGS 424
               ++ + +  S  + K  P     K +F     +V++++ I+    N L   + LVGS
Sbjct: 503 PAIRILENAVFPSHASGKHNPKVKWLKNYF--RCFVVIASVAIAWVGANDLDKFVSLVGS 560

Query: 425 TTASLSAYILPPMTNL-ILTGERRAAKEKLPHYACILFGFSIMVISSTQAII 475
                  YI PPM +     G   +  + +     + FG +IMV  S Q ++
Sbjct: 561 LACIPLIYIYPPMLHYKAFRGTNISRHDLVLDQVVLWFGIAIMVYISLQTVL 612

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 85/188 (45%), Gaps = 11/188 (5%)

Query: 293 SLRKPSLRRFN-SLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFAR 351
           S+ KP L R + SL  +  T+  V   +  YS F    S  +  +L NFP    Y    +
Sbjct: 388 SMAKPHLFRLSLSLVMVIVTLIFVSVGLLCYSAF---GSDVETVVLLNFPQDSPYTLIVQ 444

Query: 352 FCFGFNMLTTFPLEIFVLRDVIRDLI--STETPKGEPLRLSTKRHFIITTALVLSTMGIS 409
             +   +L + PL++F    ++ + +  S  + K  P     K +F   T +V+ T  I+
Sbjct: 445 LLYSLAILLSTPLQLFPAIRILENWVFKSRYSGKYNPKIKWAKNYF--RTLVVIGTSFIA 502

Query: 410 -LTTCNLGALLELVGSTTASLSAYILPPMTNL-ILTGERRAAKEKLPHYAC-ILFGFSIM 466
            +   +L   + LVGS       YI PP+ ++  L          L   +C I+FGF+I+
Sbjct: 503 WIGADDLDKFVSLVGSFACIPLIYIYPPLLHIKALKRNGTVTNLHLIVDSCMIIFGFTIL 562

Query: 467 VISSTQAI 474
           + +S Q I
Sbjct: 563 IYTSCQTI 570

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 78/207 (37%), Gaps = 7/207 (3%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXX 242
           D +P VL  F  N+    NRN+ IT+V +F+  PL   +N                    
Sbjct: 104 DVLPQVLSTF-TNHEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCA 162

Query: 243 XXXXRGPTVGNDYRGSFDLEELFVKPR----LFQGISVISFALVCLHNTSFIYFSLRKPS 298
                   + ND   +F  +  +  P+        + +  FA  C HN   +      P+
Sbjct: 163 LVLIHF-IMPNDETHNFKGDVSWGLPKNGLNPLTTLPIYVFAYTCHHNMFSVINEQMDPT 221

Query: 299 LRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNM 358
                 +  IS  ++  + ++ G +G+LTF     GNI+  +P + +     R    F +
Sbjct: 222 YNSVKKIAIISMILAGFLYILIGGAGYLTFGDHITGNIITLYPQNIS-TTIGRIAIIFLV 280

Query: 359 LTTFPLEIFVLRDVIRDLISTETPKGE 385
              FPL+    R  I  +I    P  +
Sbjct: 281 TLAFPLQCHPARASINHIIHYFKPAQD 307

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/341 (19%), Positives = 121/341 (35%), Gaps = 84/341 (24%)

Query: 183 DSIPHVLRAFFPNYIEYF-NRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXX 241
           D +P +L  F     E+F NRN+ ITIV +F+  PL   +N                   
Sbjct: 104 DVMPQILGTF--TDTEFFLNRNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLC 161

Query: 242 XXXX------------XRGPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSF 289
                            RGP        S+   +  + P     + +  FA  C HN   
Sbjct: 162 FLVMFHFFIPNEEIRDTRGPV-------SWGFPKDGLNP--LNTLPIFVFAYTCHHN--- 209

Query: 290 IYFSLRKPSLRRFNSLTHISCTISMVVC---LIAGYSGFLTFKSKTKGNILNNFPSSDNY 346
           ++  + +     FN L  I     ++ C   +I G SG+LTF +   GNI+  + S+   
Sbjct: 210 MFSVINEQQDIHFNKLKQICIFAMLLACTLYIIIGGSGYLTFGNAITGNIITLY-SNSAA 268

Query: 347 INFARFCFGFNMLTTFPLEIFVLRDVIR-------------------------------- 374
               R      ++  FPL+    R  I                                 
Sbjct: 269 TTVGRIAIVILVMLAFPLQCHPARASINHILHYFQLINCDNNQVQESESGHRESSGLIDN 328

Query: 375 -----------------DLISTETPKG----EPLRLSTKRHFIITTALVLSTMGISLTTC 413
                            +++  E P+     EP+ L  K   ++T  +++ +  ++++  
Sbjct: 329 EITPQPQLQEAFEQPPDEVVEEEFPEQQKSFEPVTLDPKTFTVVTICILICSYILAVSVT 388

Query: 414 NLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLP 454
           +L  +L +VG+T ++  A+ILP +    L G   +  + +P
Sbjct: 389 SLAKVLAIVGATGSTSIAFILPGVFGYQLIGSEYSTSQIVP 429

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 81/197 (41%), Gaps = 29/197 (14%)

Query: 304 SLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFP 363
           +L  IS T+  V     G  G+L++ +KT+  IL N P  +  +N  +F +   +L + P
Sbjct: 525 ALVIISATVLFVTV---GTLGYLSYGAKTETVILLNLPQGNILVNLIQFFYSSAILLSTP 581

Query: 364 LEIFVLRDVIRDLISTE----------------TPKGEPL--RLSTKRHFIITTALVLST 405
           L++F    +I + +  +                 P    L  R+   ++F+ +  + L  
Sbjct: 582 LQLFPAIAIIENKVFPKFTKIYVKRSDHTKVHYKPNSGKLDWRVKWLKNFVRSLIVSLVV 641

Query: 406 MGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKE-----KLP---HYA 457
           +       +L   + +VGS       YI PPM +L          E     K P    Y 
Sbjct: 642 IAAYFGADHLDTFVSIVGSFACIPLVYIYPPMLHLESCSRPACQNETSIWKKWPMAVDYV 701

Query: 458 CILFGFSIMVISSTQAI 474
            I+FG   MV +S Q+I
Sbjct: 702 LIIFGAIGMVYTSYQSI 718

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 101/240 (42%), Gaps = 45/240 (18%)

Query: 279 FALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILN 338
           FA  C HN   +         R    +  I+ +++ V+ +I G +G++TF     GNIL 
Sbjct: 214 FAYTCHHNMFSVINEQADKGFRILKRIPIIAISLAFVLYVIIGGAGYMTFGKNIVGNILT 273

Query: 339 NFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI--STETPKGE---------PL 387
            +P+S +     R      ++  FPL+    R  I+++I       KG+         PL
Sbjct: 274 LYPNSVS-TTIGRLAMLLLVMLAFPLQCHPCRSSIKNIIIFIENFRKGKLQENRDDCIPL 332

Query: 388 RL-----------------------STKRHFIITTALVLSTMGISLTTCNLGALLELVGS 424
            +                       S++   IIT  ++ S+  ++++  +L  +L +VG+
Sbjct: 333 DVLSSVNSQEESRQQNNEQQNFPSESSRHTNIITLCILGSSYLLAISITSLAKVLAIVGA 392

Query: 425 TTASLSAYILPPMTNLILTG-------ERRAAKEKLPHYACIL---FGFSIMVISSTQAI 474
           T ++  ++ILP +    L G       ER  A  K+  Y  +L   +G  +M+ S +  +
Sbjct: 393 TGSTSISFILPGLFGYKLIGSEYISRDERVPASVKILKYLGLLLFIWGIVVMIASLSATV 452

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 99/262 (37%), Gaps = 54/262 (20%)

Query: 266 VKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGF 325
           V   +     +  FA  C HN   I       SL     L  I+ T++M + +  G  G+
Sbjct: 190 VDSSMLSSFPIFVFAYTCHHNMFSIINEQSDKSLDSITKLIRIAITLAMSLYISIGALGY 249

Query: 326 LTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIF------------------ 367
            TF     GNI+  +P+S +     R      ++  FPL+                    
Sbjct: 250 CTFGDHITGNIITLYPNSISS-TIGRIAIALLVILAFPLQCHPARASVNHILHYFSKGNT 308

Query: 368 -------------VLRDV-----------IRDLISTETPKGEP--LRLSTKRHFIITTAL 401
                        +LRD              D +  E    +P  + L   R   IT+ +
Sbjct: 309 HPPMTTTSAEQNSLLRDSELESSEQLTYECEDELIEENSANQPPVVTLEGPRFIFITSGI 368

Query: 402 VLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRA------AKEKLPH 455
           +L +  ++++  +L  +L +VG+T ++  ++ILP +    L     A      AKE++  
Sbjct: 369 LLFSYILAMSVTSLANVLSIVGATGSTSISFILPGIFGYKLIASEYAKSVVPPAKERILR 428

Query: 456 YACIL---FGFSIMVISSTQAI 474
              +L   +GF +M+ S +  I
Sbjct: 429 IISLLLAIWGFIVMITSLSATI 450

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 90/209 (43%), Gaps = 11/209 (5%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFN-SLTHISCTISMVVCLIAGYSGFLTF 328
           LF G ++ +F  + L     I  S++KP    F+ SL+ + C ++ VV +  G   +  F
Sbjct: 475 LFIGTAIFTFEGIGLLIP--IQESMKKP--EHFHASLSGVMCVVT-VVFISCGLICYCAF 529

Query: 329 KSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGE--P 386
            +  +  +L NFP    Y    +  +   +L + PL++F    ++ +   +    G+  P
Sbjct: 530 GADVETVVLLNFPQESIYTRAVQLLYALAILLSTPLQLFPAIKILENWTFSPHSSGKHNP 589

Query: 387 LRLSTKRHFIITTALVLSTMGISLTTCN-LGALLELVGSTTASLSAYILPPMTNLILTGE 445
                K +F    A+V  +  I+    N L   + LVGS       YI PPM +     +
Sbjct: 590 KVKWLKNYF--RAAIVCFSALIAWAGANDLDKFVSLVGSFACIPLIYIYPPMLHFKAFKK 647

Query: 446 RRAAKEKLPHYACILFGFSIMVISSTQAI 474
            ++          + FG  +M+ +S Q I
Sbjct: 648 DKSKLFMASDIFLLFFGIIVMIYTSLQTI 676

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 87/213 (40%), Gaps = 34/213 (15%)

Query: 293 SLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARF 352
           S+R P   +F  +  +    S V+ +     G+L + S  +  IL N P  + ++N  +F
Sbjct: 509 SMRHP--EKFPMVLALVIGSSTVLFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQF 566

Query: 353 CFGFNMLTTFPLEIFVLRDVI--------------RDLISTET---PKGEPLRLSTK--- 392
            +   ++ + PL++F    +I              +D  +T+    P    L    K   
Sbjct: 567 FYSLAIMLSTPLQLFPAIKIIENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLK 626

Query: 393 ---RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAA 449
              R  I+   ++++  G       L   + ++GS       Y+ PPM +L      R+A
Sbjct: 627 NSVRAIIVALVILMAYYGAD----KLDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSA 682

Query: 450 KEKLPHYA---CIL--FGFSIMVISSTQAIITA 477
            +K P  +   C+L  FG   M  +S Q+I  +
Sbjct: 683 GQKFPWRSIVDCVLIVFGGVSMCYTSYQSIFAS 715

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 75/162 (46%), Gaps = 28/162 (17%)

Query: 305 LTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPL 364
           L  +  T+S++  LI G  G+L++  K K  IL +F +   ++N    CF   +L + PL
Sbjct: 243 LLLVMLTMSIIFILI-GTCGYLSYGEKIKVIILQSF-APGIFVNIIIVCFTIGILLSTPL 300

Query: 365 EIFVLRDVIRDLISTETP---KGEPLR---------------------LSTKRHFIITTA 400
           ++F L  ++ D + T+       E L+                     ++ + + II   
Sbjct: 301 QLFSLTSLLEDFLFTKKKIAVADEDLKVLEESDILCSESDTEAQGTKHINLRVYKIILRF 360

Query: 401 LVLSTMGI--SLTTCNLGALLELVGSTTASLSAYILPPMTNL 440
           L+++T+ +   +T+  L  L+ +VGS       YI PP+ NL
Sbjct: 361 LIVTTVCLIGYITSDKLNKLVAIVGSLACIPLVYIYPPLLNL 402

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 80/188 (42%), Gaps = 12/188 (6%)

Query: 293 SLRKPSLRRFNSL---THISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINF 349
           S++ P   +FN       +S +I+ ++C +  YS F    S  +  IL NFP        
Sbjct: 415 SMKHP--EKFNKCLLGVMVSVSIAFILCGLLCYSAF---GSSVETVILLNFPRKSAMTAS 469

Query: 350 ARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGE--PLRLSTKRHFIITTALVLSTMG 407
            +  +   ++ + PL++F +  ++   I  +   G+  P     K +F I   L  +T+ 
Sbjct: 470 VQLLYALAIMLSTPLQLFPIIRILETSIFPKNASGKYNPRVKWMKNYFRIGIVLA-NTLI 528

Query: 408 ISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLP-HYACILFGFSIM 466
             L   +L   + +VGS       YI PPM +         +K  L    A   FG ++M
Sbjct: 529 AWLGANDLDKFVSIVGSFACIPLIYIYPPMLHYKAFSNGGGSKLSLGCDVAIASFGVAVM 588

Query: 467 VISSTQAI 474
             ++ QA+
Sbjct: 589 TYTTYQAV 596

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 1/123 (0%)

Query: 256 RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMV 315
           RGS +   ++    L    ++I FA     N   I   L    +     + + S  IS +
Sbjct: 180 RGSINWVSIYDFNGLLSTFTIIIFAYTGSMNLFTIINELNYNDIDSIKIVINHSIAISTI 239

Query: 316 VCLIAGYSGFLTFKSKTKGNILNNFPSSDN-YINFARFCFGFNMLTTFPLEIFVLRDVIR 374
           + LI    G+LTF + T GNI+ N+  S++ YI   +   G  ++ TFPL    LR    
Sbjct: 240 IFLIISIFGYLTFGTLTLGNIMLNYNYSNSLYIILGKLALGIMVILTFPLLFHPLRIACN 299

Query: 375 DLI 377
           ++I
Sbjct: 300 NII 302

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 393 RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAK 450
           R + I+  L++S   I+L   +   +L LVG+T ++  ++ILP +   IL G  + ++
Sbjct: 401 RFYTISAFLLISMFSIALNIKSFALVLSLVGATGSTSISFILPGLLGYILIGRDKISR 458

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/341 (19%), Positives = 128/341 (37%), Gaps = 54/341 (15%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXX 242
           D  P +   F  N++   +RN+ IT++ +F+  PL   +                     
Sbjct: 104 DLTPQIASVFTSNHL-LLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCV 162

Query: 243 XXXXR--GPTVG-NDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSL 299
                   P+   +D +G   L     +      + +  FA  C HN   +    +  S 
Sbjct: 163 LIFIHFVWPSEEIHDLKGHVSLWIPHDETNPLTTLPIFVFAYTCHHNMFSVINEQKDTSF 222

Query: 300 RRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNML 359
           R    +   +  +++ + L+ G  G+LTF     GNI+  +P   +     R      ++
Sbjct: 223 RHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIKLYPQFAS-TTVGRIAIVLLVM 281

Query: 360 TTFPLE-----------IFVLRD--------------------------------VIRDL 376
             FPL+           +F L++                                +I +L
Sbjct: 282 LAFPLQCHPARASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQEYMIDEL 341

Query: 377 ISTETPKGEP-LRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILP 435
           I  ++    P + L  ++  IIT  L+L++  ++++  +L  +L +VGST ++  ++ILP
Sbjct: 342 IEEDSANQPPVVPLHGRKFVIITIFLLLASYLLAISVSSLARVLAVVGSTGSTSISFILP 401

Query: 436 PMTNLILTGERRAA-----KEKLPHYACILFGFSIMVISST 471
            +    L G    +     K KL  YA +      +V+ +T
Sbjct: 402 GIFGYQLIGSEVDSGSLPFKTKLFKYAGLALAVWGVVVMAT 442

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 91/216 (42%), Gaps = 23/216 (10%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSL-RRFNSLTHISCTISMVVCLIAGYSGFLTF 328
           LF G ++ +F  + L     I  S++ P + R+  S   +  T+  + C +  YS F   
Sbjct: 434 LFIGTAIFTFEGIGLLIP--IQESMKHPEVFRKSLSGVMVIVTVIFISCGLLCYSAF--- 488

Query: 329 KSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI--STETPKGEP 386
            S     +L NFP         +  +   +L + PL++F    ++      S  + K  P
Sbjct: 489 GSHVDTVVLVNFPQDSYTTAIVQLLYALAILLSTPLQLFPAIRILEQWTFNSNASGKHNP 548

Query: 387 LRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGER 446
            R+   +++     ++ +T+   +   +L   + LVGS       YI PP+ +       
Sbjct: 549 -RVKWLKNYFRCGVVIFTTVLAWVGASDLDKFVSLVGSLACIPLIYIHPPLLH------H 601

Query: 447 RAAKEK--------LPHYACILFGFSIMVISSTQAI 474
           RA++          +      +FGFS+MV +S QAI
Sbjct: 602 RASRSDGTSSRGILILDLLICIFGFSVMVYTSWQAI 637

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 75/178 (42%), Gaps = 10/178 (5%)

Query: 312 ISMVVCLI------AGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLE 365
           +S+V+C++       G   +  F  K +  +L NFP    +    +  +   +L + PL+
Sbjct: 544 LSLVMCIVTIIFISCGLICYSAFGEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQ 603

Query: 366 IFVLRDVIRDLISTETPKGEP-LRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGS 424
           +F    ++ +        G+   R+  K+++     ++ + M   +   +L   + LVGS
Sbjct: 604 LFPAIKILENWTFPIHASGKHNSRIKWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVGS 663

Query: 425 TTASLSAYILPPMTNL--ILTGERRAAKEKLP-HYACILFGFSIMVISSTQAIITAIH 479
                  YI PP+ +    L    +  + +L       +FG  IMV +S + I   +H
Sbjct: 664 FACIPLIYIYPPLLHFKAFLNDTSKTMRFRLGLDMLVFVFGIIIMVYTSWETISMWVH 721

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 82/204 (40%), Gaps = 29/204 (14%)

Query: 279 FALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILN 338
           FA  C HN   I   LR  SL     +   +  +++ +    G +G+LTF     GNI+ 
Sbjct: 204 FAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALAVALYATIGGAGYLTFGDHITGNIIA 263

Query: 339 NFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI--------------------- 377
            +P +       R      ++  FPL+    R  I  +                      
Sbjct: 264 QYPPAPA-TTLGRAAIAVLVMLAFPLQCHPARASINHIWHYCIPSHTVAPSEASALIRGG 322

Query: 378 -----STETPKGEP--LRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLS 430
                + E P  EP  + L   R   IT AL++++  ++++  +L  +L +VG+T ++  
Sbjct: 323 SPPADAAEGPGNEPAAVPLGPPRFAAITAALLIASYAVAVSVTSLARVLAVVGATGSTAI 382

Query: 431 AYILPPMTNLILTGERRAAKEKLP 454
           ++ILP +    L G    A +  P
Sbjct: 383 SFILPGLFGYQLIGSESRADQLPP 406

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 38/90 (42%)

Query: 275 SVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKG 334
           S+I FA     N   I   L   S+R    + + S   S  + ++ G +G+LTF S    
Sbjct: 194 SIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILVGMAGYLTFGSNVAQ 253

Query: 335 NILNNFPSSDNYINFARFCFGFNMLTTFPL 364
           N++ NF              G  +L +FPL
Sbjct: 254 NVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 97/243 (39%), Gaps = 48/243 (19%)

Query: 279 FALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILN 338
           FA  C HN   I    R         +  I+ ++++++ +  G +G+LTF     GNI+ 
Sbjct: 204 FAYTCHHNMFSIINEQRSSRFEHIMKIPLIAVSLALILYIAIGCTGYLTFGDNIIGNIIM 263

Query: 339 NFPSSDNYINFARFCFGFNMLTTFPLEIF--------VLRDVIRDLISTETP-------- 382
            +P + +     R      ++  FPL+          +L+ + R+ I+T T         
Sbjct: 264 LYPQTVSS-TVGRIAIVLLVMLAFPLQCHPARASIHQILQHLERENITTSTTSVSGPTFA 322

Query: 383 -KGEPLR-----------------------LSTKRHFIITTALVLSTMGISLTTCNLGAL 418
            +  PL                        L  K    IT  ++L++  ++++  +L  +
Sbjct: 323 NENSPLMGDRGLDINEVIEEESIYQPKETSLKGKSFVFITCGILLASYLVAISVSSLARV 382

Query: 419 LELVGSTTASLSAYILPPMTNLILTGERRAA----KEKLPHY---ACILFGFSIMVISST 471
           L +VG+T ++  ++ILP +    L G           +L  Y   A  ++G  IM+   T
Sbjct: 383 LAIVGATGSTSISFILPGLFGYKLIGTEHNTVIPFTTRLFKYTGLALFIWGLVIMITCLT 442

Query: 472 QAI 474
            A+
Sbjct: 443 AAL 445

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 91/209 (43%), Gaps = 9/209 (4%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           LF G ++ +F  + L     I  S+R P  +  +SL  + C +S VV +  G   +  F 
Sbjct: 441 LFIGTAIFTFEGIGLLIP--IQESMRHPE-KFQSSLFGVMCIVS-VVFISCGLLCYSAFG 496

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI--STETPKGEPL 387
           S  +  +L NFP    Y    +  +   +L + PL++F    ++      S  + K  P 
Sbjct: 497 SNVQTVVLLNFPQDSPYTLLVQLFYSMAILLSTPLQLFPAIRILEHWTFPSNASGKYNP- 555

Query: 388 RLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERR 447
           ++  ++++     +VL+++   +   NL   + LVGS       YI PP+ +     + +
Sbjct: 556 KIKWRKNYFRCIIVVLTSVLAWVGASNLDKFVSLVGSLACIPLIYIHPPLLHFKAFKDDQ 615

Query: 448 AAK--EKLPHYACILFGFSIMVISSTQAI 474
             +    +     + FG  +M  +S Q +
Sbjct: 616 DTRYWSLICDILLLAFGVGVMTYTSVQTL 644

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 99/229 (43%), Gaps = 28/229 (12%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           LF G ++ SF  + L     +  S+RKP   +F  +  +    + VV +I    G+L + 
Sbjct: 505 LFIGTAIFSFEGIGL--VIPVQDSMRKP--EKFPLVLGLVIICTTVVFIIVATIGYLAYG 560

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVI---------------- 373
           S+    IL N P  +  ++  +  +   ++ + PL++F    +I                
Sbjct: 561 SEVDTVILLNLPQKNILVSLIQLLYSIAIMLSTPLQMFPAIRIIESGLFKQYDRWVNRSD 620

Query: 374 RDLISTE--TPKGE-PLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLS 430
           R+  +TE  T  G+   ++   ++ + ++ ++L      +   NL   L ++GS      
Sbjct: 621 REGHATEHNTSSGKSSWKVKWMKNAVRSSIVILVVAIACVGADNLDKFLSIIGSFACIPL 680

Query: 431 AYILPPMTNLILTGERRA-----AKEKLPHYACILFGFSIMVISSTQAI 474
            Y+ PPM +L  T   R+     ++  +     I+FG   MV +S Q+I
Sbjct: 681 VYMYPPMLHLKSTSLPRSNGKIMSRRVIIDIVLIIFGGISMVYTSYQSI 729

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 315 VVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIR 374
           V+ ++ G  G+L +    +  IL N   S+ ++N  +  +   +L + PL++F    +I 
Sbjct: 569 VLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQLFYSVAILLSTPLQLFPAIKIIE 628

Query: 375 DLI-----STETPKGEPLRLSTK------------RHFIITTALVLSTMGISLTTCNLGA 417
           + +     ST+    + L  S K            R  I++  ++++ +G +    NL  
Sbjct: 629 NRMFTSFRSTDNGSSQFLSNSGKLNWRIKWRKNCLRSIIVSCVILIAYLGYN----NLDK 684

Query: 418 LLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITA 477
            + L+GS       Y+ PPM +L         + K      ++F FS++V+     + T+
Sbjct: 685 FVSLIGSFACIPLVYMYPPMLHLKSYSIPSLKQHKFNF--TVIFDFSLIVLGGISMLYTS 742

Query: 478 IHS 480
             S
Sbjct: 743 YRS 745

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 65/338 (19%), Positives = 118/338 (34%), Gaps = 74/338 (21%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNXXXXXXXXXXXXXXXXXXXX 242
           D +P +   F  + I    RN  IT+V IF+  PL   +                     
Sbjct: 146 DLLPQIFSNFTSHEI-LLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIAISAVGYLCV 204

Query: 243 XXXXRG--PTVG-NDYRGSFDLEELFVKPR-----LFQGISVISFALVCLHNTSFIYFSL 294
                   P+    D +G+  L     +P+     +     +  FA  C HNT  I   L
Sbjct: 205 LVVAHFLFPSQEIKDLKGTVSL----FRPKGLHTSMLSSFPIFVFAYTCHHNTFSIVNEL 260

Query: 295 RKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCF 354
           +  S+     +   +  +++ + +  G SG+ TF     GNI+  +P S +     R   
Sbjct: 261 KDNSVENVRKVVIGAMGLAVCLYIAIGGSGYGTFGDNIGGNIIMLYPHSTS-TTVGRIAI 319

Query: 355 GFNMLTTFPLEIFVLRDVIRDLI------------------------------------- 377
              ++  FPL+    R  I  +I                                     
Sbjct: 320 VLLVMLAFPLQCHPARASINHIIHHLFEERRGGAQNGEERESNAASKNRTDESACNGNSE 379

Query: 378 ------STET---------------PKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLG 416
                 STET               PK  PL    ++  +IT+ +++ +  ++++  +L 
Sbjct: 380 SSRLVQSTETSIPVDELIEECSARQPKVVPLE--GRKFVVITSCILIFSYALAVSVTSLA 437

Query: 417 ALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLP 454
            +L +VG+T ++  ++ILP +    L G       ++P
Sbjct: 438 RVLAVVGATGSTSISFILPGIFGYQLIGSEYENTSEMP 475

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 92/213 (43%), Gaps = 16/213 (7%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           LF G ++ +F  + L     I  S+ KP  + FN       +    V + +G   +  F 
Sbjct: 406 LFVGTAIFTFEGIGLLIP--IQESMEKP--QHFNKCLLGVMSGVAFVFITSGLICYSAFG 461

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETP-----KG 384
           SK +  +L NFP    +   A+  +   +L + PL++F     IR L +   P     K 
Sbjct: 462 SKVETVVLLNFPQDSPFTKSAQLLYVLAILLSTPLQLF---PAIRILENWTFPVDASGKH 518

Query: 385 EPLRLSTKRHFIITTALVLSTMGISLTTCN-LGALLELVGSTTASLSAYILPPMTNLILT 443
            P     K +F   +A+V++T  I+    N L   + LVGS       YI PP  +    
Sbjct: 519 NPHIKWLKNYF--RSAIVIATSLIAWGGANDLDKFVSLVGSFACVPLIYIYPPALHFKAF 576

Query: 444 GERRAAKEKLPHYACIL-FGFSIMVISSTQAII 475
            ++ A+K  L     I   G  IM+ ++ Q+I+
Sbjct: 577 KDKNASKISLVTDVVIASVGVIIMLYNTYQSIL 609

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 83/211 (39%), Gaps = 36/211 (17%)

Query: 293 SLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARF 352
           S+R P   +F  +  +    S V+ +  G  G+L +  K K  IL N P ++  +N  +F
Sbjct: 513 SMRHP--EKFPLVLGMVIITSTVLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQF 570

Query: 353 CFGFNMLTTFPLEIFVLRDVIRDLISTE-----------------TPKGEPLRLSTK--- 392
            +   ++ + PL++F    +I + +  +                  P    L    K   
Sbjct: 571 FYSLAIMLSTPLQLFPAIKIIENKVFPKFIKIYVKKDDNTTGVEMRPNSGKLNWKVKWLK 630

Query: 393 ---RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLI------LT 443
              R  I+ + ++++  G       L   + L+GS       Y+ PPM +L         
Sbjct: 631 NFVRSLIVGSVILMAYFGAD----QLDKFVALIGSFACIPLVYMYPPMLHLRSCSLPNHK 686

Query: 444 GERRAAKEKLPHYACILFGFSIMVISSTQAI 474
           G R      L  Y  I+FG   M+ +S Q++
Sbjct: 687 GGRINWSAGL-DYVLIIFGAISMIYTSYQSV 716

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 74/198 (37%), Gaps = 5/198 (2%)

Query: 183 DSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSL--NRNXXXXXXXXXXXXXXXXXX 240
           D +P ++     N +   +R   IT++  FV+ PL L  N N                  
Sbjct: 108 DLMPQIVSGLTKNAL-LLDRVFHITLIMAFVAGPLCLLKNLNSLRYASMVAISAVAYLCI 166

Query: 241 XXXXXXRGPTVG-NDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSL 299
                   P+    D +G F +     +      + +  FA  C HN   +    +K   
Sbjct: 167 LVLVHFIFPSQEIKDLKGDFAVWFPHNEGSPLSTLPIFVFAYTCHHNVFAVINEQKKTRF 226

Query: 300 RRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNML 359
                +  I+  +++V+ ++ G +G+ TF +   GNI+  +P S       R    F + 
Sbjct: 227 AHVKVIAIIAMLLALVLYVLIGGAGYFTFGNHIVGNIITLYPHSITS-TIGRVAIVFLVT 285

Query: 360 TTFPLEIFVLRDVIRDLI 377
             FPL+    R  I  +I
Sbjct: 286 LAFPLQCHPARASIHHII 303

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 382 PKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLI 441
           P+  PL   T +  IIT  L+     ++++  +L  +L +VG+T ++  ++ILP +    
Sbjct: 389 PENTPLEGKTFK--IITLILIACAYTVAISVTSLAHVLAIVGATGSTSISFILPGLFGFT 446

Query: 442 LTG-ERRAAKEKLP 454
           L G E   A E++P
Sbjct: 447 LIGSEYTEADEEIP 460

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 89/228 (39%), Gaps = 59/228 (25%)

Query: 271 FQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVC---LIAGYSGFLT 327
           F+ + +  FA  C HN   ++  L + S   F+ L +I  T   + C   LI G  G++T
Sbjct: 190 FKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYIPLTAISIACIMYLIVGTFGYVT 246

Query: 328 FKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGE-- 385
           F S    NI+  +P++       +      +   FPL+    R    ++I+   P+ +  
Sbjct: 247 FGSNITSNIVAQYPTNSIATILGQTAMLTVVTLAFPLQCQPARASFINIINAFFPRFKYT 306

Query: 386 -----------------------------------------PLRLSTK----------RH 394
                                                    P+   +K          +H
Sbjct: 307 PPPLQDEESMYISSTADSINNNNNQNSTPSTPRESTPNETTPIEARSKLPFAQEPTQFQH 366

Query: 395 FIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLIL 442
            ++TT ++L +  I+++  +L  +L +VG+T ++  ++ILP +   IL
Sbjct: 367 ILLTTIILLGSWLIAISVKSLAHVLAIVGATGSTSISFILPGLFGAIL 414

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 82/188 (43%), Gaps = 11/188 (5%)

Query: 293 SLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARF 352
           S+ KP  + F SLT +   ++ V+ +  G   +  F S  +  +L NFP    Y    + 
Sbjct: 409 SMAKPH-QFFISLTLVMVIVT-VIFISVGLLCYCAFGSSVETVVLLNFPQDSPYTLTVQL 466

Query: 353 CFGFNMLTTFPLEIFVLRDVIRDLISTETPKGE--PLRLSTKRHFIITTALVLSTMGISL 410
            +   +L + PL++F    ++ + +  +   G+  P     K +F   + +V+ T  I+ 
Sbjct: 467 LYCLAILLSTPLQLFPAIRILENWVFKKKGSGKYNPKIKWAKNYF--RSLIVIGTTCIAW 524

Query: 411 TTCN-LGALLELVGSTTASLSAYILPPMTNL---ILTGERRAAKEKLPHYACILFGFSIM 466
           +  N L   + LVGS       YI PP+ +     + G     +  L     ILFG  +M
Sbjct: 525 SGANDLDKFVSLVGSFACIPLIYIYPPLLHYKACKINGSANLVQNYL-DIILILFGVILM 583

Query: 467 VISSTQAI 474
             +S Q I
Sbjct: 584 SYTSFQTI 591

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 5/207 (2%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           LF G ++ +F  + L     I  S++KP    F        +I   + + +G   +L F 
Sbjct: 402 LFIGTAIFTFEGIGLLIP--IQESMKKP--EHFYPSLGFVMSIVTFIFVSSGLLCYLAFG 457

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKGEP-LR 388
           +K +  +L NFP         +  +   +L + PL++F    +           G+   R
Sbjct: 458 AKVETVVLLNFPQDSIATISVQLIYSLAILLSTPLQLFPAIRIFETWTFPSNASGKHNHR 517

Query: 389 LSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRA 448
           +   +++  T  ++ + +   +   +L   + LVGS       YI PP+ +L  +  + +
Sbjct: 518 VKWLKNYFRTGVVIFTALLAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHLKSSDTQTS 577

Query: 449 AKEKLPHYACILFGFSIMVISSTQAII 475
               L       FG  +M  +S Q I+
Sbjct: 578 KFIILGDLLIFFFGVGVMAYTSYQNIV 604

>TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON}
           Anc_2.177 YNL101W
          Length = 742

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 71/171 (41%), Gaps = 16/171 (9%)

Query: 308 ISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIF 367
           I C  S+ + +  G  G++T+       IL N P+    +   +  +   ++ + PL+IF
Sbjct: 578 IGCVTSLFILI--GSMGYVTYGEDINTVILINLPNDKVTVQSIQLLYSIAIMLSIPLQIF 635

Query: 368 VLRDVIRDLISTETPKGEPLRLSTKRHF-------IITTALVLSTMGISLTTCN-LGALL 419
               +I + I      G   R S K +         + + +++  + IS    N L   +
Sbjct: 636 PAIKIIENFIINYGVSGGDYRRSGKYNVYYKWLKNCLRSIIIVIIILISKEFINQLDKFV 695

Query: 420 ELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISS 470
            ++GS       YI P + +L      R    K  ++  IL G ++MV ++
Sbjct: 696 SIIGSVACIPLVYIYPSLLHL------RCGGNKFRNWVMILLGLAVMVFTT 740

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 271 FQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKS 330
           F GI++ SF  V L     +  S+R P   +F  +  +   +   + ++ G  G+LTF  
Sbjct: 323 FVGIAIFSFEGVGL--IIPVEDSMRNP--EKFPLVLSLVLLVCTAIFMLIGTLGYLTFGK 378

Query: 331 KTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI 377
                IL++F   + +++ A+ C+   +L + P+++F +  ++ + I
Sbjct: 379 DITPVILSSFNQKNKFVSIAQLCYSIAILLSTPIQLFPVYKMVEEAI 425

>AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR249W (YEF3) and
           YNL014W (HEF3)
          Length = 1044

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 50/127 (39%), Gaps = 5/127 (3%)

Query: 249 PTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTH 307
           PT  + Y  G+ DLE  F +P   +G+     A+V + N SF Y    KP +   N    
Sbjct: 633 PTAKSYYELGASDLEFKFPEPGFLEGVKTKQKAIVKVSNMSFQYPGTSKPQIADINFQCS 692

Query: 308 ISCTISMVVCLIAGYSGFLTFKS----KTKGNILNNFPSSDNYINFARFCFGFNMLTTFP 363
           +S  I+++    AG S  +   +     T G +  +      YI    F    N L   P
Sbjct: 693 LSSRIAVIGPNGAGKSTLINVLTGELLPTTGEVYTHENCRIAYIKQHAFAHIENHLDKTP 752

Query: 364 LEIFVLR 370
            E    R
Sbjct: 753 SEYIQWR 759

>ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL146W
          Length = 678

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 72/157 (45%), Gaps = 9/157 (5%)

Query: 325 FLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKG 384
           +  F +K +  IL NFP         +  +   ++ + PL++F    ++ +++ T +  G
Sbjct: 521 YAAFGAKVETVILLNFPQDSALGTGVQLLYAAAIMLSTPLQLFPAIRILENVVVTTSRSG 580

Query: 385 EPLRLSTK----RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTN- 439
              + STK    +++     +VL  +  SL + +L   + L+GS       Y+ PP+ + 
Sbjct: 581 ---KYSTKVKWIKNWFRALVVVLMLVLASLGSNDLDKFVSLIGSFACIPLIYVYPPLLHY 637

Query: 440 LILTGERRAAKEKLP-HYACILFGFSIMVISSTQAII 475
           ++  G    ++  L    A + FG  IM  ++ Q ++
Sbjct: 638 VVFRGTGTVSQVALALDLAVMAFGLGIMGYTTVQTVV 674

>KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} highly
           similar to uniprot|P53978 Saccharomyces cerevisiae
           YNL014W HEF3 Translational elongation factor EF- 3
           paralog of YEF3 and member of the ABC superfamily
           stimulates EF-1 alpha-dependent binding of
           aminoacyl-tRNA by the ribosome normally expressed in
           zinc deficient cells
          Length = 1044

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 249 PTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTH 307
           PT  + Y  G+ DLE  F +P   +G+     A+V + N SF Y    KP +R  +    
Sbjct: 633 PTAKSYYELGASDLEFRFPEPGFLEGVKTKQKAIVKVSNMSFQYPGTAKPQIRDVSFQCS 692

Query: 308 ISCTISMVVCLIAGYSGFL 326
           +S  I+++    AG S  +
Sbjct: 693 LSSRIAVIGPNGAGKSTLI 711

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/231 (19%), Positives = 95/231 (41%), Gaps = 28/231 (12%)

Query: 270 LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFK 329
           LF G ++ SF  + L     I  S++ P   +F  +  +    + ++ +     G+L++ 
Sbjct: 478 LFVGTAIFSFEGIGLIIP--IQDSMKNP--EKFPLVLGLVLITATILFISIATIGYLSYG 533

Query: 330 SKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI----------ST 379
           S     IL N P S+ ++N  +  +   ++ + PL++F    +I   +            
Sbjct: 534 SSIDVVILLNLPQSNIFVNLIQLFYSLAIMLSTPLQMFPAIKIIESKLFPKFIKVYAKDG 593

Query: 380 ETPKGEPLRLSTK---------RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLS 430
            +P    L L++          ++F+ +  + L  +   L   NL  ++ ++GS      
Sbjct: 594 NSPGSYELSLNSGKLNWKVKWLKNFVRSIIVTLVVLIAYLEVENLDKVVSIIGSLACIPL 653

Query: 431 AYILPPMTNL-----ILTGERRAAKEKLPHYACILFGFSIMVISSTQAIIT 476
            YI PP+ +L       +  ++     L  Y  + FG   M  +S Q+I +
Sbjct: 654 VYIYPPLLHLRSHSIPFSVNQKVKWRVLFDYLLVGFGTVSMFYTSYQSIFS 704

>KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1.391
           YLR249W
          Length = 1045

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 249 PTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTH 307
           PT  + Y  G+ DLE  F +P   +G+     A+V + N +F Y    KP ++  N    
Sbjct: 633 PTAKSYYELGASDLEFRFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTDKPQIKDINFQCS 692

Query: 308 ISCTISMVVCLIAGYSGFL 326
           +S  I+++    AG S  +
Sbjct: 693 LSSRIAVIGPNGAGKSTLI 711

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 47/121 (38%), Gaps = 3/121 (2%)

Query: 247 RGPTVGNDY---RGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFN 303
           +G   GN Y   RG      +     L    S+I  A     N   +   L+  S     
Sbjct: 164 QGVMFGNKYVEHRGDVSWLHIHSVGELVSTFSIIILAYTGSMNMFSVINELKDNSTANAK 223

Query: 304 SLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFP 363
            + + S  IS ++ L  G  G+LTF +    N++ N+  S        F  G  ++ +FP
Sbjct: 224 RVVYYSVGISTLIFLSVGLGGYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFP 283

Query: 364 L 364
           L
Sbjct: 284 L 284

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 68/153 (44%), Gaps = 7/153 (4%)

Query: 327 TFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIF-VLRDVIRDLISTE-TPKG 384
            F S+ +  IL NFP      +  +F +   ++ + PL++F  +R +   +IS+  + K 
Sbjct: 472 AFGSRVETVILLNFPKDSVLSSSVQFLYAMAIMLSTPLQLFPAIRILEHGIISSSVSGKH 531

Query: 385 EPLRLSTKRHFIITTALVLSTMGISLTTC-NLGALLELVGSTTASLSAYILPPMTNLIL- 442
           +P     K  F +    V  T+ I+     +L   + L+GS       YI PP+ + +L 
Sbjct: 532 DPRVKWAKNWFRVLVVFV--TVSIAWVGADDLDKFVSLIGSFACVPLIYIYPPLLHYMLF 589

Query: 443 TGERRAAKEKL-PHYACILFGFSIMVISSTQAI 474
            G  R +   L      + FG   M  +S+Q +
Sbjct: 590 KGTGRVSNAALFLDQLVVWFGVIGMFYTSSQTV 622

>NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1.391
          Length = 1049

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 50/129 (38%), Gaps = 5/129 (3%)

Query: 247 RGPTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSL 305
           R PT  + Y  G+ DLE  F  P   +G+     A+V + N SF Y    KP +      
Sbjct: 634 RCPTAKSYYELGASDLEFQFPTPGYLEGVKTKQKAIVKVSNMSFQYPGTSKPQVSDVTFQ 693

Query: 306 THISCTISMVVCLIAGYSGFLTFKS----KTKGNILNNFPSSDNYINFARFCFGFNMLTT 361
             +S  I+++    AG S  +   +     T G++  +      YI    F    N L  
Sbjct: 694 CSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGDVYTHENCRIAYIKQHAFAHIENHLDK 753

Query: 362 FPLEIFVLR 370
            P E    R
Sbjct: 754 TPSEYIQWR 762

>KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {ON}
           Anc_1.391 YLR249W
          Length = 1049

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 249 PTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTH 307
           PT  + Y  G+ DLE  F +P   +G+     A+V + N SF Y    KP ++  +    
Sbjct: 637 PTAKSYYELGASDLEFRFPEPGYLEGVKTKQKAIVKVSNMSFQYPGTSKPQIQDISFQCS 696

Query: 308 ISCTISMVVCLIAGYSGFL 326
           +S  I+++    AG S  +
Sbjct: 697 LSSRIAVIGPNGAGKSTLI 715

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 79/177 (44%), Gaps = 24/177 (13%)

Query: 324 GFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI------ 377
           G+L +    +  IL N P S+ ++N  +  +   ++ + PL++F    +I + +      
Sbjct: 590 GYLAYGKLIETVILLNLPKSNIFVNLIQLFYSMAIMLSTPLQLFPAIKIIENKVFPKFTK 649

Query: 378 ----STETPKGEPLRLST---------KRHFIITTALVLSTMGISLTTCNLGALLELVGS 424
                 +T +G  LR ++         +++F+ +  +++  +       +L   + ++GS
Sbjct: 650 YYVKIDQTREGVRLRQNSGKLDWRVKWRKNFLRSVIVLIVILMAYYGYDDLDRFVSIIGS 709

Query: 425 TTASLSAYILPPMTNL----ILTGERRAAKEK-LPHYACILFGFSIMVISSTQAIIT 476
                  Y+ PPM +L    I + E    K + +  Y  I FG   M+ +S Q++++
Sbjct: 710 FACIPLVYMYPPMLHLRSYSIPSSEGLKIKYRVILDYILIAFGGVSMLYTSYQSLMS 766

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 72/176 (40%), Gaps = 26/176 (14%)

Query: 324 GFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIR--------- 374
           G+L + S  K  IL N P S+ ++N  +  +   ++ + PL++F    +I          
Sbjct: 539 GYLAYGSDVKTAILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFFPKFTK 598

Query: 375 -----DLISTET---PKGEPLRLSTK--RHFIITTALVLSTMGISLTTCNLGALLELVGS 424
                D ++T     P    L    K  ++FI +  +++        + NL   + ++GS
Sbjct: 599 IYVKHDDLTTRVELRPNSGKLDWKVKWLKNFIRSIIVIIVVSIAYFGSDNLDKFVSVIGS 658

Query: 425 TTASLSAYILPPMTNLI------LTGERRAAKEKLPHYACILFGFSIMVISSTQAI 474
                  YI P M +L         GE    K  L     ILFG + M+ +S Q+I
Sbjct: 659 LACIPLVYIYPSMLHLRGNSLPETKGEFWKFKPIL-DTILILFGITSMLYTSYQSI 713

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 25/148 (16%)

Query: 272 QGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYS-------- 323
           + + VIS AL+ L  TSF+YF+    S +  N  T+ S  IS     +   +        
Sbjct: 14  RNLRVISSALLLLGVTSFLYFTWNDYSEKLSNPSTNASSVISSTQSTLISQNILDESQLR 73

Query: 324 -------GFLTFKSKTK-GNILNNFPSSDNYI-NFARFCFGFNMLTTFPLEIFVL---RD 371
                    LT K++ K  +IL+  P+S + I +F      F +L T P+ +F+    RD
Sbjct: 74  NIQKVNDEILTIKNQIKTTSILSPIPTSSSPIQSFNPEVNFFQILETSPMVLFIKSSERD 133

Query: 372 --VIRDLISTE---TPKGEPLRLSTKRH 394
             +IRD+++ E   +P+   + L   +H
Sbjct: 134 SKIIRDILTKEYEISPELAVVDLDKHKH 161

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/202 (17%), Positives = 91/202 (45%), Gaps = 28/202 (13%)

Query: 263 ELFVKPR---LFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLI 319
           E  + PR   LF G ++ SF  + L     +  S+++P   +F+ +  +    + ++ + 
Sbjct: 478 EYGIDPRRWTLFVGTAIFSFEGIGL--IIPVQDSMKRP--EKFSLVLKLVMITTTIIFIT 533

Query: 320 AGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI-- 377
               G+L + S+ +  +L N P  + ++N  +F +   ++ + PL++F    ++   +  
Sbjct: 534 IATVGYLAYGSEIQTVVLLNLPQGNLFVNLIQFLYSLAIMLSTPLQLFPAIKILEGKVFY 593

Query: 378 -------------STETPKG------EPLRLSTKRHFIITTALVLSTMGISLTTCNLGAL 418
                        + E+ KG        +++   ++ + +T +V + +   L   +L  +
Sbjct: 594 RYNKKVSRQLSGEANESTKGGSYSGKSNMKIKWLKNLLRSTIVVGAILIAYLGMDSLDKV 653

Query: 419 LELVGSTTASLSAYILPPMTNL 440
           + ++GS       +ILPP+ ++
Sbjct: 654 VSIIGSFCCLPLVFILPPLLHM 675

>Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON}
           similar to Ashbya gossypii AAL028W
          Length = 1044

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 247 RGPTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSL 305
           + PT  + Y  G+ +LE  F +P   +G+     A+V + N SF Y    KP +   N  
Sbjct: 631 KCPTAKSYYELGASELEFSFPEPGYLEGVKTKQKAIVKVSNMSFQYPGTSKPQIADINFQ 690

Query: 306 THISCTISMVVCLIAGYSGFL 326
             +S  I+++    AG S  +
Sbjct: 691 CSLSSRIAVIGPNGAGKSTLI 711

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 4/101 (3%)

Query: 267 KPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFL 326
            PRL  G+ ++ F   C  N        R+  L+    +          VCLI G +G+L
Sbjct: 187 APRLL-GLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAAVCLICGITGYL 245

Query: 327 TFKSKTK---GNILNNFPSSDNYINFARFCFGFNMLTTFPL 364
           TF   T+    N+L  +P         R     ++  +FPL
Sbjct: 246 TFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPL 286

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 82/212 (38%), Gaps = 35/212 (16%)

Query: 293 SLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARF 352
           S+RKP   +F  +  +    + V+ +     G+L F    +  IL N P  + ++N  +F
Sbjct: 515 SMRKP--EKFPLVLGLVILTATVLFISIAALGYLAFGRYIETVILLNLPQDNIFVNLVQF 572

Query: 353 CFGFNMLTTFPLEIFVLRDVI--------RDLISTE-------TPKGEPLRLSTK----- 392
            +   +L + PL++F    +I        R  +S         +P    L    K     
Sbjct: 573 FYSLAILLSTPLQLFPAIGIIESKLVPKFRKTVSPTNKNDVQLSPNSGKLDWKVKWTKNF 632

Query: 393 -RHFIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTG-----ER 446
            R  I+   + L+  G    +  L   +  +G        Y+ PP+ +L         + 
Sbjct: 633 LRSIIVIFVICLAYFG----SSKLDVFVSFIGCFACIPLVYMYPPLLHLKSCSQPAYKQN 688

Query: 447 RAAKEKL---PHYACILFGFSIMVISSTQAII 475
           +  K +L     Y  ++FG   M+ +S Q I+
Sbjct: 689 QTLKNRLMITMDYGLVIFGGVSMLYTSYQCIM 720

>TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]
           {ON} Anc_1.391 YLR249W
          Length = 1044

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 247 RGPTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSL 305
           + PT  + Y  G+ DLE  F +P   +G+     A+V + + +F Y    KP +   N  
Sbjct: 631 KCPTAKSYYELGASDLEFRFPEPGYLEGVKTKQKAIVKVSDMTFQYPGTDKPQISNINFQ 690

Query: 306 THISCTISMVVCLIAGYSGFL 326
             +S  I+++    AG S  +
Sbjct: 691 CSLSSRIAVIGPNGAGKSTLI 711

>TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]
           {ON} Anc_1.391 YLR249W
          Length = 1044

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 249 PTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTH 307
           PT  + Y  G+ DLE  F +P   +G+     A+V + N +F Y    KP +   +    
Sbjct: 633 PTAKSYYELGASDLEFRFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTTKPQIEDISFQCS 692

Query: 308 ISCTISMVVCLIAGYSGFL 326
           +S  I+++    AG S  +
Sbjct: 693 LSSRIAVIGPNGAGKSTLI 711

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 73/206 (35%), Gaps = 28/206 (13%)

Query: 293 SLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARF 352
           S+R P    F  +  +    + V+ +  G  G+L + S+ +  IL N P     +N  + 
Sbjct: 509 SMRHP--EEFPKVLGLVIITTTVLFITIGTLGYLAYGSQIQSVILLNLPQDALSVNMIQL 566

Query: 353 CFGFNMLTTFPLEIFVLRDVIR------------------DLISTETPKGEPLRLSTKRH 394
            +   +L + PL++F    +I                   D    +       R+   ++
Sbjct: 567 FYSMAILLSTPLQLFPAIGIIENKFFPRFTKVDIKGQDSADFQLQQNSGRANWRVKWSKN 626

Query: 395 FIITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEK-- 452
            + +  ++L  +       NL   + +VG        YI P M +L         K    
Sbjct: 627 LVRSIIVLLVIILAYFGADNLDLFVSIVGCLACIPLVYIYPSMLHLRSCSTPDHEKSNTW 686

Query: 453 ------LPHYACILFGFSIMVISSTQ 472
                 L  Y  I+FGF  M  +S Q
Sbjct: 687 KTRCSVLIDYILIIFGFVSMCYTSYQ 712

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 102/253 (40%), Gaps = 40/253 (15%)

Query: 249 PTVGNDYRGSFDLEELFVKPRLF--QGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLT 306
           P +G  Y  + D   LF+   +F  +GI +I    + + +      S+R P   +F  + 
Sbjct: 473 PAMGVVYGLNMDRWTLFIGTAIFAFEGIGLI----IPVQD------SMRNP--EKFPLVL 520

Query: 307 HISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEI 366
            +    + ++ +     G+L + S  +  IL N P S+ ++N  +  +   ++ + PL++
Sbjct: 521 ALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQL 580

Query: 367 FVLRDVIR--------------DLISTET---PKGEPL--RLSTKRHFIITTALVLSTMG 407
           F    +I               D ++T     P    L  R+   ++FI +  +++    
Sbjct: 581 FPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLDWRVKWLKNFIRSIIVIIVVAI 640

Query: 408 ISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYA------CILF 461
               + NL   + ++GS       YI P M +L         K K   +        I F
Sbjct: 641 AYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHL-RGNSLPETKGKFWRFKPMLDIILIFF 699

Query: 462 GFSIMVISSTQAI 474
           G + M+ +S Q+I
Sbjct: 700 GIASMLYTSYQSI 712

>CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa]
           {ON} highly similar to uniprot|P16521 Saccharomyces
           cerevisiae YLR249w YEF3 or uniprot|P53978 Saccharomyces
           cerevisiae YNL014w HEF3
          Length = 1045

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 247 RGPTVGNDYR-GSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSL 305
           + PT  + Y  G+ DLE  F +P   +G+     A+V + N +F Y    KP +   +  
Sbjct: 631 KCPTAQSYYELGASDLEFKFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISFQ 690

Query: 306 THISCTISMVVCLIAGYSGFL 326
             +S  I+++    AG S  +
Sbjct: 691 CSLSSRIAVIGPNGAGKSTLI 711

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 26/176 (14%)

Query: 324 GFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIR--------- 374
           G+L + S  +  IL N P S+ ++N  +  +   ++ + PL++F    +I          
Sbjct: 536 GYLAYGSSVRTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFFPKFTK 595

Query: 375 ------DLISTETPKGEPLRLSTK----RHFIITTALVLSTMGISLTTCNLGALLELVGS 424
                 DL +    +    +L+ K    ++FI +  +++        + NL   + ++GS
Sbjct: 596 IYVKHNDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIVVAIAYFGSDNLDKFVSVIGS 655

Query: 425 TTASLSAYILPPMTNLI------LTGERRAAKEKLPHYACILFGFSIMVISSTQAI 474
                  YI P M +L         GE    K  L     I FG + M+ +S Q+I
Sbjct: 656 LACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPVLDS-ILIFFGIASMLYTSYQSI 710

>SAKL0A09702g Chr1 complement(852429..855539) [3111 bp, 1036 aa]
           {ON} similar to uniprot|P36097 Saccharomyces cerevisiae
           YKL033W Protein of unknown function localized to the
           cytoplasm.
          Length = 1036

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 284 LHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNN-FPS 342
           L+NT ++  ++   S+R  +S+T    T+ MV+C IAGY    +F+     ++L   F  
Sbjct: 663 LNNTDYLVDAI---SVRLNSSMTQRVATVLMVICKIAGYGIIQSFR-----DVLETIFKL 714

Query: 343 SDNYINFARFCFGF 356
            D Y  ++  C  F
Sbjct: 715 LDYYHGYSDLCLEF 728

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 70/181 (38%), Gaps = 34/181 (18%)

Query: 324 GFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTE--- 380
           G+L++   T+  IL N P  +  +N  +F +   +L + PL++F    +I + +      
Sbjct: 555 GYLSYGQNTETVILLNLPQGNLCVNLIQFFYSLAILLSTPLQLFPAIAIIENKVFPRFTK 614

Query: 381 -------------TPKGEPLRLSTK------RHFIITTALVLSTMGISLTTCNLGALLEL 421
                         P    L    K      R  I++  ++L+  G    + NL   + +
Sbjct: 615 IYVKKNNRTDVELRPNSGKLDWKVKWLKNSVRSVIVSFVILLAYYG----SENLDKFVSI 670

Query: 422 VGSTTASLSAYILPPMTNLILTGERRAAK-----EKLP---HYACILFGFSIMVISSTQA 473
           VG        Y+ PP+ +L    + +        +K P    Y  I FG   M+ +S Q 
Sbjct: 671 VGCFACIPLVYMYPPLLHLRSCSKPQCHGVTKWWKKWPIGLDYLLITFGGVSMIYTSYQC 730

Query: 474 I 474
           +
Sbjct: 731 V 731

>Suva_11.323 Chr11 complement(587638..588675) [1038 bp, 345 aa]
          {ON} YKR087C (REAL)
          Length = 345

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 9  SRLDGDETGKEGTSVQSPFHTVQLNREWGDPSSSNGDRIELIDYPTKSS 57
          ++L G      G  ++SPF  VQL R +   + S+  R    DY TKSS
Sbjct: 6  TKLKGLANRANGQFLKSPFSRVQLRRSFYSSNGSSYRRFNNDDYSTKSS 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,548,633
Number of extensions: 1711643
Number of successful extensions: 4149
Number of sequences better than 10.0: 120
Number of HSP's gapped: 4163
Number of HSP's successfully gapped: 153
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)