Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR669W1.82ON1918190584010.0
Ecym_10861.82ON2091103431080.0
SAKL0C02618g1.82ON1988103119470.0
Kwal_33.133921.82ON196849818550.0
KAFR0D039501.82ON195758518150.0
NCAS0A005901.82ON194658518110.0
KLLA0C02321g1.82ON1842101517810.0
KLTH0F02376g1.82ON197651817650.0
Suva_14.711.82ON194858017460.0
Smik_14.661.82ON195258217450.0
YNL271C (BNI1)1.82ON195358617260.0
TDEL0C061901.82ON187956517150.0
NDAI0F042201.82ON202250717170.0
TPHA0B044901.82ON194054017030.0
CAGL0J08206g1.82ON189848616920.0
Skud_14.691.82ON194649916880.0
KNAG0F004701.82ON202850616910.0
TBLA0A054401.82ON217048916970.0
Kpol_2000.661.82ON193052716240.0
ZYRO0F16676g1.82ON199452316240.0
NCAS0G001205.717ON13144787862e-84
CAGL0H06765g5.717ON12944937692e-82
AFR301C5.717ON16554677682e-81
TDEL0F055605.717ON12924807513e-80
SAKL0E15224g5.717ON13354577481e-79
Kwal_55.196205.717ON13894807401e-78
Ecym_5679na 1ON13064617344e-78
Ecym_40045.717ON14544677366e-78
ZYRO0B16654g5.717ON14244197357e-78
Kpol_416.105.717ON14914797332e-77
KLLA0F10912g5.717ON12834807094e-75
AGL364Cna 1ON12603707061e-74
KNAG0L022505.717ON13674836901e-72
KLTH0E00704g5.717ON13894176874e-72
Smik_9.95.717ON13744886741e-70
TBLA0E018105.717ON14514796705e-70
TPHA0E001205.717ON16424726709e-70
NDAI0F001605.717ON13494126651e-69
Skud_9.85.717ON13744916642e-69
YIL159W (BNR1)5.717ON13754876581e-68
KAFR0D021205.717ON13244156429e-67
Suva_9.265.717ON13754246053e-62
TPHA0P001708.14ON66473773.6
Smik_12.1658.295ON490957765.7
ZYRO0B03718g7.408ON1115105766.1
Suva_15.4104.383ON79799756.2
Smik_6.4036.206ON24498746.4
CAGL0G03443g7.408ON1113100756.7
KLTH0H15312g8.786ON56963747.5
Suva_7.1946.206ON24198737.6
Skud_7.2066.206ON24298738.3
Suva_16.1096.206ON23098728.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR669W
         (1918 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...  3240   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...  1201   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   754   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   719   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   703   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...   702   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   690   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   684   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   677   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   676   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   669   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   665   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           665   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   660   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   656   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   654   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     655   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   658   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   630   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   630   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      307   2e-84
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   300   2e-82
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   300   2e-81
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   293   3e-80
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   292   1e-79
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   289   1e-78
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   287   4e-78
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   288   6e-78
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   287   7e-78
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   286   2e-77
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   277   4e-75
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   276   1e-74
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   270   1e-72
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   269   4e-72
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   264   1e-70
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   262   5e-70
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   262   9e-70
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     260   1e-69
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   260   2e-69
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   258   1e-68
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   251   9e-67
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   237   3e-62
TPHA0P00170 Chr16 complement(31006..33000) [1995 bp, 664 aa] {ON...    34   3.6  
Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa]...    34   5.7  
ZYRO0B03718g Chr2 complement(306092..309439) [3348 bp, 1115 aa] ...    34   6.1  
Suva_15.410 Chr15 (713004..715397) [2394 bp, 797 aa] {ON} YHR204...    33   6.2  
Smik_6.403 Chr6 complement(649777..650406,650816..650909,651311....    33   6.4  
CAGL0G03443g Chr7 complement(331868..335209) [3342 bp, 1113 aa] ...    33   6.7  
KLTH0H15312g Chr8 complement(1327047..1328756) [1710 bp, 569 aa]...    33   7.5  
Suva_7.194 Chr7 complement(357161..357790,358262..358357) [726 b...    33   7.6  
Skud_7.206 Chr7 complement(367578..368207,368667..368765) [729 b...    33   8.3  
Suva_16.109 Chr16 (183481..183543,183974..184603) [693 bp, 230 a...    32   8.3  

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score = 3240 bits (8401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1621/1905 (85%), Positives = 1621/1905 (85%)

Query: 14   QHAGQVAGATHANGGHSGGGLFSNLMKLTGSSGSQRIATSDISSPKKVTLPSNLDLSGAK 73
            QHAGQVAGATHANGGHSGGGLFSNLMKLTGSSGSQRIATSDISSPKKVTLPSNLDLSGAK
Sbjct: 14   QHAGQVAGATHANGGHSGGGLFSNLMKLTGSSGSQRIATSDISSPKKVTLPSNLDLSGAK 73

Query: 74   PLNKLNTINASNLPQVSGEVTQARSASGAALXXXXXXXXXXXXXQWASSKQANHPEHDQQ 133
            PLNKLNTINASNLPQVSGEVTQARSASGAAL             QWASSKQANHPEHDQQ
Sbjct: 74   PLNKLNTINASNLPQVSGEVTQARSASGAALSSPSKYSYSKRSSQWASSKQANHPEHDQQ 133

Query: 134  YPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKATDIDGTLTLEKPEDPXX 193
            YPQHLNHLFVQPHPHHSALTRQM                LHKATDIDGTLTLEKPEDP  
Sbjct: 134  YPQHLNHLFVQPHPHHSALTRQMTNQSNYSASSYTSLSLLHKATDIDGTLTLEKPEDPQE 193

Query: 194  XXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNSMPPSSTVE 253
                      KRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNSMPPSSTVE
Sbjct: 194  IEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNSMPPSSTVE 253

Query: 254  SIASSALAKXXXXXXXXXXXXXXXXXXXAKPMAVAYEPAHLSPDHYVRKIISDRVTAQEL 313
            SIASSALAK                   AKPMAVAYEPAHLSPDHYVRKIISDRVTAQEL
Sbjct: 254  SIASSALAKSPGGSISSGSITRSISQNSAKPMAVAYEPAHLSPDHYVRKIISDRVTAQEL 313

Query: 314  NDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLR 373
            NDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLR
Sbjct: 314  NDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLR 373

Query: 374  VLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAI 433
            VLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAI
Sbjct: 374  VLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAI 433

Query: 434  FPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGR 493
            FPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGR
Sbjct: 434  FPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGR 493

Query: 494  GRMGSLVGASDDYKGGENTVXXXXXXXXXXXXXXCSNHPDVQQRNLLRSRLKSYGLARII 553
            GRMGSLVGASDDYKGGENTV              CSNHPDVQQRNLLRSRLKSYGLARII
Sbjct: 494  GRMGSLVGASDDYKGGENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRSRLKSYGLARII 553

Query: 554  KKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEA 613
            KKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEA
Sbjct: 554  KKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEA 613

Query: 614  EGHXXXXXXXXXXWSRAFAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLY 673
            EGH          WSRAFAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLY
Sbjct: 614  EGHLLSLLQHLFLWSRAFAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLY 673

Query: 674  DAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILE 733
            DAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILE
Sbjct: 674  DAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILE 733

Query: 734  KSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPHGENGGSPEVNTSTPSPL 793
            KSNRVTDQ                         MLTILNSKPHGENGGSPEVNTSTPSPL
Sbjct: 734  KSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTILNSKPHGENGGSPEVNTSTPSPL 793

Query: 794  KPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMT 853
            KPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMT
Sbjct: 794  KPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMT 853

Query: 854  NFADFXXXXXXXXXXXXXXXXXIQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEER 913
            NFADF                 IQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEER
Sbjct: 854  NFADFKKEPEEENEPKLLSPPKIQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEER 913

Query: 914  VNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAP 973
            VNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAP
Sbjct: 914  VNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAP 973

Query: 974  LDPAHLDAKIEEMTKILDRLNKLKKDIDMSSVGTSTSNESASISTEELAGNNSSHSEISC 1033
            LDPAHLDAKIEEMTKILDRLNKLKKDIDMSSVGTSTSNESASISTEELAGNNSSHSEISC
Sbjct: 974  LDPAHLDAKIEEMTKILDRLNKLKKDIDMSSVGTSTSNESASISTEELAGNNSSHSEISC 1033

Query: 1034 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMIVTGAEAIISNASFLETLS 1093
                                                    MIVTGAEAIISNASFLETLS
Sbjct: 1034 TSPHSLSKPSISSTTGGSDAETAADAADDISDNDDETSSSMIVTGAEAIISNASFLETLS 1093

Query: 1094 QKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTITPTSSNFL 1153
            QKYGT            EHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTITPTSSNFL
Sbjct: 1094 QKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTITPTSSNFL 1153

Query: 1154 EELTQKVXXXXXXXXXXXXXXXTTPQSIKSDAADIFTAGQDKTAVVSGNSANGSDATEPS 1213
            EELTQKV               TTPQSIKSDAADIFTAGQDKTAVVSGNSANGSDATEPS
Sbjct: 1154 EELTQKVSPARSQSARSSRGSATTPQSIKSDAADIFTAGQDKTAVVSGNSANGSDATEPS 1213

Query: 1214 EIFDESRNEPLKEGTPSAPIIGTSAIGTDAKDVQAAXXXXXXXXXXXXXXXXXMFANTTS 1273
            EIFDESRNEPLKEGTPSAPIIGTSAIGTDAKDVQAA                 MFANTTS
Sbjct: 1214 EIFDESRNEPLKEGTPSAPIIGTSAIGTDAKDVQAAPPPPPPPPPPPPPPIPPMFANTTS 1273

Query: 1274 STEQVTASIQVGGAAXXXXXXXXXXXXXXXXXXXSSLTGKRTVDTSVGTEDMTENTESSS 1333
            STEQVTASIQVGGAA                   SSLTGKRTVDTSVGTEDMTENTESSS
Sbjct: 1274 STEQVTASIQVGGAAPPPPPPPPPPPPPPPPPLPSSLTGKRTVDTSVGTEDMTENTESSS 1333

Query: 1334 GTFXXXXXXXXQLGRSKTYGGXXXXXXXXXXXXFERYPRPKKKLKQLHWEKIDDPDNSIW 1393
            GTF        QLGRSKTYGG            FERYPRPKKKLKQLHWEKIDDPDNSIW
Sbjct: 1334 GTFPPPPPPLPQLGRSKTYGGSPSPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIW 1393

Query: 1394 ENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLH 1453
            ENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLH
Sbjct: 1394 ENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLH 1453

Query: 1454 MYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSV 1513
            MYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSV
Sbjct: 1454 MYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSV 1513

Query: 1514 EDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDK 1573
            EDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDK
Sbjct: 1514 EDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDK 1573

Query: 1574 AVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVE 1633
            AVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVE
Sbjct: 1574 AVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVE 1633

Query: 1634 RIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKF 1693
            RIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKF
Sbjct: 1634 RIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKF 1693

Query: 1694 HPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXX 1753
            HPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFENLMRMFGE                
Sbjct: 1694 HPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFA 1753

Query: 1754 XXILEYKRAQEFNRKIDEEERAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDD 1813
              ILEYKRAQEFNRKIDEEERAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDD
Sbjct: 1754 DFILEYKRAQEFNRKIDEEERAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDD 1813

Query: 1814 RDVMDKLLEKLKNAGPSKGDPSSARKRALARKKLMGGREGSIILEGLDVDDLQSAAPDVQ 1873
            RDVMDKLLEKLKNAGPSKGDPSSARKRALARKKLMGGREGSIILEGLDVDDLQSAAPDVQ
Sbjct: 1814 RDVMDKLLEKLKNAGPSKGDPSSARKRALARKKLMGGREGSIILEGLDVDDLQSAAPDVQ 1873

Query: 1874 PDTPLXXXXXXXXXXXXXXXXXHLLLELRNGEHPESRKSMLDEHK 1918
            PDTPL                 HLLLELRNGEHPESRKSMLDEHK
Sbjct: 1874 PDTPLRAASASPPPDPAADRARHLLLELRNGEHPESRKSMLDEHK 1918

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/1034 (62%), Positives = 750/1034 (72%), Gaps = 45/1034 (4%)

Query: 17   GQVAGATHANGGHSGGGLFSNLMKLTGSSGS---QRIATSDISSPKKVTLPSNLDLSGAK 73
            G     T  NGG  GGGLFSNLMKLTGSS +   QRIATSDISSPKKV++PS+LDLS AK
Sbjct: 21   GHGGTNTPINGG--GGGLFSNLMKLTGSSSALSQQRIATSDISSPKKVSIPSSLDLSTAK 78

Query: 74   PLNKLNTINASNLPQVSGEVTQARSASG-AALXXXXXXXXXXXXXQWA---SSKQANHPE 129
            PL+K +T+N S+L Q + E+ Q+R+ SG  +L             QW+   S+KQ     
Sbjct: 79   PLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGSPSKYSYSKRSSQWSGGNSNKQ----- 133

Query: 130  HDQQYPQHLNHLFVQPHPHHS--ALTRQMXXXXXXXXXXXXXXXXLHKATDIDGTLTLEK 187
                       L + P P HS   L+RQ                 L K TD DG L+LEK
Sbjct: 134  -----------LLLLPQPQHSQHTLSRQPTNQSNNSDNSFSSVTLLQKITDSDGNLSLEK 182

Query: 188  PEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNSMP 247
            P+ P            KRNI  SVSVH HRELM Y +DKKWLMVKQDLQ E K+MKN++P
Sbjct: 183  PKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNNVP 242

Query: 248  PSSTVESIASSA-LAKXXXXXXXXXXXXXXXXXXXAKPMAVAYEPAHLSPDHYVRKIISD 306
             S+  + +++S  L                     AK +AV+Y+P+HLSPDHYVRKIISD
Sbjct: 243  QSTVADPLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISD 302

Query: 307  RVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHDYDALEKEN 366
            R+TA ELNDLW+SLRTESIDWVIGFIDAQGQVAIANRL+KF QRESL+ L D D LEKE 
Sbjct: 303  RITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLEKET 362

Query: 367  AYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTA 426
            AYYKCLRVLTNLREGMQ AL SKLVIS+VVEGLLS RL+TRR+ATETLLYML+DDELKTA
Sbjct: 363  AYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTA 422

Query: 427  DTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVVAKRLEQWLYVI 486
            DT  DAIFP+L ALDQESK++++IHLRGRLHETNKR+SLPTGRAD HV+AK++EQWLYV+
Sbjct: 423  DTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVL 482

Query: 487  EYTLDGRGRMGSLVGASDDYKGGENTVXXXXXXXXXXXXXXCSNHPDVQQRNLLRSRLKS 546
            EYTLDGRGRMGSLVGAS+DYK GENTV              CS+HPD+ QRNLLRSRLKS
Sbjct: 483  EYTLDGRGRMGSLVGASEDYKNGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKS 542

Query: 547  YGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWT 606
            YGL+R+IKKMELLKYPALENEV KFED TLDDYN LM S+TVDS+VDMKDP +LW +FWT
Sbjct: 543  YGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWT 602

Query: 607  QHRGTEAEGHXXXXXXXXXXW-SRAFAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGF 665
            +H+GTE+E H          W S+AF+E  DPAE  KQLKLLDALV+NVTFSSIDTESGF
Sbjct: 603  RHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGF 662

Query: 666  NGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEV 725
            NGAIQRLYDAMQTDEVARRAILESRELTKK EE+KAERD+L +KL+QAQ+GLVGQLQ EV
Sbjct: 663  NGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEV 722

Query: 726  EQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPH--GENGGSP 783
            +QL+RILEKSNRVTDQ                         MLTILNSKP+    +  SP
Sbjct: 723  QQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDASNDAVSP 782

Query: 784  E-VNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDI 842
            + +N  TPSPLKPEKKMAIQKALQDRLRQTEKDLTRDS+R  TVPAPNRRLKMLRSKMD 
Sbjct: 783  DGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDD 842

Query: 843  IEKEARLLEMTNFADFXXXXXXXXXXXXXXXXXIQRSLRGEQVKELAALRKRLAIIQQES 902
            IEKEA +LEMTNFA+F                 I+R++R E+VKELAALR+RLA+IQQES
Sbjct: 843  IEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQES 902

Query: 903  NEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPELM--SLRLANGSVD 960
            NE+SKFNVEERVNELFYEKK KALDRLRDLE KY+ FGIDFN + EL+  + R  +G   
Sbjct: 903  NEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDAS 962

Query: 961  LDGPTIDLESSAP-------LDPAHLDAKIEEMTKILDRLNKLKKDIDMSSVGTSTSNES 1013
            +   +    S+AP       LDPA LDAKIEEMTKIL+ LN+LK  +D  +   S ++ S
Sbjct: 963  VGEAS---NSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVD-PTTANSGADIS 1018

Query: 1014 ASISTEELAGNNSS 1027
             SIST++   +N+S
Sbjct: 1019 TSISTDDFNIDNTS 1032

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/542 (78%), Positives = 466/542 (85%), Gaps = 11/542 (2%)

Query: 1345 QLGRSKTY-GGXXXXXXXXXXXXFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFAD 1403
            QLGR+K Y G             FE+YPRPKK+LKQLHWEKIDD DNSIWENARAEKFAD
Sbjct: 1377 QLGRTKKYKGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFAD 1436

Query: 1404 DLYEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAV 1463
            DLYE+GVL+ELEKAFAAREIKS   RKKDEN K+TFLSRDISQQFGINLHMYSSL V  +
Sbjct: 1437 DLYERGVLTELEKAFAAREIKSLISRKKDEN-KVTFLSRDISQQFGINLHMYSSLTVDQI 1495

Query: 1464 VSKILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDP 1523
            V+KILKCDKDFL+TQSAIEFLSK EIVEVS NMAR FAPYTTDWEGVSSVE+AK PEKDP
Sbjct: 1496 VTKILKCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDP 1555

Query: 1524 SELQRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSEN 1583
            +ELQR+DQL+L+LIVNLQSYW+SRMR LKLITTYEKDYNDLIIKLRSLDKAVGAIQKSEN
Sbjct: 1556 NELQRADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSEN 1615

Query: 1584 LRNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSF 1643
            LRNVFDVILAVGNYMND+SKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVE+IV  NYP F
Sbjct: 1616 LRNVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGF 1675

Query: 1644 NSFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKV 1703
            + FLQELEPVLQVVKISIEQLANDC EFCSTVTNVERSLEIGNLSDSSKFHP+DRVLAKV
Sbjct: 1676 DVFLQELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKV 1735

Query: 1704 LPILPEARKKANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQ 1763
            LP+LPEARK+ANLLADEVQLSLMEFE+LMR+FGE                  ILEYKRAQ
Sbjct: 1736 LPVLPEARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQ 1795

Query: 1764 EFNRKIDEEERAYERRKLMIQEQQRRAKLVQEGDETTCAR-----LSAISASGDDRDVMD 1818
            EFN+K++EEERAYERRK+MI+EQQ+RA+   + D +   R      S+ISASGDDRDVMD
Sbjct: 1796 EFNKKMEEEERAYERRKIMIEEQQKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMD 1855

Query: 1819 KLLEKLKNAGPSKGDPSSARKRALARKKLMGGRE-GSIILEGLDVDDL---QSAAPDVQP 1874
            +LLEKLKNAGPSK DPSSARKRALARKKLM G++ GSIIL+GLDV++L   QS   D Q 
Sbjct: 1856 RLLEKLKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQS 1915

Query: 1875 DT 1876
            D+
Sbjct: 1916 DS 1917

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 74/152 (48%), Gaps = 34/152 (22%)

Query: 1084 SNASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSI---------NSGNHR 1134
            SN SFLE+LSQKYGT             +++   +  +R S +S          NSG HR
Sbjct: 1107 SNTSFLESLSQKYGTGT-----------NLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHR 1155

Query: 1135 KSFVNRMKRTITPTSSNFLEELTQKVXXXXXXXX----XXXXXXXTTPQSIKSDAA---D 1187
            KSFVNRMK+  TP SS+F++E++QK+                   +TPQS KS+ A    
Sbjct: 1156 KSFVNRMKKNSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSSSTPQSAKSEDAVGIG 1215

Query: 1188 IFTAGQDK-TAVVSGNSA------NGSDATEP 1212
            IF+ G +   AV + N        NG D+  P
Sbjct: 1216 IFSKGTNTGMAVDTANDGQTPWIENGEDSISP 1247

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1031 (43%), Positives = 608/1031 (58%), Gaps = 98/1031 (9%)

Query: 34   LFSNLMKLTGSSG----SQRIATSDISSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQV 89
            LFSNL KLTGS      S +I  SDISSPK V+ P+  + SG KPL+K  T+N  NL   
Sbjct: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSG-KPLSKQTTLNTQNLSSY 85

Query: 90   SGEVT--QARSASGAALXXXXXXXXXXXXXQWASSKQANHPEH--DQQYPQHLNHLFVQP 145
                T    RS SG +              QW++     +      QQ  Q L+   +  
Sbjct: 86   VDMNTPHHNRSPSGMS-GSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFS 144

Query: 146  HPHHSALTRQMXXXXXXXXXXXXXXXXLHKATDIDGTLTLEKPEDPXXXXXXXXXXXXKR 205
                + LT+ M                       DG + L++P +P            KR
Sbjct: 145  QGSMTNLTKFMGA---------------------DGKVKLDRPSNPQEIEDLFAELMHKR 183

Query: 206  NIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKN----------SMPPSSTVESI 255
            N  QS+   G +ELM+Y +DKKWL+VKQDLQ+E KK+ N          +   ++T+ + 
Sbjct: 184  NFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANKKNTHVAPAGAAGLAATISAA 243

Query: 256  ASSALAKXXXXXXXXXXXXXXXXXXXAKPM-----------------AVAYEPAHLSPDH 298
                                      + P+                  ++ +P HLSPD+
Sbjct: 244  TQGTSGAGGVGGVDGTQAGSKGHNSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDY 303

Query: 299  YVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHD 358
            YVRKIISD+++ ++L DLW+SLRTE +DWV+GF+DAQGQVAIAN LL+F  +ES D L +
Sbjct: 304  YVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLN 363

Query: 359  YDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLLYML 418
             +AL+KE A++KCL+ L NL+EG  EA+++KLV+S++ +GLLS R+STRR+A+E L+++ 
Sbjct: 364  DEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFI- 422

Query: 419  SDDELKTADTGQDAIFPL---LVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHV- 474
                     T  D  + L   +  LDQES  ++N+HL+ RL   NKR SL     +  + 
Sbjct: 423  ---------TQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLT 473

Query: 475  ---VAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCS 529
                +K+ EQWL+V+EYTLDGRG+MGSLVGAS+D+K  GGEN +              C+
Sbjct: 474  RDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCN 533

Query: 530  NHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVD 589
               DV QR LLRSR KS GL+RI++K+ELL Y  ++ ++R FED T DDYN +M S +++
Sbjct: 534  TPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSIN 593

Query: 590  SAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXX-XXWSRAFAEYRDPAESIKQLKLLD 648
              VDM++P +L Q+ W  ++GT AE +            S+   E  DP E+ KQLKL+D
Sbjct: 594  HNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLID 653

Query: 649  ALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLAS 708
            +LV+NVT SSIDTES FNGAIQRLYD+MQTDEVARRAI+E+RELT+K+EE+KAERD L  
Sbjct: 654  SLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGE 713

Query: 709  KLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXML 768
            KLS+A+ GLVGQLQ+E+ Q +RILEK+ RVT+Q                         +L
Sbjct: 714  KLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLL 773

Query: 769  TILNSKPHGENGGSPE----VNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLN 824
            TILNS+P G +    E     ++S P  L  ++K+AIQKALQDRL+QT+KDLT++SKRL 
Sbjct: 774  TILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLG 833

Query: 825  TVPA----PNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXX------ 874
            T       PNRRLK+LRS+M+ IE EAR LEMTNFAD                       
Sbjct: 834  TTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVL 893

Query: 875  ----XIQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLR 930
                  ++ ++ +QV++L  LR+RLA +Q+ESN+VSKFNVEER+NELF +KK  ALDRL+
Sbjct: 894  DRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLK 953

Query: 931  DLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKIL 990
            +LE KYKGFGIDF  DPEL ++ L++   + +    D ++   LDP HL  KIEEM+KI+
Sbjct: 954  ELETKYKGFGIDFQADPELSAM-LSDAPPE-NHHAKDGQAHPSLDPKHLSRKIEEMSKIV 1011

Query: 991  DRLNKLKKDID 1001
            D L   KK+I+
Sbjct: 1012 DELTAFKKEIE 1022

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/509 (67%), Positives = 420/509 (82%), Gaps = 10/509 (1%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FERYPRPKKKLKQLHWEKI+D  NSIW++A+AEK+ADDLYE+GVL++LEKAFAAREIK  
Sbjct: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              R+K++ NK+TFLSRD+SQQFGINLHMY++L V  VV KIL+CDKDFL + S I+FL K
Sbjct: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            PEIVEVS N+AR+FAPY+T+WEGVSSV++AK+PEKDP ELQR+DQL+L ++VNLQ YW+S
Sbjct: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR LK+ITTYEK+Y+DL+ KLRS+DKAV +IQ S+NLR+VF+VILAVGNYMND+SKQA 
Sbjct: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKL+TLQRLTFIKDEKNSMTFLNYVE+I+ +NY  FNSFLQELEPVL VVKIS+EQLA 
Sbjct: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF   + NVERS+E+GNLSDSSKFHP DRVL KVLP+LPEARK+++LL+DEV+L+LM
Sbjct: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF+ LM+MFGE                  I EYK+AQ  N K++EEERAYERRK M++EQ
Sbjct: 1667 EFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAYERRKKMVEEQ 1726

Query: 1787 QRRAKLVQE----GDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRAL 1842
             +RA+L  E     D +    ++A+S    +RDVMDKLLEKLKNAGP K DPSSARKRAL
Sbjct: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRG--ERDVMDKLLEKLKNAGPGKSDPSSARKRAL 1784

Query: 1843 ARKKLMGGREGSI-ILEGLDVDDLQSAAP 1870
            ARKKL+ G+  S  IL+  +VD+   AAP
Sbjct: 1785 ARKKLLDGKRSSANILDNFEVDE---AAP 1810

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 41/77 (53%), Gaps = 12/77 (15%)

Query: 1084 SNASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKR 1143
            S  SFLETLSQKYGT               R +V    R S N    G HR+SF+ R+K+
Sbjct: 1051 STGSFLETLSQKYGTGQNAGPTASS-----RAMVG---RES-NYPGRGYHRRSFMERVKK 1101

Query: 1144 TITPTSSNFLEELTQKV 1160
            +    ++ FL ELTQKV
Sbjct: 1102 S---DAAPFLSELTQKV 1115

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/498 (68%), Positives = 411/498 (82%), Gaps = 1/498 (0%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FERYPRP KKLKQLHWEKIDD ++SIW+NA+AE+FADDLYEKG+LS LEKAFAAREIKS 
Sbjct: 1315 FERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSL 1374

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              RKK +++K+TFLSRD+SQQFGINLHMYSSL V  VV+KILKCDKDFL+T S IEFLSK
Sbjct: 1375 TSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSK 1434

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             EIVEVS N+AR+FAPYTTDWEG+++V+DAK PEKDPSELQR+D+L+L L VNLQ YWSS
Sbjct: 1435 QEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLELFVNLQGYWSS 1494

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR LK+IT+YEK+Y+DLI KLR +DKA  AIQ+SENLRNV DVILAVGN+MND+SKQAQ
Sbjct: 1495 RMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1554

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GF+L+TLQRLTFIKD+KNSMTFLNYVE+IV + YP FN FL+ELEPV+  VKISIEQ++ 
Sbjct: 1555 GFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQ 1614

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  +V NVERS++IGNLSDSSKFHP DR L KVLP+LPEARKK +LL DE++L+L+
Sbjct: 1615 DCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLL 1674

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF+NLM+MFGE                  + EYK+AQ +N K++EEE+AYERRK M++EQ
Sbjct: 1675 EFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQ 1734

Query: 1787 QRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARKK 1846
            QRRA+   E + +        +A+  DRDVMD+LLEKLKNAGP K DPSSARKRA+AR+K
Sbjct: 1735 QRRARESNEQENSVDGNADDNTAASGDRDVMDRLLEKLKNAGPGKSDPSSARKRAIARRK 1794

Query: 1847 LM-GGREGSIILEGLDVD 1863
            L+ G    S IL+  +++
Sbjct: 1795 LLQGSSSNSTILDNFEIE 1812

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1199 (36%), Positives = 615/1199 (51%), Gaps = 194/1199 (16%)

Query: 25   ANGGHSGGGLFSNLMKLTGSSGS------QRIATSDISSPKKVTLPSNLDLSGAKPLNKL 78
            A+ G   GG+FSNL +LTG++ +      Q++  SDISSPKK+ LP   + S  KPL+K 
Sbjct: 18   ASNGSGNGGIFSNLKRLTGNANNSSSQTLQKVDISDISSPKKINLPDTGEFS-HKPLSKQ 76

Query: 79   NTINASNLPQVSGEV-TQARSASGAALXXXXXXXXXXXXXQWASSKQANHPEHDQQYPQH 137
            +T+N +NL   +    T  RS+S A+              QW SS     P         
Sbjct: 77   STLNIANLSAYTDVASTHNRSSSAASNSSPTKYSYSRRASQW-SSNGGTAPS-------- 127

Query: 138  LNHLFVQPHPHHSALTRQMXXXXXXXXX--XXXXXXXLHKATDIDGTLTLEKPEDPXXXX 195
                        + L+RQ                   L K    DG++ LEKP DP    
Sbjct: 128  ------------TKLSRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIE 175

Query: 196  XXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKN----SMPP--- 248
                    KRN+ QS+     +EL +Y ++KKWLMV+QDLQ+E KK  N    S  P   
Sbjct: 176  ELFEEVLYKRNVYQSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMNNKSVSKSPAAA 235

Query: 249  --------------------SSTVESIASSALAKXXXXXXXXXXXXXXXXXXXAKPMAVA 288
                                SS  ES+A S+ ++                        ++
Sbjct: 236  STGISLIAPESPSTGHFASNSSINESLAGSSRSRAQNPGTSDQFYGSNNGTSST--TTLS 293

Query: 289  YEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFV 348
             +P+HLSPD+YVRKII + ++A+ LNDLW+SLRTE +DWV+GF++AQGQVAIAN +LK  
Sbjct: 294  QDPSHLSPDYYVRKIICNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTC 353

Query: 349  QRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVV---EGLLSSRLS 405
             RES D L   + L+KE AY+KCL+   NL+EG  EA+ S      +    EGLLS R++
Sbjct: 354  YRESPDNLLGDEVLDKEFAYFKCLKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVA 413

Query: 406  TRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSL 465
            TRR+A+E LL  LS   L    T       ++ ALDQES+F  N+HL+ RL      K +
Sbjct: 414  TRRIASE-LLVSLSQWALPHGFTH------VMNALDQESRFCDNVHLQARLLSQTSNKEI 466

Query: 466  PTG-RADFHV------VAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXX 516
                R+          + ++ EQW+ V+EYTLDGRG+MGSLVGAS+D++  GGEN +   
Sbjct: 467  KNSLRSSLLADNNGDRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEY 526

Query: 517  XXXXXXXXXXXCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATL 576
                       C    DV+QR +LR+RLK+ GL RI+ KM+ L Y  ++ ++  FED+T 
Sbjct: 527  AYLTLLLVNHLCQTPVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTT 586

Query: 577  DDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWSRAFA--EY 634
            DD++ L +       ++M+DP ++ Q+ W   +GTEAE H           +        
Sbjct: 587  DDFDTLYSQGPNGELINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSK 646

Query: 635  RDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTK 694
             DPA+  KQLKL+DALV+NV+ +S+D +S FN AIQRLYDAMQTDE+ARRAILE+R+  K
Sbjct: 647  EDPAQRTKQLKLIDALVSNVSMASVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVK 706

Query: 695  KYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXX 754
            +YEEIKAER+NL  KLS A+ GLVGQLQ E++Q + ILEKS RVT Q             
Sbjct: 707  RYEEIKAERNNLKEKLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLI 766

Query: 755  XXXXXXXXXXXXMLTILNSKPHG----ENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLR 810
                         LT LNSK       E+GG P+       PLKPE+ +AIQ+ALQ +L 
Sbjct: 767  LAKHQHEVELRKTLTALNSKGGDIQLTEDGGQPK-------PLKPERMLAIQRALQIKLE 819

Query: 811  QTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXX 870
            +T K++T +S RL     PN+RL++LRS+M+ IE +AR LEMTNF+++            
Sbjct: 820  KTSKEITVESSRLGVSLEPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAH 879

Query: 871  XXXXXIQRSLRGEQVKE----LAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKAL 926
                     +     ++    L  LR++LA +Q ESN++SKFNVE R +E+F ++K +AL
Sbjct: 880  EGTHMYPSDVDVGTTQDSNLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQAL 939

Query: 927  DRLRDLENKYKGFGIDFNEDP-ELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEE 985
            DRL+ LEN Y GFGI++  DP E  SL+   G         D+  S  LDP   +  ++E
Sbjct: 940  DRLKKLENDYSGFGINY--DPAESPSLKQEQGQ--------DVNKSRTLDPKGPNNSVDE 989

Query: 986  MTKILDRLNKLKKDIDMSSVGTSTSNESASISTEELAGNNSSHSEISCXXXXXXXXXXXX 1045
                    ++L+ D   +S+ +S ++E  S+  E++    S+  EI              
Sbjct: 990  --------SQLETDRANASIDSSPASE--SLEEEDVHLTKSTTEEIG------------- 1026

Query: 1046 XXXXXXXXXXXXXXXXXXXXXXXXXXXXMIVTGAEAIISNASFLETLSQKYGTXXXXXXX 1105
                                                     SFLE LSQKYG        
Sbjct: 1027 ----------------------------------------GSFLERLSQKYG-------- 1038

Query: 1106 XXXXXEHMRGVVNVKRRTS----QNSI-NSGNHRKSFVNRMKRTITPTSSNFLEELTQK 1159
                    +G  N+  R S    +NS   SG HRKSF+NR+K++    +  +LEEL+ K
Sbjct: 1039 --------KGQANLSNRNSVVGRENSYPGSGYHRKSFMNRVKKS---DNVPYLEELSGK 1086

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/585 (60%), Positives = 430/585 (73%), Gaps = 43/585 (7%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FERYPR +KK+KQLHWEKI+  DNSIW   +AE+FADDL+EKGV S LEKAFAARE+KS 
Sbjct: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              ++KD+ +KITFLSRDISQQFGINLHMYSSL V  +V+KILKCD+DFL T S IEFLSK
Sbjct: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            PEI EVS N+AR+++PYTTDWEG+ S+EDAK PEKDP++LQR+DQ++L L+VNLQ YW+S
Sbjct: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR LK+ITTYEK+YN+L++KLR +DKAVG++Q+SENLRNVF+VILAVGNYMNDTSKQAQ
Sbjct: 1480 RMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYPSFNSFLQELEPVL+VVKISIEQLAN
Sbjct: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  +VTNVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ RKK +LL DEV L+LM
Sbjct: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF+ LM+++GE                  I EY++AQE N K++EEE AYER K M++EQ
Sbjct: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERHKRMVEEQ 1719

Query: 1787 QRRAKLVQEGDETTCARLSAISASGDD-------RDVMDKLLEKLKNAGPSKGDPSSARK 1839
            QR+A+  +  ++        I  + DD       R  MDKLLE+LKN GPS+ DPSSARK
Sbjct: 1720 QRKAERKEAKNQNN------IDENEDDDQERTDRRGTMDKLLEQLKNVGPSRADPSSARK 1773

Query: 1840 RALARKKLMGGREGSIILEGLDVDDLQSAAPDV--QPD---------------------- 1875
            RALARKK++  +EG++ +    + DL++ +  +   PD                      
Sbjct: 1774 RALARKKMLTDKEGTVNM----MHDLETESDSIIYSPDNKAIGSTPFGANGASSHKQNSN 1829

Query: 1876 --TPLXXXXXXXXXXXXXXXXXHLLLELRNGEHPESRKSMLDEHK 1918
              +P                   LL+ LR    P  R SMLDEHK
Sbjct: 1830 ELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHK 1874

 Score =  505 bits (1300), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 330/875 (37%), Positives = 472/875 (53%), Gaps = 76/875 (8%)

Query: 180  DGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEY 239
            DG   LE P DP            KRNI Q++SV   RELM+Y + KKWL+VKQD+Q E+
Sbjct: 165  DGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEF 224

Query: 240  KKMKNSM--PPSST---VESIASSALAKXXXXXXXXXXXXXXXXXXXAKPMAVAYEP--- 291
            K+++ +   P +S+   VE +  S                       A   +  Y P   
Sbjct: 225  KRIRATKNGPKNSSLVNVEQLVYSPTTTTTNNNNNNNNSNYNNTSPMASVASNEYYPMTS 284

Query: 292  ----------------------------AHLSPDHYVRKIISDRVTAQELNDLWISLRTE 323
                                         +  P+ YV KII+D+++  E+ DLW++LRTE
Sbjct: 285  PQTKKPTSHELYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTE 344

Query: 324  SIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQ 383
             +DWV  F++ QG +A+AN L+K + + +         LEKEN+++KC +VL+ L +G+ 
Sbjct: 345  QLDWVDSFLENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIY 404

Query: 384  EALKSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQE 443
            E  K KL+  ++  GL S+RL TR++A E  + ML     K   +  +AI   L +LDQ 
Sbjct: 405  EFSKHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLE----KRNKSRFEAI---LNSLDQN 457

Query: 444  SKFAANIHLRGRLHETNKRKSLPTG----RADFHVVAKRLEQWLYVIEYTLDGRGRMGSL 499
             +  +N H+   L      K LP        D H+  K L+ WL+ IE T+DGRG+MGSL
Sbjct: 458  FRIGSNFHMFQNL------KKLPQYFIHLTPDSHL--KVLQAWLFSIENTIDGRGKMGSL 509

Query: 500  VGASDDYK--GGENTVXXXXXXXXXXXXXXCSNHPDVQQRNLLRSRLKSYGLARIIKKME 557
            VGAS D K  GGEN +              C+    +QQR LLR++L++ G  RI+ K++
Sbjct: 510  VGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIK 569

Query: 558  LLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHX 617
            LL Y  + +E+  +E+  LDD+NL++ S   +S V+++DP +L  + W   +GTE E   
Sbjct: 570  LLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLL 629

Query: 618  XXXXXXX-XXWSRAFAEYRDPAESIKQLKLLDALVTNVTFSSI-DTESGFNGAIQRLYDA 675
                       SR   E  DP +  KQLKL+D+LVTNV+ SS  D ES  N AIQRLYD+
Sbjct: 630  ISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDS 689

Query: 676  MQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKS 735
            MQTDEVARRAILESR LTKK EE++AE+D L  KLS+A+NGLVGQL++++ + ++IL K+
Sbjct: 690  MQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKN 749

Query: 736  NRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPHGENGG-SPEVNTSTPSPLK 794
             RVT Q                         MLTILN++    +G  + + +    S L 
Sbjct: 750  QRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTILNTRSSTNDGAKTIDKDKDNISKLN 809

Query: 795  PEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTN 854
             +K   IQK LQD L + + D T D+K+      PN+RLKMLR +M+ IE EAR LEMTN
Sbjct: 810  LQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTN 869

Query: 855  FADFXXX--------XXXXXXXXXXXXXXIQRSLRGEQ---VKELAALRKRLAIIQQESN 903
            F +F                         I +    +Q   + +L  LR+ LA IQ ESN
Sbjct: 870  FTEFERKKLEPPVEVTKPKHRHKKHKIEKINQQESNDQKSRINKLNDLREALAEIQTESN 929

Query: 904  EVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDG 963
             +SKFN+EERVNELF EKK KAL RL++LE KYK FGI+F E  + +  +  +G+   +G
Sbjct: 930  NISKFNLEERVNELFNEKKLKALQRLKELETKYKDFGINF-EMKDFLENKPNDGTK--EG 986

Query: 964  PTIDLESSAPLDPAHLDAKIEEMTKILDRLNKLKK 998
             T   E    LDP   + K++++ ++ ++L  L+K
Sbjct: 987  ST--EEEYESLDPKIYEKKLDDIDRLTEQLLNLQK 1019

 Score = 41.2 bits (95), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 18/74 (24%)

Query: 1087 SFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTIT 1146
            SFLETLS+KYGT                G  NV    + NS       K F++RM+R  +
Sbjct: 1061 SFLETLSEKYGT----------------GQKNVAMTATPNSRIVTQSEKQFLDRMRR--S 1102

Query: 1147 PTSSNFLEELTQKV 1160
             T++ FL+ELT+KV
Sbjct: 1103 STAAPFLQELTEKV 1116

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/585 (60%), Positives = 427/585 (72%), Gaps = 38/585 (6%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE YPRP+KKLKQLHWEK+D  DNSIW+  +AEKFADDLYEKGVL++LEKAFAAREIKS 
Sbjct: 1288 FENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSL 1347

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              +KK++ +KI+FLSRDISQQFGINLHMY++LPV  VV KILKCD+DFL T S IEFLSK
Sbjct: 1348 ASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSK 1407

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            PEIVEVS N+AR++APY+TDWEGV SVEDAK+PEKDP+ELQR+DQL+L LI+NLQSYW S
Sbjct: 1408 PEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGS 1467

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR L +ITT++K+YN+L+ KLR +DKAV ++Q+SENL+NVF+VILAVGNYMNDTSKQAQ
Sbjct: 1468 RMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQ 1527

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKL+TLQRLTFIKD  NSMTFLNYVE+IV  NYPSFN FL ELEPVL VVKISIEQL +
Sbjct: 1528 GFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVS 1587

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  ++ NVERS+E GNLSDSSKFHP DRVLAKVLPILP+ARKK  LL DEV+L++M
Sbjct: 1588 DCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIM 1647

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF  LM+++GE                  I EYK+AQ  N K +EEE+ YER K M+++Q
Sbjct: 1648 EFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQ 1707

Query: 1787 QRRAKLVQEGDETTCARLSAISASGDD----RDVMDKLLEKLKNAGPSKGDPSSARKRAL 1842
            Q++   +QE +  +    +    SGDD    R +MDKLL++LKNAGPSK DPSSARKRAL
Sbjct: 1708 QKK---LQEQENGSNGSENGEEGSGDDSGDRRAMMDKLLDQLKNAGPSKTDPSSARKRAL 1764

Query: 1843 ARKKLMGGREGSIILEGLDVDD------LQSAAPDVQP---DTPLXXXXXXXXXX----- 1888
             RKKLM   E + +L+ ++ +D       +   P V P   DTP                
Sbjct: 1765 VRKKLMT--ESTALLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHDESEMDVSSSPIQRS 1822

Query: 1889 ---------------XXXXXXXHLLLELRNGEHPESRKSMLDEHK 1918
                                   LL+ELR    P  R S+LDEHK
Sbjct: 1823 LSPSRNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEHK 1867

 Score =  509 bits (1312), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 298/715 (41%), Positives = 423/715 (59%), Gaps = 25/715 (3%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDI 355
            P HYV++II+D +T++E+ DLW++LRTE IDWV  FI+ QG +A+AN L+K + + S D 
Sbjct: 315  PIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDG 374

Query: 356  LHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLL 415
              +   LEKENA++KC RVL+ L +G++E  + +++  +V  GL S  LSTRR+ATE  +
Sbjct: 375  TPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFV 434

Query: 416  YMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVV 475
             ML   E K  +  +     +L ALDQ+ K   N H+      T   K  P       + 
Sbjct: 435  CML---EKKNPERFK----VILNALDQKFKIGYNAHM------TQNIKMFPDYFTHLTLD 481

Query: 476  A--KRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCSNH 531
            +  K  + WL+ +E+TLDGRG+MGSLVGASDD+K  GGEN +              CS  
Sbjct: 482  SQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCS 541

Query: 532  PDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSA 591
             ++ QR LLR++L++ G+ RI+ K++ L Y  +  ++  +E+  LDD N L+ S   ++ 
Sbjct: 542  SNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNAN 601

Query: 592  VDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWSRAFAE-YRDPAESIKQLKLLDAL 650
            ++++DP ++ ++ W   +GTE E             S  F E  +DP +  +QLKLLD+L
Sbjct: 602  INLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSL 661

Query: 651  VTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKL 710
            VTNV+ SS D E+  N AIQRLYDAMQTDEVARR+ILESR LTKK EE++AERD L+ KL
Sbjct: 662  VTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKL 721

Query: 711  SQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTI 770
              A++GLVGQLQ E+ Q +RIL K+ RV +Q                         MLTI
Sbjct: 722  KNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRKMLTI 781

Query: 771  LNSKPH--GENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPA 828
            LN++P     NG S +     PS L P KK +IQ+ALQD L +T+KD + D++       
Sbjct: 782  LNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQ 841

Query: 829  PNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXXXIQRSLRGEQVKEL 888
            PN+RLK+LR +M+ IE EAR LEMTNF ++                   +      + +L
Sbjct: 842  PNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKVATKKEIDPSINKL 901

Query: 889  AALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPE 948
              LR+ LA IQ ESN++SKFNV+ERVNELF +K+  AL RL+DLE KYK FGIDFN D E
Sbjct: 902  NDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNID-E 960

Query: 949  LMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRLNKLKKDIDMS 1003
            L+     + S D +G        + LDP     K++E+ ++ D L ++K  ++ S
Sbjct: 961  LVD----SASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNAS 1011

 Score = 65.9 bits (159), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 38/64 (59%)

Query: 180 DGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEY 239
           DG + LE P DP            KRNI QS+      ELMSY ++KKWL+VKQDLQ E 
Sbjct: 154 DGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEM 213

Query: 240 KKMK 243
           KKM+
Sbjct: 214 KKMR 217

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1015 (40%), Positives = 583/1015 (57%), Gaps = 89/1015 (8%)

Query: 14   QHAGQVAGATHANGGHS-------GGGLFSNLMKLT-----GSSGSQRIATSDISSPKKV 61
            Q +    G T     HS       G  LFSNL KL      GSS   +     ISSPK+V
Sbjct: 2    QRSQSSRGPTGNENSHSRSLSNSQGSSLFSNLKKLATGGNHGSSQPSQTRKELISSPKRV 61

Query: 62   ----TLPSNLDLSGAKPLNKLNTINASNLPQVSGEV-TQARSASGAALXXXXXXXXXXXX 116
                +L S   + G+KPLNK++++N  NL   + +    +RS S + L            
Sbjct: 62   FTTASLESATPIGGSKPLNKISSLNTHNLSHYTMDPEANSRSQSASLLTSPTKYSYSRRS 121

Query: 117  XQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKA 176
             Q   S                              T +                 L++ 
Sbjct: 122  SQLTRSS-----------------------------TNKSIISSSAVSVSSNSTSILNRF 152

Query: 177  TDIDGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQ 236
               DGTL L++PE+P            KRN+  SVS    +++++Y I+KKWLMVKQDLQ
Sbjct: 153  LTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQ 212

Query: 237  TEYKKMKNSMPPSSTVESIASSALAKXXXXXXXXXXXXXXXXXXXAKPMAVAYEPAHLSP 296
            +E+K++K++ P  S  ++   + L +                   ++   ++  P+H  P
Sbjct: 213  SEFKRLKSTKPRFSANDT--QNMLKRKTSTSKLNTQYEGMLHTNESQGSLLS--PSHFPP 268

Query: 297  DHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLD-- 354
            ++YVR+IIS ++  +ELNDLW+SLRTE +DWVI F++AQGQVAIAN ++  + +++ D  
Sbjct: 269  EYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTDNQ 328

Query: 355  -ILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATET 413
              + D   LE+E A +KCLRVL N+RE ++EA+ S LV +++VEGLLS+++ TRR+ATET
Sbjct: 329  NAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLATET 388

Query: 414  LLYMLSDDE-LKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADF 472
            L+Y+++ DE  K+   G D    ++ +L+ E+    NIH++ +    +     P      
Sbjct: 389  LIYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTNDSTD--PESNPQL 446

Query: 473  HVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYKG--GENTVXXXXXXXXXXXXXXCSN 530
            + V K L+QWLYV+E TLDGRG+MGSLVGASD+Y+   GEN++              C N
Sbjct: 447  YQVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLN 506

Query: 531  HPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDS 590
            + DV++R+++R++LKS+GL RI++KM+LL YP L   + +FEDA +DDYN L+ S     
Sbjct: 507  NEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTE 566

Query: 591  AVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWSRAFA-EYRDPAESIKQLKLLDA 649
             VDM DP ++ Q   +  +GTEAE +           S   A E  DP ++++QLKL+D+
Sbjct: 567  NVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLIDS 626

Query: 650  LVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASK 709
            L++NV  +++D+ES FN AIQRLYD+MQTDE+ARRAILESRELTKK EE+KAERD L  K
Sbjct: 627  LISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDK 686

Query: 710  LSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLT 769
            +S+A+NGLVGQLQ E+ + + IL+K+ RVT+Q                         MLT
Sbjct: 687  ISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLT 746

Query: 770  ILNSKPHG--ENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVP 827
            I+NSK     E+G + +   + P PL PE+K AIQ  LQ  L++TE+DL  +S+RL T  
Sbjct: 747  IVNSKTSDDLESGSTVQ---NDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAV 803

Query: 828  APNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXXXIQRSLRGEQVKE 887
                RLK+LRSKM+ IE +AR LEMTNFAD                   +  ++G+Q  +
Sbjct: 804  GSKSRLKLLRSKMEDIENQARELEMTNFADV----------KPKQNQKFKEQVKGQQATK 853

Query: 888  LAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNEDP 947
            LA LRK+LAIIQ ESN+++KFN+E RVNELF +KK  ALDRL+DLENKY GF IDF +DP
Sbjct: 854  LAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDFADDP 913

Query: 948  ELMSL--RLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRLNKLKKDI 1000
            EL  L  + +NG     GP+        LDP  +  K+EEM  I+D LN LK+++
Sbjct: 914  ELKELLTQSSNG-----GPS--------LDPTIVQRKVEEMNSIIDELNALKEEM 955

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/498 (66%), Positives = 404/498 (81%), Gaps = 4/498 (0%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FERYPRPKKKLKQLHWEKID+  +SIW+NA+AEK ADDL+E+GVLS+LEKAFAARE KS 
Sbjct: 1226 FERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSL 1285

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
            KG+ K+ N KITFLSRD+SQQFGINLHM+S+L V  VV K++KCD++FLST S IEFLSK
Sbjct: 1286 KGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSK 1345

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            P I+EV+ N+AR F PY+TDWEGV+SV+DAK PEKDP+ELQR+DQL++  ++NLQ YW S
Sbjct: 1346 PTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEFMINLQPYWGS 1405

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR + +ITTYEKDY+DL+ KLR +D+AV  I++SE+LR+VFDVILAVGNYMND+SKQAQ
Sbjct: 1406 RMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQ 1465

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKDEKNSMTFLNYVE+I+ +NYP ++ F++ELEP+  V KISIEQL  
Sbjct: 1466 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVT 1525

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  +V NVERS+EIGNLSD SKFHP DRVL KV+P+LPEARKKA+LL+DE++LSL+
Sbjct: 1526 DCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLL 1585

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EFENLM+ FGE                  I E+K+A+  N K++EEERAYERRK MI++Q
Sbjct: 1586 EFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQ 1645

Query: 1787 QRRAKLVQEGDETTCAR-LSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARK 1845
            QR+    QE D    A+ LS      DDRD ++KLL+KLKNA PSKGDPSS RKRALARK
Sbjct: 1646 QRKQ---QEADSKATAKNLSTSQEPSDDRDDIEKLLDKLKNAAPSKGDPSSTRKRALARK 1702

Query: 1846 KLMGGREGSIILEGLDVD 1863
            KL+ G+ G+ I + +  D
Sbjct: 1703 KLLDGKSGASIFDNITAD 1720

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (51%), Gaps = 16/89 (17%)

Query: 1078 GAEAIISNASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSF 1137
            G++ + + +SFLE+LSQKY T                G V  + R       SG HRKSF
Sbjct: 990  GSDIVSNGSSFLESLSQKYSTGQQTATSTNG------GRVGRETRYP----GSGYHRKSF 1039

Query: 1138 VNRMKR-TITPTSSN-----FLEELTQKV 1160
            +NR+K  T+ PT+++     FL EL  KV
Sbjct: 1040 LNRLKNTTVNPTATSEHLPPFLTELKSKV 1068

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/518 (65%), Positives = 411/518 (79%), Gaps = 15/518 (2%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            F+RYPRP KKLKQLHWEKIDD ++SIW +A+AEKFADDLYEKGVLS LEKAFAAREIKS 
Sbjct: 1332 FDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSL 1391

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              RKK +++K++FLSRD+SQQFGINLHMYSSL V  VVSKIL+CD+DFLST S I+FLSK
Sbjct: 1392 ASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             EIVEVS N+AR+FAPYT DWEGVSSVE+AK PEKDP+ELQR+D+L+L L VNLQ+YWSS
Sbjct: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR LK+ITTYEKDY+DL+ KL  +DKA  +IQ+SENLRNV DVILAVGN+MND+SKQAQ
Sbjct: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GF+L+TLQRLTFIKD+KNSMTFLNYVE+I+ + YP FN FL+ELEPV+  VKISIEQ+A 
Sbjct: 1572 GFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQ 1631

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  +V NVERS++IGNLSD +KFHP DRVL KVLP LPEARKK +LL DE++L+L+
Sbjct: 1632 DCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLL 1691

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF+NLMR+FGE                  +LEYK+AQ +N K++EEERAYERRK ++++Q
Sbjct: 1692 EFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQ 1751

Query: 1787 QRRAKLVQEGDETTCARLSAISASGD--------DRDVMDKLLEKLKNAGPSKGDPSSAR 1838
             +R +      E+         A GD        DRDVMD+LLEKLKNAGP+K DPSSAR
Sbjct: 1752 LKRTR------ESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSSAR 1805

Query: 1839 KRALARKKLM-GGREGSIILEGLDVDDLQSAAPDVQPD 1875
            KRA+ARK+L+ G    S IL+  D++D    +    PD
Sbjct: 1806 KRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPD 1843

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1180 (37%), Positives = 616/1180 (52%), Gaps = 157/1180 (13%)

Query: 37   NLMKLTGSSG-------SQRIATSDISSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQV 89
            NL +LT  SG       +Q++  SDISSPKK+ LP   + S  KPL+K +T+N ++L   
Sbjct: 30   NLKRLTTGSGNSSVSHNTQKLDISDISSPKKINLPDTGEFS-HKPLSKQSTLNMASLSAY 88

Query: 90   SGEV-TQARSASGAALXXXXXXXXXXXXXQWASSKQANHPEHDQQYPQHLNHLFVQPHPH 148
            +  V    RSAS A++             QW+++  A                       
Sbjct: 89   TDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSA---------------------VS 127

Query: 149  HSALTRQMXXXXXXXXX--XXXXXXXLHKATDIDGTLTLEKPEDPXXXXXXXXXXXXKRN 206
             S L+RQ                   L K    DG + LE+P DP            KRN
Sbjct: 128  GSKLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRN 187

Query: 207  IPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNS----------------MPPSS 250
            + QS+     REL +Y ++KKWLMV+QDLQ+E KK  NS                +P S 
Sbjct: 188  VYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAVPDSP 247

Query: 251  TVESIASS----------ALAKXXXXXXXXXXXXXXXXXXXAKPMAVAYEPAHLSPDHYV 300
            +  +  SS          +  K                   +    ++ +P+HLSPD+YV
Sbjct: 248  SASNFTSSTSPNGSFTGLSRPKISTSSVNTSEQFYSSNLGTSSTTTLSQDPSHLSPDYYV 307

Query: 301  RKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHDYD 360
            RKII + ++A+ LNDLW+SLRTE +DWV GF++AQGQVAIAN +LK   RES D L   +
Sbjct: 308  RKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDE 367

Query: 361  ALEKENAYYKCLRVLTNLREGMQEALKS---KLVISSVVEGLLSSRLSTRRVATETLLYM 417
             L+KE AY+KCL+   NLREG  EA+ S   ++++S++VEGLLS R++TRRVA+E LL  
Sbjct: 368  VLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASE-LLIS 426

Query: 418  LSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRL------HETNKRKSL-PTGRA 470
            LS   L            ++ ALDQES+F  N+HL+ RL       +  K  S+ PT   
Sbjct: 427  LSQWSLP------HGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDG 480

Query: 471  DFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXC 528
            D   V ++ EQW+ V+EYTLDGRG+MGSLVGAS+D++  GGEN +              C
Sbjct: 481  DGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLC 540

Query: 529  SNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTV 588
                DV+QR +LR+RLK+ GL RI+ KM+LL Y  ++ ++ +F+D+T DD++ L +  + 
Sbjct: 541  QTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQEST 600

Query: 589  DSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWSRAFAEYR--DPAESIKQLKL 646
               VDMKDP ++ Q+ W   +GT+AE H           +         DP +  KQLKL
Sbjct: 601  GEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKL 660

Query: 647  LDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNL 706
            +DALV+NV+ +S+D +S FN AIQRLYDAMQTDE+ARRAILE+R+  K+YEEIKA+RDNL
Sbjct: 661  IDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNL 720

Query: 707  ASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXX 766
              KLS A+ GLVGQLQ EV Q + ILEKS RV  Q                         
Sbjct: 721  KEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRK 780

Query: 767  MLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTV 826
             LT +NS   G +    E  +  P PL+PE+K+AIQKALQ +L +T K++  +SKRL   
Sbjct: 781  TLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLS 840

Query: 827  PAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXXXI--QRSLRGEQ 884
              PN+RLK+LRS+M+ IE +AR LEMTNF+D+                    +   + +Q
Sbjct: 841  LEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQ 900

Query: 885  VK--ELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGID 942
            +   +L  LRK+LA +QQESN++SKFNVE R +E+F  +K+ ALDRL+ LE  YKGFGI+
Sbjct: 901  ISALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGIN 960

Query: 943  FNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRLN--KLKKDI 1000
            F+ D  L    LA  SV  D      + +  LDP      +EE++ IL  L+  K  +  
Sbjct: 961  FDPDSPLGQA-LAGKSVSSD------DKARTLDPKEALNIVEEVSNILSGLDSSKAAEKS 1013

Query: 1001 DMSSVGTSTSNESASISTEELAGNNSSHSEISCXXXXXXXXXXXXXXXXXXXXXXXXXXX 1060
            + + + T+TS++S+    ++  G+                                    
Sbjct: 1014 NETPLRTATSSDSSEDEMDDKNGDK----------------------------------- 1038

Query: 1061 XXXXXXXXXXXXXMIVTGAEAIISNASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVK 1120
                              A++ +  +SFLE+LSQKYG                 G +N  
Sbjct: 1039 ----------------IAADSTLPTSSFLESLSQKYGGAQNSLSNRHS---FAGGEINYP 1079

Query: 1121 RRTSQNSINSGNHRKSFVNRMKRTITPTSSNFLEELTQKV 1160
                     SG HRKSF+NR+KRT    +  +L EL+ K+
Sbjct: 1080 --------GSGYHRKSFMNRVKRT---GAVPYLGELSGKI 1108

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/580 (58%), Positives = 420/580 (72%), Gaps = 29/580 (5%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE+YPRP KKLKQLHWEKID  DNSIW + +AEKFADDLYEKGVL++LEKAFAAREIKS 
Sbjct: 1345 FEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1404

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              ++K++  K+TFLSRDISQQFGINLHMYSSL V+ +V KILKCD+DFL T S +EFLSK
Sbjct: 1405 ATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            PEI EVS N+AR++APY+TDWEG+  +EDAK PEKDP++LQR+DQ++L L+VNL+ YW S
Sbjct: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR L ++T+YEK+YN+L+ KLR +D+AVGA+Q+S+NLRNVF+VILAVGN+MNDTSKQAQ
Sbjct: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYPSFN FL+ELEPVL VVK+SIEQL N
Sbjct: 1585 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1644

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LP+LPEAR+K +LL DEV+L++M
Sbjct: 1645 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIM 1704

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EFE+LM+ +GE                  + EYKRAQ  N   +EEER YE+ K M++EQ
Sbjct: 1705 EFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQ 1764

Query: 1787 QRRAKLVQEGDE-TTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARK 1845
            Q+RA+  ++  E +     +    + D R VMDKLLE+LKNAGP+K DPSSARKRAL RK
Sbjct: 1765 QKRAQDKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALVRK 1824

Query: 1846 KLMGGREGSIIL-------EGLDVDDLQSAAPDV------QPDTPLXX------------ 1880
            K +  ++ S  +       EG  +   ++  PD       +  TPL              
Sbjct: 1825 KYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPEDLPS 1884

Query: 1881 ---XXXXXXXXXXXXXXXHLLLELRNGEHPESRKSMLDEH 1917
                               LL ELR  + P  + S+LDEH
Sbjct: 1885 PSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEH 1924

 Score =  474 bits (1220), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 291/722 (40%), Positives = 420/722 (58%), Gaps = 40/722 (5%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDI 355
            P HYV++I++D++T  E+ DLW++LRTE +DWV  FID QG +A+AN L+  + + +   
Sbjct: 341  PIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRE 400

Query: 356  LHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLL 415
                + LEKEN+++KC RVL+ L +G+ E    +L+  +V EGL S++L TR++ATE  +
Sbjct: 401  HLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFV 460

Query: 416  YMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVV 475
             ML           ++    +L ALD++ +   N+H+     +  +  S  T  +   ++
Sbjct: 461  CMLEK-------KNKNRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKII 513

Query: 476  AKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCSNHPD 533
                + WL+ +E TLDGRG+MGSLVGASD++K  GGEN +              CS   +
Sbjct: 514  ----QAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDN 569

Query: 534  VQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVD 593
            V QR LLR++L++ G+ RI+ K++LL Y  + +++  +++  LDD+N+ + ++     VD
Sbjct: 570  VNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVD 629

Query: 594  MKDPAALWQDFWTQHRGTEAEGHXXXXXXXX-XXWSRAFAEYRDPAESIKQLKLLDALVT 652
            +KDP +L ++ W   +GT+ E              S+   E ++P++  KQLKL+D+LVT
Sbjct: 630  LKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVT 689

Query: 653  NVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLS 711
            NV+ +S  D ES  N AIQRLYDAMQTDEVARRAILESR LTKK EEI+AERD+L+ KL 
Sbjct: 690  NVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLG 749

Query: 712  QAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTIL 771
            +A++GLVGQL++E+   +RIL K+ RV  Q                         MLTIL
Sbjct: 750  KAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTIL 809

Query: 772  NSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNR 831
            NS+P   +  S       PS L   +K  IQK LQD L + +KD   DSK+      PN+
Sbjct: 810  NSRPEESSDLSKGTKDINPS-LNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNK 868

Query: 832  RLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXXXIQRSL--------RGE 883
            RLKMLR +M+ IE EAR LEMTNFA+F                  ++          +G 
Sbjct: 869  RLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPKIKHKKHKIKKSSVKTQGA 928

Query: 884  QVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDF 943
             + +L  LR+ LA IQ ESN++SKFNVEERVNELF EKK+ AL RL++LE KYKGFGIDF
Sbjct: 929  DMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDF 988

Query: 944  N-----EDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRLNKLKK 998
            N     E P+  S+   N   D   P+        LDP    +K++E+ +I D L  L+ 
Sbjct: 989  NVEEFIETPKKFSVDEEN---DAAYPS--------LDPKAYQSKLDEINRITDELLDLQT 1037

Query: 999  DI 1000
             +
Sbjct: 1038 QV 1039

 Score = 70.1 bits (170), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 86/187 (45%), Gaps = 26/187 (13%)

Query: 59  KKVTLPSNLDLSGAKPLNKLNTINASNLPQ-VSGEV-TQARSASGAALXXXXXXXXXXXX 116
           +++  PS    + A+PLNK  T+N  NL Q ++G++ T A ++S  A             
Sbjct: 69  RRLNGPSRSTSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHA-------RSHSVQ 121

Query: 117 XQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKA 176
            +++ SK+ +    ++   QH      Q H   S L+                   L K 
Sbjct: 122 SKYSYSKRTSSQASNKLTRQHTG----QSHSATSLLS-------------LGSLTNLSKF 164

Query: 177 TDIDGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQ 236
           T  DG + LE P DP            KRNI QS+S     ELMSY  +KKWL+VKQDLQ
Sbjct: 165 TTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQ 224

Query: 237 TEYKKMK 243
            E KK++
Sbjct: 225 NELKKIR 231

 Score = 40.4 bits (93), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 13/75 (17%)

Query: 1086 ASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTI 1145
             SFL+ LSQKYGT                G +              N  KSF+NR++++ 
Sbjct: 1089 GSFLDALSQKYGTGQNVTASAGLRDNRGSGHM------------PSNVEKSFINRLRKS- 1135

Query: 1146 TPTSSNFLEELTQKV 1160
            T +S+ +LEELTQKV
Sbjct: 1136 TASSAPYLEELTQKV 1150

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/582 (58%), Positives = 423/582 (72%), Gaps = 31/582 (5%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE+YPRP KKLKQLHWEK+D  DNSIW   +AEKFADDLYEKGVL++LEKAFAAREIKS 
Sbjct: 1347 FEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1406

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              ++K++  KITFLSRDISQQFGINLHMYSSL V+ +V KIL CD+DFL T S +EFLSK
Sbjct: 1407 ATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSK 1466

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            PEI+EVS N+AR++APY+TDWEGV +++DAK PEKDP++LQR+DQ++L L+VNL+SYW S
Sbjct: 1467 PEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1526

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR L ++T+YEK+YN+L+ KLR +DKAVGA+Q+S+NLRNVF+VILAVGN+MNDTSKQAQ
Sbjct: 1527 RMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1586

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYPSFN FL+ELEPVL VVK+SIEQL N
Sbjct: 1587 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1646

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC +F  ++ NVERS+EIGNLSDSSKFHP D++L K LP+LPEARKK +LL DEV+L++M
Sbjct: 1647 DCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIM 1706

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EFE+LM  +GE                  I EYK+AQ  N   +EEER YE+ K +++EQ
Sbjct: 1707 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQ 1766

Query: 1787 QRRAKLVQE---GDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALA 1843
            Q+RA+  ++      ++ +  +    + D R VMDKLLE+LKNAGP K DPSSARKRAL 
Sbjct: 1767 QKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGPGKSDPSSARKRALV 1826

Query: 1844 RKKLMGGR-------------EGSIIL--EGLDVD-----DLQSAAP-------DVQPDT 1876
            RK+ +  +             EGSI+   E LD D       +S  P       ++  D 
Sbjct: 1827 RKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAESPTPLTTRGTLNIPEDL 1886

Query: 1877 PLXXXXXXXXXXXXXXXXXHLLL-ELRNGEHPESRKSMLDEH 1917
            P                   +LL ELR  + P  + S+LDEH
Sbjct: 1887 PSPSKASTLEDQEEISDRAKMLLKELRGSDTPVKQNSILDEH 1928

 Score =  473 bits (1216), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 296/716 (41%), Positives = 422/716 (58%), Gaps = 40/716 (5%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLL----KFVQRE 351
            P HYV++I++D++T  E+ DLW++LRTE +DWV  FID QG +A+AN L+    K   R+
Sbjct: 339  PIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRD 398

Query: 352  SLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVAT 411
            SL      + LEKEN+++KC RVL+ L +G+ E    +L+  +V EGL S+RL+TR++AT
Sbjct: 399  SLT----KELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTRLATRKMAT 454

Query: 412  ETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRAD 471
            E  + ML     K   +  +A+   L ALD++ +   N+H+     +  +  S  T  + 
Sbjct: 455  EIFVCMLE----KKNKSRFEAV---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 507

Query: 472  FHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCS 529
              ++    + WL+ +E TLDGRG+MGSLVGASD++K  GGEN +              CS
Sbjct: 508  LKII----QAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCS 563

Query: 530  NHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVD 589
               ++ QR LLR++L++ G+ RI+ K++LL Y  + +++  +++  LDD+N+ + +    
Sbjct: 564  CSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEANNKA 623

Query: 590  SAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXX-XXWSRAFAEYRDPAESIKQLKLLD 648
              VD++DP +L ++ W   +GTE E              S+   E ++P++  KQLK++D
Sbjct: 624  FNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNPSKLTKQLKVMD 683

Query: 649  ALVTNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLA 707
            +LVT+V+ +S  D ES  N AIQRLYDAMQTDEVARRAILESR LTKK EEI+AERD+L+
Sbjct: 684  SLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLS 743

Query: 708  SKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXM 767
             KLS+A++GLVGQL+ E+   +RIL K+ RV  Q                         M
Sbjct: 744  EKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKM 803

Query: 768  LTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVP 827
            LTILNS+P  EN    E      S L   +K  IQK LQD L + +KD   DSK+     
Sbjct: 804  LTILNSRPE-ENSSINEGIRGKNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTL 862

Query: 828  APNRRLKMLRSKMDIIEKEARLLEMTNFADFXX------XXXXXXXXXXXXXXXIQRSLR 881
             PN+RLKMLR +M+ IE EAR LEMTNFA+F                        +   R
Sbjct: 863  QPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLISR 922

Query: 882  GEQV--KELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGF 939
             ++V   +L  LR+ LA IQ ESN++SKFNVEERVNELF EKK+ AL RL++LE KYKGF
Sbjct: 923  PQEVDMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGF 982

Query: 940  GIDFNEDPELMSLRLANGSVDL--DGPTIDLESSAPLDPAHLDAKIEEMTKILDRL 993
            GIDFN + E+M     N + +   DG        + LDP     K++E+ +I D+L
Sbjct: 983  GIDFNVE-EIMESPKKNSANERKEDGANY-----SSLDPRTYQNKLDEINRITDQL 1032

 Score = 71.2 bits (173), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 106/253 (41%), Gaps = 54/253 (21%)

Query: 20  AGATHANG----GHSGGGLFSNLMKL---------TGSSGSQRIATSDISSP-------- 58
           +G+ H+N      +S  GLF NL +L         TGS  +  ++     SP        
Sbjct: 5   SGSKHSNSKESHSNSNSGLFQNLKRLANSNAANNNTGSPTN--VSPQQQHSPVEHEAATS 62

Query: 59  -------KKVTLPSNLDLSGAKPLNKLNTINASNLPQ-VSGEVTQARSASGAALXXXXXX 110
                  +K+  PS    + A+PLNK +T+N  NL Q ++G+++     S          
Sbjct: 63  PASSSSFRKLNGPSRSISTEARPLNKKSTLNTQNLSQYMNGKISADVPVSS------QHA 116

Query: 111 XXXXXXXQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXX 170
                  +++ SK+ +    ++   QH      Q H   S L++                
Sbjct: 117 RSHSMQSKYSYSKRNSSQASNKLTRQHTG----QSHSVSSLLSQ-------------GSL 159

Query: 171 XXLHKATDIDGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLM 230
             L K T  DG + LE P DP            KRNI QS+S      LMSY  +KKWL+
Sbjct: 160 TNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEALMSYSTEKKWLI 219

Query: 231 VKQDLQTEYKKMK 243
           VKQDLQ E KK++
Sbjct: 220 VKQDLQNELKKLR 232

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 20/80 (25%)

Query: 1086 ASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNH-----RKSFVNR 1140
             SFL+ LSQKYGT                  V+V  R S + ++   H      K+F+N+
Sbjct: 1085 GSFLDALSQKYGTG-------------QNNTVSVGLRDS-DYVSVIGHMPSKVEKTFMNK 1130

Query: 1141 MKRTITPTSSNFLEELTQKV 1160
            ++++ T +S+ +LEELTQKV
Sbjct: 1131 LRKS-TASSAPYLEELTQKV 1149

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/586 (58%), Positives = 422/586 (72%), Gaps = 39/586 (6%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE+YPRP KKLKQLHWEK+D  DNSIW   +AEKFADDLYEKGVL++LEKAFAAREIKS 
Sbjct: 1348 FEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1407

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              ++K++  KITFLSRDISQQFGINLHMYSSL V+ +V KIL CD+DFL T S +EFLSK
Sbjct: 1408 ASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSK 1467

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             EI+EVS N+AR++APY+TDWEGV ++EDAK PEKDP++LQR+DQ++L L+VNL+SYW S
Sbjct: 1468 SEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1527

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR L ++T+YE++YN+L+ KLR +DKAV A+Q+S+NLRNVF+VILAVGN+MNDTSKQAQ
Sbjct: 1528 RMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1587

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKD  NSMTFLNYVE+IV  NYPSFN FL ELEPVL VVK+SIEQL N
Sbjct: 1588 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVN 1647

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LP+LPEARKK +LL DEV+L++M
Sbjct: 1648 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIM 1707

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EFE+LM  +GE                  I EYK+AQ  N   +EEER Y + K +++EQ
Sbjct: 1708 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQ 1767

Query: 1787 QRRAKLVQEGDETTCARLSAISASGDDRD-------VMDKLLEKLKNAGPSKGDPSSARK 1839
            Q+RA+  ++  E +    ++ S+ G++ D       VMDKLLE+LKNAGP+K DPSSARK
Sbjct: 1768 QKRAQEKEKQKENS----NSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSDPSSARK 1823

Query: 1840 RALARKKLMGGR-------------EGSIIL--EGLD-----VDDLQSAAP-------DV 1872
            RAL RKK +  +             EGSI+   E +D     V   +S  P       + 
Sbjct: 1824 RALVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPTPLATRGVMNT 1883

Query: 1873 QPDTPLXXXXXXXXXXXXXXXXXHLLL-ELRNGEHPESRKSMLDEH 1917
              D P                   +LL ELR  + P  + S+LDEH
Sbjct: 1884 SEDLPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSILDEH 1929

 Score =  477 bits (1227), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 296/717 (41%), Positives = 427/717 (59%), Gaps = 42/717 (5%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLL----KFVQRE 351
            P HYV++I++D++T+ E+ DLW++LRTE +DWV  FID QG +A+AN L+    K   RE
Sbjct: 338  PIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRE 397

Query: 352  SLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVAT 411
            +L      + LEKEN+++KC RVL+ L +G+ E    +L+  +V EGL S++L+TR++AT
Sbjct: 398  NLT----KELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATRKMAT 453

Query: 412  ETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRAD 471
            E  + ML     K   +  +A+   L +LD++ +   N+H+     +  +  S  T  + 
Sbjct: 454  EIFVCMLE----KKNKSRFEAV---LTSLDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 506

Query: 472  FHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCS 529
              ++    + WL+ +E TLDGRG+MGSLVGASD++K  GGEN +              CS
Sbjct: 507  LKII----QAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCS 562

Query: 530  NHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVD 589
               ++ QR LLR++L++ G+ RI+ K++LL Y  + +++  +++  LDD+N+ + +    
Sbjct: 563  CSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEANNKA 622

Query: 590  SAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXX-XXWSRAFAEYRDPAESIKQLKLLD 648
              VD+ DP +L ++ W   +GTE E              S+   E ++ ++  KQLKL+D
Sbjct: 623  FNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMD 682

Query: 649  ALVTNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLA 707
            +LVTNV+ +S  D E+  N AIQRLYDAMQTDEVARRAILESR LTKK EEI+AERD+L+
Sbjct: 683  SLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLS 742

Query: 708  SKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXM 767
             KLS+A++GLVGQL+ E+ + +RIL K+ RV  Q                         M
Sbjct: 743  EKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKM 802

Query: 768  LTILNSKPH---GENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLN 824
            LTILNS+P     +N G+  +N+S    L   +K  IQK LQD L + +KD   DSK+  
Sbjct: 803  LTILNSRPEESFNKNEGTRGMNSS----LNSSEKANIQKVLQDGLSRAKKDYKDDSKKFG 858

Query: 825  TVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXX-----XXXXXXXXXXXIQRS 879
                PN+RLKMLR +M+ IE EAR LEMTNFA+F                       ++ 
Sbjct: 859  MTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKP 918

Query: 880  LRGEQ---VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKY 936
            L   Q   V +L  LR+ LA IQ ESN++SKFNVEERVNELF EKK+ AL RL++LE KY
Sbjct: 919  LVKPQEADVNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKY 978

Query: 937  KGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRL 993
            KGFGIDFN D  + S +   G V+    T +  + A LDP     K++E+ +I D+L
Sbjct: 979  KGFGIDFNVDEIMDSPKKNTGDVE----TEEDANYASLDPKTYQKKLDEINRITDQL 1031

 Score = 77.4 bits (189), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 98/233 (42%), Gaps = 45/233 (19%)

Query: 33  GLFSNLMKLTGS------SGSQRIATSDISSP---------------KKVTLPSNLDLSG 71
           G+F NL +L  S      +GS   A+    SP               +K+  PS    + 
Sbjct: 22  GIFQNLKRLANSNATNSNTGSPTYASQQQHSPVGNEVSTSPASSSSFRKLNAPSRSTSTE 81

Query: 72  AKPLNKLNTINASNLPQ-VSGEVTQARSASGAALXXXXXXXXXXXXXQWASSKQANHPEH 130
           A+PLNK +T+N  NL Q ++G++      SG                +++ SK+ +    
Sbjct: 82  ARPLNKKSTLNTQNLSQYMNGKL------SGDVPVSSQHARSHSMQSKYSYSKRNSSQAS 135

Query: 131 DQQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKATDIDGTLTLEKPED 190
           ++   QH      Q H   S L++                  L K T  DG + LE P D
Sbjct: 136 NKLTRQHTG----QSHSASSLLSQ-------------GSLTNLSKFTTPDGKIYLEMPSD 178

Query: 191 PXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMK 243
           P            KRNI QS+S      LM Y I+KKWL+VKQDLQ E KKM+
Sbjct: 179 PYEVEVLFEDIMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMR 231

 Score = 36.2 bits (82), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 22/81 (27%)

Query: 1086 ASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSG------NHRKSFVN 1139
             SFL+ LSQKYGT                  V       +N+  SG         K+F+N
Sbjct: 1088 GSFLDALSQKYGTGQN---------------VTASAAFGENNNGSGIGPLHSKVEKTFMN 1132

Query: 1140 RMKRTITPTSSNFLEELTQKV 1160
            R++++ T +S+ +LEELTQKV
Sbjct: 1133 RLRKS-TVSSAPYLEELTQKV 1152

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/565 (58%), Positives = 415/565 (73%), Gaps = 15/565 (2%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            F  YPR +KKLKQLHWEK+D  DNSIW + +AEKFA DLYEKGVL +LEKAFAAREIKS 
Sbjct: 1251 FSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSL 1310

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              +K+++ +KITFLSRD+SQQFGINLHMYS L V  +V+KILKC++DF+ T S +EFLSK
Sbjct: 1311 ATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSK 1370

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            PEI+EVSTN+AR+++PY+TDW+GVS VEDAKSPEKDP+ELQR+DQL+L LI NLQ YW S
Sbjct: 1371 PEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGS 1430

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR L++IT+YE++Y++L+ KLR +DKAV  IQKS NLRNVF+VILAVGNYMND++KQAQ
Sbjct: 1431 RMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQ 1490

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKD  NSMTFLNYVE+IV  NYPSFN FL++L+PVL VVKISIEQL +
Sbjct: 1491 GFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLIS 1550

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  ++TNVERS++IGNL+DSSKFHP D+VL KVLP+LPEA K+  LL +EV+LS+M
Sbjct: 1551 DCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEASKRVELLDEEVKLSIM 1610

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EFE+LM+ +GE                  I EYKRAQ  N K +EEER Y+  K M++EQ
Sbjct: 1611 EFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEEEERLYQTHKKMVEEQ 1670

Query: 1787 QRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARKK 1846
            Q+RA+  +  +  T     A   + D R +MDKLLE+LKNAGP K DP SARKRA+ RKK
Sbjct: 1671 QKRAEEKERSENATEE--DASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMIRKK 1728

Query: 1847 LMGGREG-SIILEGLDV-DDLQSAAPDVQ----------PDTPLXXXXXXXXXXXXXXXX 1894
            ++   E  S +L+ +   DD    +P+ Q            +P                 
Sbjct: 1729 MLNDSEAVSDVLDSIQQEDDSMIYSPEKQEGITNPTGDSSQSPSKGAANNQQDEEEITDR 1788

Query: 1895 XH-LLLELRNGEHPESRKSMLDEHK 1918
               LL+ LR GE P  R ++L+ HK
Sbjct: 1789 AKALLMGLRGGESPSKRNNVLNGHK 1813

 Score =  550 bits (1416), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 383/1035 (37%), Positives = 549/1035 (53%), Gaps = 92/1035 (8%)

Query: 17   GQVAGATHANGGHSGGGLFSNLMKLTGSSGSQ----RIATSDISSPKKVTLPSNL-DLSG 71
            G     + +   ++G GL SNL +  GSSGSQ    RI TSDISSP+KV++PS + + + 
Sbjct: 9    GSQGNGSDSRDSNTGSGLLSNLKRFAGSSGSQSGSQRIETSDISSPRKVSVPSRVSNAND 68

Query: 72   AKPLNKLNTINASNLPQVSGEVTQARSASGAALXXXXXXXXXXXXXQWASSKQANHPEHD 131
             +PLNK +T+N  NL       + A S S                 +  S + +    + 
Sbjct: 69   LRPLNKKSTMNTQNLSHYMNGKSSAESLSS-------------NHSRSPSVQSSTKYTYS 115

Query: 132  QQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKATDI--DGTLTLEKPE 189
            ++   HL+   V     +S LTR+                  + A  +  DG + L+ P 
Sbjct: 116  RRSSSHLSTPGV-----NSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPS 170

Query: 190  DPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKM------- 242
                          KRNI Q++S    +ELM Y +DKKWL+VKQDLQ ++KK+       
Sbjct: 171  S-HEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPA 229

Query: 243  -----------------KNSMPPSS-TVESIASSAL------AKXXXXXXXXXXXXXXXX 278
                             K S P SS T ESI  +                          
Sbjct: 230  AHAAISSSNSDSLPSSLKVSSPRSSMTYESIQQAIKFNKTNNGSSSGPASNNKSKLQQLS 289

Query: 279  XXXAKPMAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQV 338
               +    +  E  +  P HYV++II+D++T  E+NDLW++LRTE +DWV GF++ QG +
Sbjct: 290  DKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHI 349

Query: 339  AIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEG 398
            A+AN L   + +   +    YD LEKE+A+++C RVL+ L +G+ E  +  ++  +V  G
Sbjct: 350  AMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANG 409

Query: 399  LLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHE 458
            L S RL+TR++ATE  + ML     K      +A+   L ALD++ K   N+H+   +  
Sbjct: 410  LFSVRLATRKMATEIFVCMLE----KKNKVRFEAV---LNALDKKFKIGENLHMLHYMKN 462

Query: 459  TNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXX 516
            + +  S  T  + F +V    + WL+ +E +L+GRG+MGSLVGAS+D+K  GGEN +   
Sbjct: 463  SPQHFSHFTRDSQFKIV----QSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEY 518

Query: 517  XXXXXXXXXXXCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATL 576
                       C+    + QR LLR+RL++ G  RI+ + +LL Y  +   V  +E+  L
Sbjct: 519  SQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKL 578

Query: 577  DDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXX-XXWSRAFAEYR 635
            DD N ++ +    S +DM D A+L +  +   +GTE+E              SR   + +
Sbjct: 579  DDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQ 638

Query: 636  DPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKK 695
            DP +  KQL+L+D+LVTNV+ S++D  S  N AIQRLYD+MQTDEVARRAILESR LTKK
Sbjct: 639  DPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKK 698

Query: 696  YEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXX 755
             EE +AERD L+ KLS+  NGLVGQL+ EV+Q + ILEK+ RVT Q              
Sbjct: 699  LEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLL 758

Query: 756  XXXXXXXXXXXMLTILNSKPHGENGGSPEVNT-STPSPLKPEKKMAIQKALQDRLRQTEK 814
                       MLTILNS+P G+      V++ + P  L P+KK  IQ+ALQD L +T+K
Sbjct: 759  EKHEHEVELRKMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKK 818

Query: 815  DLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXX-XXXXXXXX 873
            DL+ DSKR      PN+RLKMLR +M+ IE+EAR LEMTNFAD                 
Sbjct: 819  DLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNY 878

Query: 874  XXIQRSLRGEQVK--ELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRD 931
               +  LR +++K  +L+ LRK LA IQ+ESN VSKFNVEERVNELF +KK  ALDRL D
Sbjct: 879  VRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLND 938

Query: 932  LENKYKGFGIDFN------EDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEE 985
            LEN YK +GID +      ++P+      A    + +GP+        LDP    AK++E
Sbjct: 939  LENMYKEYGIDLSTHFPIQDEPQ----ESAESEKNAEGPST-------LDPRAYQAKLDE 987

Query: 986  MTKILDRLNKLKKDI 1000
            + +I   L ++K ++
Sbjct: 988  IDRISKELIEMKSEL 1002

 Score = 33.9 bits (76), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 17/76 (22%)

Query: 1086 ASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKR-T 1144
            +SFLE+LSQKYGT                 ++N   R        G+ R+SF+ RMK+ +
Sbjct: 1041 SSFLESLSQKYGTGKNATNMLT------NDILNSSER-------KGHSRQSFMERMKKPS 1087

Query: 1145 ITPTSSNFLEELTQKV 1160
              P    +LEEL  KV
Sbjct: 1088 GVPA---YLEELPLKV 1100

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/507 (63%), Positives = 395/507 (77%), Gaps = 16/507 (3%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE YPRP KKLKQLHWEK++  DNSIW   +AE+FADDLYEKGVLSELE AFAAREIKS 
Sbjct: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              ++K +  KITFLS D+SQQFGINLHMY+SL V  +++KILKCD+DFL T S IEFLS+
Sbjct: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
            PEIV+VS N+AR++APY  DWEG+ +VEDAK PEK+P+ELQR+DQ++L L+VNLQSYW S
Sbjct: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR LK+ITT+EK+YN+L+ KLR +D+AV ++Q+SENL+NVF VILAVGNYMNDTSKQAQ
Sbjct: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKL+TLQRLTFIKD  N+MTFLNYVE+IV  NYP+FN FL ELEPVL VVKISIEQL +
Sbjct: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  ++ NVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ARKK  LL DEV+L++M
Sbjct: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF  LM+++GE                  I EYK+AQ  N +++EEE+ YER K M++EQ
Sbjct: 1706 EFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765

Query: 1787 QRRAKLVQEGDETTCARLSAIS--------ASGDDRDVMDKLLEKLKNAGPS-KGDPSSA 1837
            QR+A+      E   +R+++ +          GD R +MD LLE+LKN  P+ K DPSSA
Sbjct: 1766 QRKAQ------EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSA 1819

Query: 1838 RKRALARKKLMGGREGSIILEGLDVDD 1864
            RKRAL RKKLM G   S IL+ +D +D
Sbjct: 1820 RKRALVRKKLM-GESTSNILKDIDTED 1845

 Score =  463 bits (1192), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 278/707 (39%), Positives = 405/707 (57%), Gaps = 26/707 (3%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDI 355
            P  YV+KIISD +T++E+ DLW++LRTE +DWV  FI+ QG +A+AN L+K + + + + 
Sbjct: 338  PIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNE 397

Query: 356  LHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLL 415
                  LEKEN+++KC RVL+ L +G++E  K +L+  ++  GL S+ LSTR++ATE  +
Sbjct: 398  KLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFV 457

Query: 416  YMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVV 475
             ML+           +    +L  LDQ+ K   N+H+   L +  +     T  ++  V 
Sbjct: 458  CMLNK-------KNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVT 510

Query: 476  AKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCSNHPD 533
                  WL+ +E++LDGRG+MGS VGASDDYK  GGEN                C    +
Sbjct: 511  ----RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDN 566

Query: 534  VQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVD 593
            + QR LLR++L+  G+ RI+ +++ L Y  +  ++  +E++ LDD N L+  +  ++ ++
Sbjct: 567  INQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANIN 626

Query: 594  MKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWSRAFAEYRDPAESI-KQLKLLDALVT 652
            + DP +L ++ W   +GTE E             S    E +  A  + KQLKL+D+LVT
Sbjct: 627  LHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVT 686

Query: 653  NVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQ 712
            NV+ +S D ES  N AIQRLYDAMQTDEVARR+ILESR LTKK EE +AE D L+ KL  
Sbjct: 687  NVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKN 746

Query: 713  AQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILN 772
            A++GLVGQLQ E+ Q +R+  K+ R+T+Q                         MLTILN
Sbjct: 747  AEHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILN 806

Query: 773  SKP-HGE-NGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPN 830
            ++   GE    S + +   P   +  KK  IQK LQ+ L +T+KD T DSK       PN
Sbjct: 807  ARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPN 866

Query: 831  RRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXX----XXXXXXXXXXXIQRSLRGEQVK 886
            +RLK LR +M+ IE EAR LEMTNFA+F                      ++    +++K
Sbjct: 867  KRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQKKQNKNEKKEEDDKIK 926

Query: 887  ELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNED 946
            +L  LR+ LA IQ ESN++SKFNVEERVNELF EK++ AL RL++LE KYK FGI+FN D
Sbjct: 927  KLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNID 986

Query: 947  PELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRL 993
                   ++  +  +D         + LDP     K++E+ +I ++L
Sbjct: 987  D------ISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQL 1027

 Score = 74.3 bits (181), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 96/242 (39%), Gaps = 33/242 (13%)

Query: 14  QHAGQVAGATHANGGHSGGGLFSNLMKL----TGSSGSQRIATSDISSPKKV---TLP-- 64
           +H       T  N   SG  LF NL +     TGSS +    TS+ S P +V   ++P  
Sbjct: 8   KHNANQEQGTKNNATTSGSNLFQNLKRFATNSTGSSNNTSPRTSNSSEPSQVKRESIPQG 67

Query: 65  --SNLDLSG-AKPLNKLNTINASNLPQVSGEVTQARSASGAALXXXXXXXXXXXXXQWAS 121
             S+L  S   KPL K  T+N  NL Q          +   ++                +
Sbjct: 68  STSSLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQT 127

Query: 122 SKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKATDIDG 181
           +      + D+QY    + + V     +S L++ M                       DG
Sbjct: 128 NPSVTGYKLDRQYTNQSSAVSVLSQGSYSNLSKFMTH---------------------DG 166

Query: 182 TLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKK 241
            L LE P DP            KRNI QS+      ELMSY I KKWL+VKQDLQ E+KK
Sbjct: 167 KLNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKK 226

Query: 242 MK 243
            K
Sbjct: 227 FK 228

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/540 (60%), Positives = 407/540 (75%), Gaps = 8/540 (1%)

Query: 1346 LGRSKTY-GGXXXXXXXXXXXXFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADD 1404
            +G +K Y  G            + +YPRP+KKLKQLHW+K+DD + SIW +A AE+FADD
Sbjct: 1238 MGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADD 1297

Query: 1405 LYEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVV 1464
            LYEKGVL  LEKAFAAREIKS   +KK++ +KI+FLSRDISQQFGINLHM+ SL V  +V
Sbjct: 1298 LYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELV 1357

Query: 1465 SKILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPS 1524
             KILKC++D ++T S IEFLSKPEI +VS N+AR++APY TDWEGV  VEDAK+PEK   
Sbjct: 1358 IKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVD 1417

Query: 1525 ELQRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENL 1584
             LQR+DQ+++ L+VNLQSYW SRMR +K+IT+YEK+Y +L+ KLR +D AV AIQKS+NL
Sbjct: 1418 GLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNL 1477

Query: 1585 RNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFN 1644
             N+F+VILAVGNYMND+SKQAQGFKL+TLQRLTFIKD  NSMTFLNYVE+I+ +NYP FN
Sbjct: 1478 TNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFN 1537

Query: 1645 SFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVL 1704
             F++ELEPVL VVKIS+EQL NDCNEF  ++ NVERSLEIGNLSDSSKFHP D+V+ KVL
Sbjct: 1538 GFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVL 1597

Query: 1705 PILPEARKKANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQE 1764
            P+LPEA KK++LL DEV+L+ MEFE LM+ FGE                  I EYK+A+ 
Sbjct: 1598 PVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARA 1657

Query: 1765 FNRKIDEEERAYERRKLMIQEQQRRAKLVQEGD--ETTCARLSAISASGDDRDVMDKLLE 1822
             N K +EE R YER K M++EQQR+AK  QE +  ET  +   +  A GD+R  MDKLL 
Sbjct: 1658 QNLKAEEEVRKYERHKQMVEEQQRKAK-EQEKNYMETGVSDSESAEAKGDNRGHMDKLLA 1716

Query: 1823 KLKNAGPSKGDPSSARKRALARKKLMGGREG-SIILEGLDVDD---LQSAAPDVQPDTPL 1878
            +LKNAGP++ DPSSARKRA+ RKKL+  ++  S+IL+ L+  D   + S   D   DT L
Sbjct: 1717 QLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSL 1776

 Score =  493 bits (1269), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 342/1032 (33%), Positives = 527/1032 (51%), Gaps = 102/1032 (9%)

Query: 31   GGGLFSNLMKLTGSSGS----QRIATSDISSPKKVTLPSNLDLSGAKPLNKLNTINASNL 86
            G GL  NL KLT SS +      I  SDISSPK   L + L +   KPLNK  ++N  NL
Sbjct: 23   GSGLLHNLKKLTNSSSTTSQNNAINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNL 82

Query: 87   PQ-VSGEVTQARS-ASGAALXXXXXXXXXXXXXQWASSKQANHPEHDQQYPQHLNHLFVQ 144
             Q ++G++ +++S +S                 Q  SS   N     Q   ++       
Sbjct: 83   SQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQSSAKYSYSRRSS 142

Query: 145  PHPHHSALTRQMXXXXXXXXX--XXXXXXXLHKATDIDGTLTLEKPEDPXXXXXXXXXXX 202
                 + L+RQ                   L K  D +G L L+ P D            
Sbjct: 143  NSTAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELM 202

Query: 203  XKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMK---------------NSMP 247
             KRNI Q++S    R++M+Y   KKW++VKQDLQ E K++K               +SMP
Sbjct: 203  YKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKLKNNNINNSDTTIIPSSMP 262

Query: 248  PSS---------------TVESIASSALAKXXXXXXXXXXXXXXXXXXXA--------KP 284
             S+               T+++ AS+                                + 
Sbjct: 263  SSNISERSSVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRS 322

Query: 285  MAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRL 344
            ++ + +  +++P HYVRKI+SD ++  ELNDLW++LRTE +DWV  F++ QG +AIAN L
Sbjct: 323  ISESSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNL 382

Query: 345  LKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRL 404
            ++ + + +       + +EKE  ++KC RVL  L +G+ E  K KL++ ++  GL S+R+
Sbjct: 383  IRCIYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRV 442

Query: 405  STRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKS 464
            STR++A E L+Y+++    +  ++       ++++LD+  + + N+++   + +     S
Sbjct: 443  STRKMALEILVYIINKKNTQRFES-------VIMSLDRFFRLSENLNMLKIITQFGGAFS 495

Query: 465  LPTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXX 522
              +    F +     + ++  +E TL+GRG+MGS VGASDD+K  GGEN +         
Sbjct: 496  RTSPDTQFKI----FQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALI 551

Query: 523  XXXXXCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLL 582
                 C+   ++ QR +LR++ ++ G  R++ K++L+ Y  +  +V  +ED  LDD+N L
Sbjct: 552  FINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSL 611

Query: 583  MTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXX-XXWSRAFAEYRDPAESI 641
            +   +  + ++M+DP +L    W   +GTE E              S+   + R+PA+  
Sbjct: 612  LEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLS 671

Query: 642  KQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKA 701
            KQLKL+D+L+TN+T S +D ++  N AIQRLYD+MQTD+VARRAILE+R L+KK EE+ A
Sbjct: 672  KQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTA 731

Query: 702  ERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXX 761
            E++ L  KLS+A+NGLVGQL+ E+EQ + IL KS RVT Q                    
Sbjct: 732  EKEYLKEKLSKAENGLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHE 791

Query: 762  XXXXXMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSK 821
                 +LTI+N+    +      +N S+      +KK  IQKAL+  L +T+KDL  D K
Sbjct: 792  VELRKILTIVNTNTDAD----ASLNNSS------DKKHNIQKALETELSRTKKDLNNDVK 841

Query: 822  RLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXXXIQRSL- 880
            +      PN+RL+MLR +M+ IEKEAR LEMTNF++                   ++   
Sbjct: 842  KFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSK 901

Query: 881  ---------------RGEQVK--ELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKN 923
                           R   +K  +L  LR+ LA+IQ E+N+VSKFNV++RVNELF EKK+
Sbjct: 902  KKSKSSKSKEENNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKH 961

Query: 924  KALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESS-APLDPAHLDAK 982
            +AL+RL+ LE KYK F IDF  DP            D     +D  +S   LDP  +  K
Sbjct: 962  EALNRLQMLEKKYKSFEIDF--DPN-----------DFKQAQLDSNASYESLDPNFVTKK 1008

Query: 983  IEEMTKILDRLN 994
            I ++ +I D L+
Sbjct: 1009 ITDIDRIADELD 1020

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 15/81 (18%)

Query: 1080 EAIISNASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSFVN 1139
            + +I  +SFLE+LS+KYGT            ++  G  ++   + QN I S    KSF+N
Sbjct: 1055 KGLIDGSSFLESLSEKYGT-----------AQNTEG-TSLSPLSPQNRIASLGE-KSFMN 1101

Query: 1140 RMKRTITPTSSNFLEELTQKV 1160
            R KR   P+S  FLEEL+QKV
Sbjct: 1102 RFKR--KPSSMQFLEELSQKV 1120

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 390/486 (80%), Gaps = 7/486 (1%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE YPRP+KKLKQLHWEK++  DNSIW + +AEKFADDLYEKGVLSELEKAFAAREIKS 
Sbjct: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              RKK++  KI+FLS DISQQFGINLHMYS+L V+  V K+LKC++DF++T S IEFLSK
Sbjct: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             EIVEVSTN+AR++APY+TDWEG+  +EDAK+PEKDP+ELQR+DQ++L L+VNLQSYW+S
Sbjct: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR +++IT+YE++YN+L+ KL  +DKAVG++Q S+NL+N+F+VILAVGN+MND++KQA+
Sbjct: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKD  NSMTFLNYVE+IV  NYP FN+FL ELEPVL+VVK+SIEQL N
Sbjct: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DCN+F   + NVERS+EIGNLSDSSKFHP D+VL KVLP L EARKK  LLADE++L++M
Sbjct: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EFE +M+ +GE                  I EYK+AQ  N K++EEE AYER K M++EQ
Sbjct: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674

Query: 1787 QRRA-----KLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRA 1841
            QR+A     KL +   +T          S D R VMDKLLE+LKNAG  K DP+SARKRA
Sbjct: 1675 QRKAQEDASKLNENSSQT--GNSDEEEESEDRRAVMDKLLEQLKNAGQVKTDPTSARKRA 1732

Query: 1842 LARKKL 1847
            L RKK+
Sbjct: 1733 LLRKKI 1738

 Score =  499 bits (1285), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 348/1034 (33%), Positives = 528/1034 (51%), Gaps = 109/1034 (10%)

Query: 34   LFSNLMKLTGSSGSQRIATSDISSPKKVTLPS---------NLDLSGA-----------K 73
            LF NL +LT      R       SPK+ +L +         N+++S A           +
Sbjct: 21   LFQNLRRLTTKDRDNRN-----KSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSR 75

Query: 74   PLNKLNTINASNLPQVSGEVTQARSASGAALXXXXXXXXXXXXXQWASSKQANHPEHDQQ 133
            PLNK +T+N+ NL Q    V   ++ S  +              +++ S++++       
Sbjct: 76   PLNKKSTLNSQNLSQY---VNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSG--QVSM 130

Query: 134  YPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKATDIDGTLTLEKPEDPXX 193
             P  + ++ +  H  +++ +                   L +    DG + L  P DP  
Sbjct: 131  APSSMGNINLTRHNTNTSFS-------SASVLSHGSITNLSRFMTPDGKINLTMPSDPYE 183

Query: 194  XXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKNS-------- 245
                      KRNI QS+      ELMSY I+KKWL+VKQDLQ E+K++K S        
Sbjct: 184  VESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTG 243

Query: 246  --MP-----PSST------------------VESIASSALAKXXXXX-------XXXXXX 273
              MP     PS++                  V S A S  ++                  
Sbjct: 244  MSMPDLGSDPSNSVSPPGPISSSGSSIFSSDVTSTAPSTYSRSGKKNIPISKPIAATSTE 303

Query: 274  XXXXXXXXAKPMAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFID 333
                         +  + A+  P HYV+KI+ D+++  E+ DLW++LRTE +DWV  F++
Sbjct: 304  LYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLE 363

Query: 334  AQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVIS 393
             QG +A+AN L+K + + +         L+KENA++KC RVL  L +G+ E     L+  
Sbjct: 364  NQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTD 423

Query: 394  SVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLR 453
            ++ +GL S RL+TR++ATE  +++L     K  ++       +L +LD+      N H+ 
Sbjct: 424  TIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFES-------VLSSLDKNFIIGQNSHMN 476

Query: 454  GRLHETNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGEN 511
                +  +  +  T  ++  V+    + WL+ +E TLDGRG+MGSLVGAS+DYK  GGEN
Sbjct: 477  ESYKKLPQYFTHLTSNSNLKVI----QAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGEN 532

Query: 512  TVXXXXXXXXXXXXXXCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKF 571
             +              CS+  ++ QR LLR +L++ G+ RI+ K++LL Y  + +++  +
Sbjct: 533  AILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELY 592

Query: 572  EDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXX-WSRA 630
            E+  LDD+N L+ S   +  VD++DP +L ++     +GTE E              S+ 
Sbjct: 593  ENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKL 652

Query: 631  FAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESR 690
              E +DP +  KQLKL+D+LVTNV+ +S +  S  N AIQRLYD+MQTDEVARRAILESR
Sbjct: 653  LDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESR 712

Query: 691  ELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXX 750
             LTKK EE++AERD L  KLS+A++GLVGQL+ EV++ +RIL K+ RV  Q         
Sbjct: 713  TLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELK 772

Query: 751  XXXXXXXXXXXXXXXXMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLR 810
                            MLTILNS+P        ++ +     ++  +K  +Q+ALQ  L+
Sbjct: 773  KKHLLEKHEQEVELRKMLTILNSRPAKTKEQKKKIGS-----IEASEKEDLQRALQSGLQ 827

Query: 811  QTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXX 870
            + +KD   DSK+      PN+RLK+LR +M+ IE EAR LEMTNFA++            
Sbjct: 828  KAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQ 887

Query: 871  XXXXXIQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLR 930
                 I    + +++++L  LR +L  IQ ESN+VSKFNV+ERVNELF +KK  AL RL+
Sbjct: 888  KKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLK 947

Query: 931  DLENKYKGFGIDFN-EDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKI 989
            +LE KYKGFGIDF  ED         + S D        E  + LDP     K++E+TKI
Sbjct: 948  ELETKYKGFGIDFKVED-------FTHESTDSSN-----EGYSSLDPKVYQDKLDEITKI 995

Query: 990  LDRLNKLKKDIDMS 1003
             + L + K +++ +
Sbjct: 996  SEELLQQKNELETT 1009

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/499 (62%), Positives = 391/499 (78%), Gaps = 19/499 (3%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE+YPRP KKLKQLHWEK+D  DNSIW + +AEKFADDLYEKGVL++LEKAFAAREIKS 
Sbjct: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              ++K++  KITFLSRDISQQFGINLHMYSSL V  +V K+L CD+DFL T S +EFLSK
Sbjct: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             EI+EVS N+AR++APY+TDWEGV +++DAK PEKDP++LQR+DQ++L L++NL+SYW S
Sbjct: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR L ++T+YE++YN+L+ KLR +DKAVGA+Q S+NLRNVF+VILAVGN+MNDTSKQAQ
Sbjct: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYP+FN FL+ELEPVL VVK+SIEQL N
Sbjct: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LP+LPEAR+K +LL DEV+L++M
Sbjct: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMI--- 1783
            EFE+LM+ +GE                  I EYK+AQ  N   +EEER YE+ K ++   
Sbjct: 1701 EFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQ 1760

Query: 1784 --------QEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPS 1835
                    ++++R A    EG+E   A         D RDVMDKLLE+LKNAGP+K DPS
Sbjct: 1761 QKKAQEKEKQKERSASPSPEGNEEDEAE--------DRRDVMDKLLEQLKNAGPAKTDPS 1812

Query: 1836 SARKRALARKKLMGGREGS 1854
            SARKRAL RKK +  ++ +
Sbjct: 1813 SARKRALVRKKYLSDKDSA 1831

 Score =  461 bits (1187), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 293/719 (40%), Positives = 423/719 (58%), Gaps = 46/719 (6%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLL----KFVQRE 351
            P HYV++I++D++T  E+ DLW++LRTE +DWV  FI+ QG +A+AN L+    K   R+
Sbjct: 337  PIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRD 396

Query: 352  SLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVAT 411
            +L      + LEKEN+++KC RVL+ L +G+ E    +L+  +V EGL S++L+T+++AT
Sbjct: 397  NLT----KELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKMAT 452

Query: 412  ETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRAD 471
            E  + ML     K   +  +A+   L ALD++ +   N+H+     +  +  S  T  + 
Sbjct: 453  EIFVCMLE----KKNKSRFEAV---LTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESH 505

Query: 472  FHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCS 529
              ++    + WL+ +E TLDGRG+MGSLVGASDD+K  GGEN +              CS
Sbjct: 506  LKII----QAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCS 561

Query: 530  NHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVD 589
               ++ QR LLR++L++ G+ RI+ K++LL Y  + +++  +++  LDD+N+ + +    
Sbjct: 562  CSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEA 621

Query: 590  SAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXX-XXWSRAFAEYRDPAESIKQLKLLD 648
              VD++DP +L ++ W   +GTE E              S+   E ++ ++  KQLKL+D
Sbjct: 622  FNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMD 681

Query: 649  ALVTNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLA 707
            +LVTNV+ +S  D ES  N AIQRLYDAMQTDEVARRAILESR LTKK EEI+AERD+L+
Sbjct: 682  SLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLS 741

Query: 708  SKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXM 767
             KLS+A++GLVGQL+ E+ + + IL K+ RV  Q                         M
Sbjct: 742  EKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKM 801

Query: 768  LTILNSKPHGENGGSPEVNTST----PSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRL 823
            LTILNS+P      S ++N  T    PS L   +K  IQK LQD L + +KD   DSK+ 
Sbjct: 802  LTILNSRPE----ESSDINEGTRNIDPS-LNFSEKANIQKVLQDGLSRAKKDYKDDSKKF 856

Query: 824  NTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXX---------XXXXXXXXXXXXX 874
                 PN+RLKMLR +M+ IE EAR LEMTNFA+F                         
Sbjct: 857  GMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKN 916

Query: 875  XIQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLEN 934
             + R+   +  K L  LR+ LA IQ ESN +SKFNVEERVNELF EKK+ AL RL++LE 
Sbjct: 917  FLARAQEADMNK-LNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELET 975

Query: 935  KYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRL 993
            KYKGFGIDFN +  + S +  + + + +G   D   S+ LDP     K++E+ +I D L
Sbjct: 976  KYKGFGIDFNVEKIMESPKKLSVADEREG---DARYSS-LDPKAYQKKLDEINRITDEL 1030

 Score = 67.8 bits (164), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 98/241 (40%), Gaps = 61/241 (25%)

Query: 33  GLFSNLMKLTGSSGSQRIATSDIS------SP---------------KKVTLPSNLDLSG 71
           GL  NL +L  S+G+   A S  +      SP               + +  PS      
Sbjct: 21  GLLQNLKRLANSNGTSANAASPTNATQQQHSPMGQESSTSPSSSSSFRNLNGPSRTTSIE 80

Query: 72  AKPLNKLNTINASNLPQ-VSGEVT--------QARSASGAALXXXXXXXXXXXXXQWASS 122
           A+PLNK +T+N  NL Q +SG+++         ARS S                 +++ S
Sbjct: 81  ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHS--------------VQSKYSYS 126

Query: 123 KQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXXXLHKATDIDGT 182
           K+ +    ++   QH      Q H   S L++                  L K T  DG 
Sbjct: 127 KRNSSQASNKLTRQHTG----QSHSASSLLSQ-------------GSLTNLSKFTTPDGK 169

Query: 183 LTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKM 242
           + LE P DP            KRNI QS+S      LM Y  +KKWL+VKQDLQ E KKM
Sbjct: 170 IHLEMPSDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKM 229

Query: 243 K 243
           +
Sbjct: 230 R 230

 Score = 38.1 bits (87), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 12/76 (15%)

Query: 1086 ASFLETLSQKYGTXXXXXXXXXXXXE-HMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRT 1144
             SFL+ LSQKYGT              ++ G+ +   +            K+F+NR+KR+
Sbjct: 1087 GSFLDALSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKV----------EKTFMNRLKRS 1136

Query: 1145 ITPTSSNFLEELTQKV 1160
             T  S+ +LEELTQKV
Sbjct: 1137 -TVNSAPYLEELTQKV 1151

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/506 (63%), Positives = 404/506 (79%), Gaps = 9/506 (1%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE+YPRP+KKLKQLHWEK+D  +NSIW  ++AEKFADDLYEKGVLS LEKAFAARE+KS 
Sbjct: 1373 FEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSL 1432

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              +K D++ KITFL+RD+SQQFGINLHM+ +L V  +V+KILKCD++ L++ S IEFLSK
Sbjct: 1433 SSKKGDDS-KITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSK 1491

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             E+VEVS N+AR+++PY+TDWEGV  +EDAK+PEKDP+ELQR+DQL+++L+VNLQ YWSS
Sbjct: 1492 QEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSS 1551

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RMR LK+ITTYE++Y +L+ KLR +DKAVG++Q+SENL+NV +VILAVGNYMNDTSKQAQ
Sbjct: 1552 RMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQ 1611

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKL+TLQRLTFIKD  NSMTFLNYVE+IV +NYP+FN FL EL+PVL VVKISI+QL +
Sbjct: 1612 GFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVS 1671

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF  +V NVERS+EIGNLSDSSKFHP DRVL KVLP+LPEARKKA+LL DEV+L+++
Sbjct: 1672 DCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTML 1731

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF NLM+ +GE                  I EYK+AQ  N   +EEE+ YER K +++EQ
Sbjct: 1732 EFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQ 1791

Query: 1787 QRRAKLVQE------GDETTCARLSAI-SASGDDRDVMDKLLEKLKNAGPSKGDPSSARK 1839
            QR+ +  ++       D T     +A+   + D R +MDKLLE+LKNAG  K DPSSARK
Sbjct: 1792 QRQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSSARK 1851

Query: 1840 RALARKKLMGGRE-GSIILEGLDVDD 1864
            RALAR+KL+G ++  S +L  +D DD
Sbjct: 1852 RALARRKLLGDKDAASALLHDIDTDD 1877

 Score =  466 bits (1198), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 285/731 (38%), Positives = 418/731 (57%), Gaps = 53/731 (7%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDI 355
            P HYV+KII+D+++  ELNDLW++LRTE +DWV  F+D QG +A+AN L+K + + S ++
Sbjct: 418  PIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLMKSLYKTSPNV 477

Query: 356  LHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLL 415
                  L+KE +Y+KC +VL+ L +G++E    +L+  ++  GL SSRL TR++ATE  +
Sbjct: 478  SLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRLPTRKMATEIFV 537

Query: 416  YMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTG--RADFH 473
             ML   E K   T  DA+   + +LDQ  +  +N H+       N  + +P      +  
Sbjct: 538  CML---ETKN-QTRFDAV---ITSLDQNFQIGSNAHM------VNNLQKMPDYFIHLNLQ 584

Query: 474  VVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXXXXXCSNH 531
               K ++ WL+ I+ TLDGRG+MGSLVGASD++K   GEN+V              C + 
Sbjct: 585  STLKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSS 644

Query: 532  PDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSA 591
             ++ QR LLR++L++ G  RI+ KM+LL Y  + +++  +E   LDD+N L+ S    + 
Sbjct: 645  NNLNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHAN 704

Query: 592  VDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWS-RAFAEYRDPAESIKQLKLLDAL 650
            +DM++P +L Q+ W   RGT++E             S R     +DP +  KQLKL+D+L
Sbjct: 705  IDMQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSL 764

Query: 651  VTNV--TFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLA 707
            VTNV  + S++ D E+  +  IQRL+D+MQTDEVARRAI+ESR LTKK EE++AE+D L 
Sbjct: 765  VTNVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLG 824

Query: 708  SKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXM 767
             KLS+A+ GLVG+LQ ++ + + IL K+ RV  Q                         M
Sbjct: 825  DKLSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKM 884

Query: 768  LTILNSK--PH-GENGGSPEVNTSTPS---PLKPEKKMAIQKALQDRLRQTEKDLTRDSK 821
            LTI+NSK  P+  +N  +  + +  P     L  E++  IQK LQD L +T+KD T D+K
Sbjct: 885  LTIINSKASPNLAQNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAK 944

Query: 822  RLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXX----------------XX 865
            +      PN+RL++LR K++ IE EAR LEMTNFAD                        
Sbjct: 945  KFGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKNATPVILTKGTKKKKSKKKLK 1004

Query: 866  XXXXXXXXXXIQRSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKA 925
                       QR+   ++++ L  LR  L  IQ ESN++SKFNVEE VNELF E+K KA
Sbjct: 1005 TAQPDKKQRANQRN-ENQKIEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKA 1063

Query: 926  LDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEE 985
            L RLRDLE+K+ G   +FN D  + S   A  + D DG +        LDP   D K++E
Sbjct: 1064 LQRLRDLESKFNGLNTNFNIDDIIASTEKALTATD-DGYS--------LDPRRADNKLDE 1114

Query: 986  MTKILDRLNKL 996
            + ++ + L+KL
Sbjct: 1115 IERLTNDLSKL 1125

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%)

Query: 180 DGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEY 239
           DG L LE P+DP            KRNI Q++      ELM+Y + KKWL+VKQDLQ E 
Sbjct: 247 DGKLRLEMPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNER 306

Query: 240 KKMK 243
           KK+K
Sbjct: 307 KKLK 310

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/489 (65%), Positives = 385/489 (78%), Gaps = 3/489 (0%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426
            FE+YPR +KKLKQLHWEK+DD DNSIW N +AE+FADDL+EKGVL  LE AFAAREIKS 
Sbjct: 1436 FEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSL 1495

Query: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
              +KK+++ KIT+LSRDISQQFGINLHM+S+L V  ++ KI++CD+  L+T S I+FLSK
Sbjct: 1496 ASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSK 1555

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             EIVEVS N+ARS+APY+TDWEGV  V+DAK PEKDP+ELQR+DQ++L L+VNLQSYW S
Sbjct: 1556 QEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQLMVNLQSYWGS 1615

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            RM  LK++T+YEKD+++LI KLR +D AVG+IQKSENL+NVF+VILAVGN+MND SKQAQ
Sbjct: 1616 RMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQ 1675

Query: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
            GFKL+TLQRLTFIKD  N+MTFLNYVE I+ QNYP FN FL EL+PVL VVK+SIEQL  
Sbjct: 1676 GFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVR 1735

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            DC EF   + NV RS+EIG LSDSSKFHP D+VL KVLP+LPEA KKA+LL+DEV+LS+M
Sbjct: 1736 DCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIM 1795

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EFENLM++FGE                  I EYKRAQE N K++EEER YE  K  I+EQ
Sbjct: 1796 EFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQ 1855

Query: 1787 QRR---AKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALA 1843
            Q+R   +K     D+T+    +      D RDVMDKLLE+LKN GP K DP+SARKRA+ 
Sbjct: 1856 QKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKTDPTSARKRAMV 1915

Query: 1844 RKKLMGGRE 1852
            RKKL   +E
Sbjct: 1916 RKKLQNEKE 1924

 Score =  449 bits (1154), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 285/756 (37%), Positives = 427/756 (56%), Gaps = 62/756 (8%)

Query: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESL-- 353
            P+ Y+++I++DR++  E+NDLW++LRTE + WV  F++ QG +A+AN L+K + R +   
Sbjct: 422  PNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQ 481

Query: 354  DILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATET 413
            + L  Y  ++KE  ++KC RVL+ L +G+ E +K KL+  ++V+GL S+RL+TR++ATE 
Sbjct: 482  NSLSTY-LIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQGLFSTRLATRKIATEI 540

Query: 414  LLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFH 473
             + ML     K  D G +    LL   D+      N+++   L      K++P     +H
Sbjct: 541  FVLMLQ----KINDDGLNI---LLTTFDKTFSINENLNMVYLL------KNVPDK---YH 584

Query: 474  VV-------AKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXXXXXXXX 524
             +        K L  WLY +E TLDGRG+MGSLVGAS D+K  GGEN +           
Sbjct: 585  YLNSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLI 644

Query: 525  XXXCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMT 584
               C+    + QR LLR++L++ G  RI+ K++ L Y  +  ++  +E+  LDD N L+ 
Sbjct: 645  NRLCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLE 704

Query: 585  STTVDSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXX-XWSRAFAEYRDPAESIKQ 643
              T  S+VD+ +P +L        + TE E              S+ F +  DP +  KQ
Sbjct: 705  QDT-KSSVDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQ 763

Query: 644  LKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAER 703
            LKL+D+L+T+ T S++D ES  N AIQ LYD+M TD+VARRAILESR LTKK EE++AER
Sbjct: 764  LKLMDSLMTDATLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAER 823

Query: 704  DNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXX 763
            D L+++LS+A+NGLVG+L++E+ Q + IL K+ RVT Q                      
Sbjct: 824  DFLSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVE 883

Query: 764  XXXMLTILNSKPHGE-NGGSPEVNTSTPSPLKPEK------KMAIQKALQDRLRQTEKDL 816
               MLTILNS+P  E +     ++ +  +  + EK      K  I+KALQD L++T+KDL
Sbjct: 884  LRKMLTILNSRPETELDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDL 943

Query: 817  TRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXX-- 874
            + DSKR      PN+RL+ LR +M+ IE EAR LEMTNF D                   
Sbjct: 944  SLDSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHP 1003

Query: 875  --------XIQRSLRGEQV----KELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKK 922
                      +   R E++    ++LA LRK LA IQQE+N++S+FNVEE VNELF  KK
Sbjct: 1004 SLKPGIPIAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKK 1063

Query: 923  NKALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAK 982
             +A++RL++LE  Y+ FG+DFN +  L     +   +D D P  +      LDP     K
Sbjct: 1064 IQAMERLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYET-----LDPNLFIDK 1118

Query: 983  IEEMTKILDRLNKLKKDID------MSSVGTSTSNE 1012
            ++E+ K   +L++L  D++       +S+ T+ SN+
Sbjct: 1119 MDELDKFSMKLDQLTSDLNNTMSAKQNSLSTTNSNQ 1154

 Score = 67.0 bits (162), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%)

Query: 180 DGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEY 239
           DG + LE P +P            KRNI Q++     RELMSY + KKWL+VKQDLQ+E 
Sbjct: 202 DGKVNLEMPNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSEL 261

Query: 240 KKMKNSMP 247
           KKM++  P
Sbjct: 262 KKMRSKNP 269

 Score = 33.1 bits (74), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 37/78 (47%), Gaps = 23/78 (29%)

Query: 1086 ASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSG--NHRKSFVNRMKR 1143
            +SFLE+LSQKYGT                   N     S N+ N    N  + F++RMK+
Sbjct: 1198 SSFLESLSQKYGTGQ-----------------NASGPMSSNTPNVSHYNPERKFMSRMKK 1240

Query: 1144 T-ITPTSSNFLEELTQKV 1160
               TP   N++ EL QKV
Sbjct: 1241 QHATP---NYIRELNQKV 1255

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/527 (59%), Positives = 385/527 (73%), Gaps = 18/527 (3%)

Query: 1346 LGRSKTYGGXXXXXXXXXXXXFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDL 1405
            +G+ + Y               +R PRP+KKLKQLHW+K+D  D+SIW    AE+FADDL
Sbjct: 1247 MGKKEPYKSVVDQPSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDL 1306

Query: 1406 YEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVS 1465
            YEKGVL  LEKAFAAREIKS   RKK++ +KI+FLS DISQQFGINLHMY SL V  ++ 
Sbjct: 1307 YEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIE 1366

Query: 1466 KILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSE 1525
            K+LKCD++ ++T S IEFL+K EIVEVS N+AR++APYTTDWEGV S++  K        
Sbjct: 1367 KVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK-------- 1418

Query: 1526 LQRSDQL-------FLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAI 1578
             QR  Q+       F+  +VNLQSYW+SRMR LK+IT+YE++YN+L+ KLR +DKAVGA+
Sbjct: 1419 FQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAV 1478

Query: 1579 QKSENLRNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQ 1638
            Q+SENL+NVF+VILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD  NSMTFLNYVE+IV  
Sbjct: 1479 QRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRD 1538

Query: 1639 NYPSFNSFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDR 1698
            NYPSFN F+ +LEPVL VVK+S+EQL +DCNEF  ++ NVERSLEIGNLSDSSKFHP D+
Sbjct: 1539 NYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDK 1598

Query: 1699 VLAKVLPILPEARKKANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILE 1758
            VL KVLP+LPEA KK++LL DEV+L++MEFE LM+ +GE                  I E
Sbjct: 1599 VLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITE 1658

Query: 1759 YKRAQEFNRKIDEEERAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMD 1818
            YK+AQ  N K +EEERAYE+ K MI+EQQ +  L +E                D R +MD
Sbjct: 1659 YKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLEEERSREVEGEPG--EEQSDRRAMMD 1716

Query: 1819 KLLEKLKNAGPSKGDPSSARKRALARKKLMGGREGSI-ILEGLDVDD 1864
            KLLEKLKNAGP K DPSSARKRAL RKKL+  +E +  IL+ +D  D
Sbjct: 1717 KLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGD 1763

 Score =  468 bits (1205), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 293/736 (39%), Positives = 432/736 (58%), Gaps = 43/736 (5%)

Query: 286  AVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLL 345
            ++A +  +  P HYV+KII+DR+T++E+NDLW++LRTE +DWV  F++ QG +A+AN L+
Sbjct: 320  SIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLM 379

Query: 346  KFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLS 405
              + + +       +  EKE++++KC RVL+ L +G+ E  K KL+  ++  GL SSRL+
Sbjct: 380  NTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLA 439

Query: 406  TRRVATETLLYMLSDDELKTADTGQDAIFPLLVA-LDQESKFAANIHLRGRLHETNKRKS 464
            TR++ATE L+ M+        +   +  F +++A LD+  +   N+++   +H +   K+
Sbjct: 440  TRKMATEVLVCMI--------EKRNNMRFEVVLASLDRYFRQEENLNM---VHLS---KT 485

Query: 465  LP--TGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK-GGENTVXXXXXXXX 521
            LP    ++  +   K ++ WL  ++ TL+GRG+MGSLVGASDDY+  GEN +        
Sbjct: 486  LPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYRSAGENAILEYCLWTM 545

Query: 522  XXXXXXCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNL 581
                  CSN   + QR LLR++L++ G  RI+ K++ L Y  L  ++  +++  LDD+N 
Sbjct: 546  VFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNT 605

Query: 582  LMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXX-XWSRAFAEYRDPAES 640
            ++ + + +S V+M++P +L ++ W   +G++ E              S+   E  DP + 
Sbjct: 606  VLETESKNSKVNMQNPNSLIENLWESCKGSDNEKLLLSLIQHLYLSSSKLMGEKEDPTKL 665

Query: 641  IKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIK 700
             KQLKL+D+L+TNV  S  D ES  N AIQRLYD+MQTDEVARRAILESR LTKK EE  
Sbjct: 666  SKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAH 725

Query: 701  AERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXXXXX 760
            AERD L++KLS A+NGLVGQL+S+++Q + ILEK+ RV  Q                   
Sbjct: 726  AERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEH 785

Query: 761  XXXXXXMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDS 820
                  MLTILNS+   +N   P+V+  T + L P KK+ IQKAL+  L +T+KDL+ DS
Sbjct: 786  EVELRKMLTILNSRNGTQN---PDVDDVTIT-LDPNKKLDIQKALELELNKTKKDLSNDS 841

Query: 821  KRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXX-XXXXXXXXXXIQRS 879
            KR      PN+RLKMLR +M+ IE EAR LEMTNFAD                    ++ 
Sbjct: 842  KRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKK 901

Query: 880  LRGEQ--------VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRD 931
            +  E+         K+L  LRK LA IQ E+N++SKFNVE RVNE+F +KK KAL RL+ 
Sbjct: 902  INTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDKKLKALQRLKQ 961

Query: 932  LENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILD 991
            LE KYK F I F+E      L+  +          D +  + LDP +L  KI E+ +I D
Sbjct: 962  LEAKYKDFEIPFDE------LQDLDDRE-----LDDEQQHSTLDPTYLQKKINELDEISD 1010

Query: 992  RLNKLKKDIDMSSVGT 1007
             L  +  D D ++  T
Sbjct: 1011 ELYLMNYDSDANNGNT 1026

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 85/208 (40%), Gaps = 15/208 (7%)

Query: 53  SDISSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQ-VSGEVTQARSASGAALXXXXXXX 111
           +DISSPKK  +P     +  +PLNK +T+N  NL Q VSG  T+    +   L       
Sbjct: 43  ADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVSG--TKIDQDNPNPLPTNNTSH 100

Query: 112 XXXXXXQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMXXXXXXXXXXXXXXX 171
                 Q A+    +        P  L+          S++  Q                
Sbjct: 101 TRAHSSQSATKYSYSRRSSTATGPIKLSRQQTTQSLGSSSVLSQ------------GSYT 148

Query: 172 XLHKATDIDGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMV 231
            L K  D DG + LE P DP            KRNI Q++     +ELMSY + KKW +V
Sbjct: 149 NLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLV 208

Query: 232 KQDLQTEYKKMKNSMPPSSTVESIASSA 259
           KQDLQ E KK+ +        E   SSA
Sbjct: 209 KQDLQNEIKKLMSKSSSYHPTEGSYSSA 236

 Score = 43.5 bits (101), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 42/88 (47%), Gaps = 27/88 (30%)

Query: 1079 AEAIISNASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHR---- 1134
            ++ I    SFLE+LSQKYGT                        +S  SI S N R    
Sbjct: 1051 SKGISEAGSFLESLSQKYGTGQNAI-------------------SSPTSITSPNERIASQ 1091

Query: 1135 --KSFVNRMKRTITPTSSNFLEELTQKV 1160
              KSF+NR+KR     ++ FLEELTQKV
Sbjct: 1092 GEKSFMNRLKRQT--MAAPFLEELTQKV 1117

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/523 (60%), Positives = 392/523 (74%), Gaps = 6/523 (1%)

Query: 1347 GRSKTYGGXXXXXXXXXXXXFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLY 1406
            G+ K Y               + YP+P KKLKQLHWEK+D  ++SIW +  AEKFA DLY
Sbjct: 1236 GQKKMYRSDMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLY 1295

Query: 1407 EKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSK 1466
            EKGVL+ LEKAFAAREIK+   +KK++  KITFLS D SQQFGINLHMYS + V+ +V K
Sbjct: 1296 EKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIK 1355

Query: 1467 ILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSEL 1526
            ILKCD+DF+ T S IEFLSK EI EVS N+AR+F+PY+TDW+G+ S+EDAK PEKDP++L
Sbjct: 1356 ILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDL 1415

Query: 1527 QRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRN 1586
            QR+DQ++L LI NLQ+YW SRMR +K+IT+Y+K+Y +L+ KLR +DKAVGAI KSENL N
Sbjct: 1416 QRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSN 1475

Query: 1587 VFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSF 1646
            +F+VILAVGN+MNDT+K+AQGFKLSTLQRLTFIKD  NSMTFLNYVE+I+  NYPSFN F
Sbjct: 1476 IFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDF 1535

Query: 1647 LQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPI 1706
            L+ELEPVL V KISI+QL NDCNE+C  VTNVERS+EIGNLSDSSKFHP DRVL KVLP+
Sbjct: 1536 LKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPV 1595

Query: 1707 LPEARKKANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFN 1766
            LPEARKK +LL DEV+LS+MEFENLM+ +GE                  + EYK+AQ  N
Sbjct: 1596 LPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQN 1655

Query: 1767 RKIDEEERAYERRKLMIQEQQRRAKLVQEGDETTC--ARLSAISASGDDRDVMDKLLEKL 1824
             K++EEER YER K M++EQQRR +   +  +         A     D R +MDKLL++L
Sbjct: 1656 LKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQL 1715

Query: 1825 KNAGPSKGDPSSARKRALARKKLMGGREGSIILEGLDVDDLQS 1867
            KNAGP+  DPSSARKRAL R+KL   ++ +  L    + DL S
Sbjct: 1716 KNAGPTTSDPSSARKRALMRRKLQADKDAAAHL----ISDLDS 1754

 Score =  501 bits (1290), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 314/845 (37%), Positives = 458/845 (54%), Gaps = 49/845 (5%)

Query: 180  DGTLTLEKPEDPXXXXXXXXXXXXKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEY 239
            DG + L+ P+D             KRNI Q++     +EL +Y IDKKWL+V+QDL ++ 
Sbjct: 176  DGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKKWLIVRQDLSSDL 235

Query: 240  KKM--------------KNSMPPSSTVES-----IASSALAKXXXXXXXXXXXXXXXXXX 280
            KKM                 +  ++T+ S       S    K                  
Sbjct: 236  KKMMAKSSSSATQASANTTDLSLTNTISSHDYSDATSIRHMKTNASSKSLNSNLYSNANA 295

Query: 281  XAKPMAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAI 340
             +    V  E  +  P +YV+KII+D +T  ELNDLW++LRTE +DWV  F++ QG +A+
Sbjct: 296  NSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAM 355

Query: 341  ANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLL 400
            AN L+K + + + ++     +LE+E +Y+KC RVL  L +G+ E  K  ++  +V   L 
Sbjct: 356  ANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALF 415

Query: 401  SSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETN 460
            S RL TR++ATE  + ML        D        +L ALD++     N+H+   +  + 
Sbjct: 416  SIRLPTRKMATEIFVCMLEKKNKSRFDV-------ILTALDKKFMIGENLHMMQFVKNSP 468

Query: 461  KRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVXXXXX 518
            ++       + F +V    + WL  +E  L GRG+MGSLVGAS++ +  GGEN++     
Sbjct: 469  QQFIHLKRDSQFKIV----QAWLTGLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQ 524

Query: 519  XXXXXXXXXCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDD 578
                     C     V QR LLR+RL++ G  RI+ + +LL Y  +  ++  +E+  LDD
Sbjct: 525  WTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDD 584

Query: 579  YNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWSRAFAEYR-DP 637
             N L+ S   ++ V+M+DP  + Q  W   +GTE E             S   A+ R DP
Sbjct: 585  INNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDP 644

Query: 638  AESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYE 697
            ++  KQLKL+D+LV NV+ S++D ES  N AIQRLYDAMQTDEVARRAILESR+LTK+ E
Sbjct: 645  SKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELE 704

Query: 698  EIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQXXXXXXXXXXXXXXXX 757
            EI+AERD L  KL+   +G+VG+L+ E++Q + IL K+ RV                   
Sbjct: 705  EIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEK 764

Query: 758  XXXXXXXXXMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLT 817
                     MLTILN++P  EN       T + + L P+++ +IQKALQD L++T KDL+
Sbjct: 765  HEHEVELRKMLTILNARPDDENLAKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLS 824

Query: 818  RDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFXXXXXXXXXXXXXXXXXIQ 877
             DSKR      PN+RL+MLR KM+ IE+EAR LEMTNFA+                    
Sbjct: 825  VDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEPVGTGTK----- 879

Query: 878  RSLRGEQVKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYK 937
               +   V++L+ LRK+L+ IQ+E+NEV+KFNVEERV ELF +K+ KAL RL++LE  YK
Sbjct: 880  ---KKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRLKELETTYK 936

Query: 938  GFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRLNKLK 997
            GFGIDFN +  L S     G +  +   ID +     D      K++EM +I + L  +K
Sbjct: 937  GFGIDFNANALLES---KGGDIHWNDDEIDGQ-----DLQGAQEKMDEMDRIANELTAMK 988

Query: 998  KDIDM 1002
              +++
Sbjct: 989  MKVEI 993

 Score = 39.3 bits (90), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 17/75 (22%)

Query: 1086 ASFLETLSQKYGTXXXXXXXXXXXXEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTI 1145
             SFLE LSQKYG                     V R++S       NHR SF NRMK++ 
Sbjct: 1036 GSFLEALSQKYGAGQNTTISNSP-------FPGVDRKSS-------NHRTSFANRMKKS- 1080

Query: 1146 TPTSSNFLEELTQKV 1160
               ++ + +ELT+KV
Sbjct: 1081 --NATPYFDELTRKV 1093

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  307 bits (786), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 172/478 (35%), Positives = 268/478 (56%), Gaps = 27/478 (5%)

Query: 1371 PRPK----KKLKQLHWEKIDDPDNSIWENARA-EKFADDLYEKGVLSELEKAFAAREIKS 1425
            P PK    KK+KQ+HWEKI+D +N+ W+N +  E+   +L   G+  ++E  F  + +  
Sbjct: 810  PVPKLSETKKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSV 869

Query: 1426 FKGRKK---DENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIE 1482
               +KK        I+FLSRD++QQFGINLH++  L    +VSK+L+CD D L   S +E
Sbjct: 870  IMKKKKVVSSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLE 929

Query: 1483 FLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQS 1542
            F  K E+  ++ ++ R   PY+TD+    SV     P K+P ELQR+D++FL L  NL+S
Sbjct: 930  FFCKEEMTHINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRS 984

Query: 1543 YWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTS 1602
            YW+ R + L L+ TYEKDY DL+ KL+ +D A+  I  SE  +N+  +I+ +GN+MN  +
Sbjct: 985  YWNERSQCLLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--T 1042

Query: 1603 KQAQGFKLSTLQRLTFIK-DEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISI 1661
            +   G +LS L +L FIK +  N+++FL+Y+ER++  +Y     F+ +L  V ++ KIS+
Sbjct: 1043 RPVSGIRLSALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISM 1102

Query: 1662 EQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEV 1721
            +Q+A  C EFCS +  +  ++  G LSD  K HPDD++L KV   +  AR K  LL D  
Sbjct: 1103 DQVALQCEEFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHF 1162

Query: 1722 QLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKL 1781
            +LS  +FE +MR +GE                     +K+  + N + +E ER Y +RK 
Sbjct: 1163 KLSNNDFEKVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKK 1222

Query: 1782 MIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARK 1839
            +++   R+   V  G +      +A+          D LL +L+     K +P   RK
Sbjct: 1223 IMEASTRKDSDVDSGTDNIDGENTAV----------DSLLAQLRGVD-KKPEPLRTRK 1269

 Score = 33.9 bits (76), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 48/90 (53%), Gaps = 15/90 (16%)

Query: 662 ESGFNGAIQRLYDAMQTDEVARRAILE-----------SRELTKKYEEIKAERDNLASKL 710
           E+ F  ++  L D++Q+DE+A+RA+LE           S +LTK   E   ++ ++  +L
Sbjct: 486 ETLFQESVNNLMDSLQSDEIAKRAMLELDEKQSQMNILSNQLTKLRNEKTMDKSDILDQL 545

Query: 711 SQAQNGLVGQLQSEVEQLERILEKSNRVTD 740
            Q    +   L+S+  + E+++ K+  + D
Sbjct: 546 KQ----VTDLLESKDREQEKLILKAKSLED 571

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  300 bits (769), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 174/493 (35%), Positives = 286/493 (58%), Gaps = 31/493 (6%)

Query: 1371 PRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAARE-IKSFKGR 1429
            P+   +LKQ+HWEK+DD   ++WE+       D L ++GV S++EK F   E +K  K  
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1430 KKDEN--NKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKP 1487
             ++EN   KI+FL+RDI+QQFGINLHMYS L V   V+K+LKC+ D +   S + F +K 
Sbjct: 875  AENENKPTKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTKE 934

Query: 1488 EIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSR 1547
            ++ ++ + + R FAPY+T++     + D  SPEKDP EL+R+D ++L L  NL+SYWS+R
Sbjct: 935  DLTQIPSGLERKFAPYSTNY-----LTD-DSPEKDPRELERADHIYLELFYNLRSYWSAR 988

Query: 1548 MRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQG 1607
               L ++TTYE+DY DL+ KL  +D+A+  +  S  ++ +  +I  +GNYMN  S    G
Sbjct: 989  SHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VTG 1046

Query: 1608 FKLSTLQRLTFIK--DEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLA 1665
             KL++L +L+F+K   EKN ++FL++VER+V +++P   +F +++  V  + K+++E + 
Sbjct: 1047 IKLNSLPKLSFVKSSSEKN-ISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1666 NDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSL 1725
             +C EF   V +V  SL  G LSD +K HP D +  K+   +  A+ K+ LL ++ +L+ 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1726 MEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQE 1785
                 LM+ +GE                   + +K+  + N + +E  R YE+RK ++++
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1786 QQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARK 1845
               R K ++E +            S D+ + +D L+ KL++A   K  P+  R+R   + 
Sbjct: 1226 ---RNKKIEEQEH-----------SDDEINAVDDLITKLRDA--KKQHPAPLRRRRSTKA 1269

Query: 1846 KLMGGREGSIILE 1858
             L   R G  +LE
Sbjct: 1270 VLNEKRAGEPLLE 1282

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  300 bits (768), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/467 (34%), Positives = 273/467 (58%), Gaps = 26/467 (5%)

Query: 1371 PRPKKKLKQLHWEKIDDPDNSIW--ENARAEKFADDLYEKGVLSELEKAFAAREIK---- 1424
            P  + KLKQ+HW+KI++   ++W  E  R  K + +L   G+  E+E+ F   EIK    
Sbjct: 1160 PSTRIKLKQIHWDKIENIKETVWCDEQQRVSK-SSELESLGIFKEIEELF---EIKPAST 1215

Query: 1425 ----SFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSA 1480
                +     K ++++I+ LSR+++Q+FGINLH++S   V  +V K+L CD + +  Q  
Sbjct: 1216 NLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKNQGV 1275

Query: 1481 IEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNL 1540
            +EF  K E   V  ++ R F PY T++         + PEKDP+EL+R+D+++L L  NL
Sbjct: 1276 LEFFCKEEANNVPQSIQRLFGPYETNYL------TGERPEKDPAELERADRIYLELFYNL 1329

Query: 1541 QSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMND 1600
            +SYW++R   L +I+T+E+DY D++ KL+ +D A  AIQ S  L+ +F +I+ +GNYMN 
Sbjct: 1330 RSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNYMNQ 1389

Query: 1601 TSKQAQGFKLSTLQRLTFIKDEK-NSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKI 1659
              K  QG +LS+L +L F K  K N+++F++ +ERIV   YPS + F++ +  +  V  I
Sbjct: 1390 --KPVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVEGINSITGVANI 1447

Query: 1660 SIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLAD 1719
             ++ +  + +EFC  + N++RSL  G LSD SKFHP DR L +    L +A+KKA LL D
Sbjct: 1448 IVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKARLLRD 1507

Query: 1720 EVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERR 1779
            +  L++ +FE LM  +GE                  IL +++A + N + +E +R YE+R
Sbjct: 1508 QCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREELDRTYEKR 1567

Query: 1780 KLMIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKN 1826
            + ++++    A L      +  + + + +    D+D +D L+ +L++
Sbjct: 1568 RRLLEQT---AALQDRRRSSGLSSVPSSAGDSADKDAVDTLMRRLRD 1611

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  293 bits (751), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 166/480 (34%), Positives = 273/480 (56%), Gaps = 32/480 (6%)

Query: 1372 RPKKKLKQLHWEKIDDPDNSIW--ENARAEKFADDLYEKGVLSELEKAFAARE--IKSFK 1427
            +PK+ LKQ+HWEK++D + ++W  +N + E   + L   G+ S++E++F  +E  IK  K
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKE-LKRGGIFSQIEESFKVKERTIKQTK 856

Query: 1428 GRKKDENNKI-TFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486
             + K E     +FL RD++QQFGINLHM+S       V K+L+CD + +   +A+EF ++
Sbjct: 857  NKDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTR 916

Query: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546
             ++V V+ ++ R+F PY+TD+      ED   P KDP+EL R D++FL L  NLQ YW  
Sbjct: 917  EDLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYE 970

Query: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606
            R   L  +TTYE+DY D I +L+ +D  +  ++     +++  +I+ +GNYMN   + A+
Sbjct: 971  RSFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAE 1028

Query: 1607 GFKLSTLQRLTFIKD--EKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQL 1664
            G KLS+L +L F+K   +KN+ +FL+++ERI+   YP    F  +L  V  + KIS++ L
Sbjct: 1029 GIKLSSLNKLAFVKSSVDKNT-SFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHL 1087

Query: 1665 ANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLS 1724
              +CNEF S +  V  +L+ G LSD S+ HP D ++ K+   +  A+ K++LL D+ +L 
Sbjct: 1088 EQECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLI 1147

Query: 1725 LMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQ 1784
             ++ + LM  FGE                   + +K+  + N + ++ +R YE+RK M++
Sbjct: 1148 NIDLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLE 1207

Query: 1785 EQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALAR 1844
             +QR A      D             G+D D +D LL KL+    ++  P   R+R + R
Sbjct: 1208 SRQRTAS-NHNSD-----------LQGEDEDAVDVLLAKLRG---TEEKPGLVRRRKITR 1252

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  292 bits (748), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 160/457 (35%), Positives = 271/457 (59%), Gaps = 26/457 (5%)

Query: 1376 KLKQLHWEKIDDPDNSIWENARAEKFADD-LYEKGVLSELEKAFAAREIKSFKGR--KKD 1432
            KL+Q+HW+ I+D   + W      K     L E GV  E+E+ F  ++    K    K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1433 EN-NKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVE 1491
            +N  K++FLSRD++QQFGINLHM+S+  V  +V K+L C+ + +  QS +EF +K ++  
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1492 VSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMRGL 1551
            +S ++ ++F PY+T+      V   + P KD SEL+R+D++FL L  NL+SYW +RMR L
Sbjct: 979  ISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1552 KLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKLS 1611
             ++ TYEKDY D++ KL+ +D A  AI+ S+ L+ +  +I+ +GNYMN+  +QA+G KLS
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1612 TLQRLTFIK-DEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNE 1670
            +L +L F+K    N+M+FL+Y+ERI+   Y      + +L  +  + K++++Q+  DC E
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1671 FCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFEN 1730
            F   + N+ERS + G+LS +  FHP+D +++K    +P A++K +LL D+ +L++ + E 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1731 LMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQQRRA 1790
            LM   GE                  +  +K+A   N + +E ER YE+RK +++ ++R  
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKER-- 1268

Query: 1791 KLVQEGDETTCARLSAISA--SGDDRDVMDKLLEKLK 1825
                     +C  + + ++  S ++ D +D L+ KL+
Sbjct: 1269 ---------SCGNMESQNSDESAENNDTVDVLIHKLR 1296

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 97/200 (48%), Gaps = 13/200 (6%)

Query: 535 QQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDM 594
           +++ LL  + K  G+ R+  K +      L++E+RK+++  +++  +  +S  + + +D+
Sbjct: 339 REKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYKE--VEEEVITRSSPELPTFLDI 396

Query: 595 KDPAALWQDFWTQHRGTEAEGHXXXXXXXXXXWSRAFAEYRDPAESIKQLKLLDALVTNV 654
               ++ +    + R T  E             S      R  +ESIK  KL  +++  +
Sbjct: 397 -SYGSILKTLILETRSTPLEHPLYQLLEGVLQISVT----RTSSESIKLFKLFHSILCYL 451

Query: 655 TFSSIDTESG------FNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLAS 708
              + D++SG         ++ ++ D++Q+DE+ARRA+ E   L +  +++ AE ++L  
Sbjct: 452 KDHTFDSDSGEGPESALKTSLNQMMDSLQSDEIARRAMKELNSLQETVDQLTAEVESLKE 511

Query: 709 KLSQAQNGLVGQLQSEVEQL 728
           +    +  ++ QL+   E L
Sbjct: 512 ERKVTKGEVIMQLEEARESL 531

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  289 bits (740), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/480 (35%), Positives = 274/480 (57%), Gaps = 29/480 (6%)

Query: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIW-ENARAEKFADDLYEKGVLSELEKAF---AARE 1422
             ER  +  ++LKQ+HW+KI+D   +IW E       A  L E G+L E+   F    +  
Sbjct: 911  MERKEQDSQRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAP 970

Query: 1423 IKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIE 1482
             K+  GR  +E   +  L RD++QQFGINLHM+S+L V   V K+L CD+  ++ QS +E
Sbjct: 971  TKANTGRLNEEG-PLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLE 1029

Query: 1483 FLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQS 1542
            F ++ ++V +  +++  F PY++D+         K P KD S+L+R+D++FL L  NL+S
Sbjct: 1030 FFARDDLVNIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRS 1083

Query: 1543 YWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTS 1602
            YW  R   L  + TYEKDY D++ KL+ +D A+  I+ S  L++   +I+ +GNYMN   
Sbjct: 1084 YWRQRSICLLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--R 1141

Query: 1603 KQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISI 1661
            KQA G KLS+LQ+L F+K  K+ +++FL+ VER +     +   F+ EL  VL +  + +
Sbjct: 1142 KQAPGIKLSSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVV 1201

Query: 1662 EQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEV 1721
             Q+  D  E+   +  V++SL+ G LSDS  FHP+DR+L KV P +  A +KA LL ++ 
Sbjct: 1202 GQVEQDFQEYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQF 1261

Query: 1722 QLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKL 1781
            +L++   ENLMR++GE                  I+++K+A + N + +E ER Y  RK 
Sbjct: 1262 KLTMRALENLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKE 1321

Query: 1782 MIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRA 1841
            ++Q++            T  +  +  S+  ++ D +D L+++L++   S     S+ KRA
Sbjct: 1322 LLQQK------------TKASSKNDASSEEEEDDAVDILIQRLRDVNKSS---KSSTKRA 1366

 Score = 38.1 bits (87), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 51/90 (56%), Gaps = 12/90 (13%)

Query: 658 SIDTESGFNGAIQRLYDAMQTDEVARRAI----LESRELTKKYEEIKAERDN-------L 706
           +I+ +S  N ++  L D +Q+DE+A+RA+    L  +E+     EI+A R +       +
Sbjct: 489 NINIDSVVNISLNHLVDGLQSDEIAKRAMSELELAQKEIENLESEIRALRKDKEITKGGV 548

Query: 707 ASKLSQAQNGLVGQLQSEVEQLERILEKSN 736
            S+L Q Q  L  + ++ +E+LE+ L++ N
Sbjct: 549 LSELRQTQQAL-AEKETAIEKLEKELKRCN 577

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  287 bits (734), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 163/461 (35%), Positives = 260/461 (56%), Gaps = 19/461 (4%)

Query: 1374 KKKLKQLHWEKIDDPDNSIWENARAE-KFADDLYEKGVLSELEKAF-----AAREIKSFK 1427
            K KLKQ+HW+KIDD   ++W + +     + +L   GV  E+E+ F     A +   +  
Sbjct: 813  KVKLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMF 872

Query: 1428 GRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKP 1487
              +   N K+T LS D++QQFGINL+++S+  V  +V K+L CD + +  QS IEF SK 
Sbjct: 873  TAQNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKD 932

Query: 1488 EIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSR 1547
            +I  +  ++ R FAPY T++           PEKD   L R+D+++L L  NL+SYW+ R
Sbjct: 933  DINHIPQSIQRMFAPYETNYLT------GDKPEKDSRSLDRADRIYLELFYNLRSYWAPR 986

Query: 1548 MRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQG 1607
             + L  + TYEKDY D++ KL+ +D    AI+ S+ L+ +  +I+ VGNYMN+  KQA G
Sbjct: 987  AKYLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALG 1044

Query: 1608 FKLSTLQRLTFIKDEK-NSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666
             +LS+L +L F K  K N+++F++ +E IV  NYP  + F+ +LE +L V  I ++ +  
Sbjct: 1045 IQLSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQ 1104

Query: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726
            +  EF   ++ +ERSL +G LSDSSKFHP D+ L      +  A KKA+LL  +  L++ 
Sbjct: 1105 EAQEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMG 1164

Query: 1727 EFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786
            EF+ LM  +GE                   L +K+A + N +  E  R  E R+ ++++ 
Sbjct: 1165 EFDKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENIE-REVRRVCESRRYLLEKT 1223

Query: 1787 QRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNA 1827
                  V   +  T   L ++ A  DD+  ++ L+++L+N 
Sbjct: 1224 GNSHIRVDRSERCT---LPSLPADSDDQQAVEILIKRLRNV 1261

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  288 bits (736), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 159/467 (34%), Positives = 268/467 (57%), Gaps = 27/467 (5%)

Query: 1373 PKKKLKQLHWEKIDDPDNSIW--ENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRK 1430
            PK KLKQ+HW+KIDD   ++W  ++ R  K + +L   G+  E+++ F            
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSK-STELASFGIFQEIDELFQLNPTSPAIANA 1016

Query: 1431 -----KDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLS 1485
                 K ++ K++ LSR+++Q+FGINLH++S   V  + SK+L CD + L  QS IEF  
Sbjct: 1017 TANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFC 1076

Query: 1486 KPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWS 1545
            K EI  +  ++ + FAPY+ ++         + P++DP+EL R+D+++L L  NL+SYW 
Sbjct: 1077 KEEINNIPKSVQQLFAPYSANYIT------GEQPDRDPNELDRADRIYLELFYNLRSYWG 1130

Query: 1546 SRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQA 1605
            +R + L +I T++KDY D++ KL  +D A  A+Q S  L+ +F +I+ +GNYMN   +  
Sbjct: 1131 ARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPV 1188

Query: 1606 QGFKLSTLQRLTFIKDEK-NSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQL 1664
             G +LS+L +L F K    N+M+F++ +ERIV + YPS + F++ L+ +L+V  I ++ +
Sbjct: 1189 AGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHV 1248

Query: 1665 ANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLS 1724
              + +EFC  + ++ER   IG LSD S+FHP+D+ + K    +  A+KKA+LL D+  L+
Sbjct: 1249 QQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLT 1308

Query: 1725 LMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQ 1784
            + +FE LM  +GE                  I  +++A + N + +E  R YE+R+  ++
Sbjct: 1309 MSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRRALE 1368

Query: 1785 EQQRRAKLVQEGDETTCARLSAISASGDD----RDVMDKLLEKLKNA 1827
            +     +  +     + A      AS DD     D +D L++KL+N 
Sbjct: 1369 QSASSQRQRRRASRLSTA------ASMDDGTQQEDAVDTLIKKLRNV 1409

 Score = 33.9 bits (76), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 629 RAFAEYRDPAESIKQLKLLDALVTNVTFSS-----IDTESGFNGAIQRLYDAMQTDEVAR 683
           R     R  AE+ K L+L  ++   +   S     + TE     ++ +L D +Q+ +V +
Sbjct: 430 RQIVTSRTSAEATKLLQLFQSIFKYLIEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQ 489

Query: 684 RAILESRELTKKYEEIK 700
           RA+ E  E+  K EE+K
Sbjct: 490 RAVQELEEMKVKMEEMK 506

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  287 bits (735), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 243/419 (57%), Gaps = 16/419 (3%)

Query: 1372 RPKKKLKQLHWEKIDDPDNSIWE-NARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRK 1430
            +PK+ LKQ+HWEKIDD + ++WE N + E+   +L   G+  +++  F  +   + K  K
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKN-STVKKVK 906

Query: 1431 KDENNKIT-----FLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLS 1485
             D + K T     FLSRD++QQFGINLHMYS  PV   V K+L+CD D L   S +EF +
Sbjct: 907  NDNSTKKTTQLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFN 966

Query: 1486 KPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWS 1545
              E+  +  +++RSFAPY+ D++      + KSP  DP+EL+R D++FL L  NL+SYW 
Sbjct: 967  NEELTNIPASLSRSFAPYSADFQ------ENKSPTVDPNELERPDRIFLELCYNLRSYWR 1020

Query: 1546 SRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQA 1605
             R + L +  TYE+DY DL+ KL+++D A+  I+ +  L+ +  +I+ +GNYMN   K  
Sbjct: 1021 ERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNV 1078

Query: 1606 QGFKLSTLQRLTFIKDE-KNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQL 1664
             G +L++L +L+F+K    N+++FL+++E++V   YP    F  +L     +  IS + +
Sbjct: 1079 SGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHI 1138

Query: 1665 ANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLS 1724
             ++C E+CS V +V R    G LS  S  HP D ++ KV   +  A+ K+ LL D+ +L 
Sbjct: 1139 QSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLI 1198

Query: 1725 LMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMI 1783
              + + LM+ FGE                   + +K+  + N + +E  R YE+RK ++
Sbjct: 1199 SADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLL 1257

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  286 bits (733), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/479 (33%), Positives = 272/479 (56%), Gaps = 33/479 (6%)

Query: 1371 PRPK--KKLKQLHWEKIDDPDNSIWE-NARAEKFADDLYEKGVLSELEKAFAAREI---K 1424
            P+P+  K LKQ+HW+K+++ DN+IW+ N    +   +L    + +++E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1425 SFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFL 1484
            S   + K+++N  +FLSRD++QQFGINLHMYS+      +  +L C  + +   S +EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1485 SKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYW 1544
             K +++ +  +++R++APY+ D+         + P KD SEL+R+D+LFL L  NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1545 SSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQ 1604
            + R + L L+ TYE+DY DL+ KL+ +D A+  +  S+  R+   ++L +GNYMN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1605 AQGFKLSTLQRLTFIK-DEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQ 1663
             +G K+S+L +L FIK    N+++FL+++E+++   YP    F+ +L  V  + K+++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1664 LANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQL 1723
            +  +C+EFC+ V +V  S+  G LS S K HP+D +L KV   +  A+ K+ LL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1724 SLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMI 1783
            +  +   L+  +GE                  +  +K+  + N + +E ER YE+RK M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1784 QEQQRRAKLVQEGDETTCARLSAISASGDD--RDVMDKLLEKLKNAGPSKGDPSSARKR 1840
            + Q ++     EGD         I+   D    D +D LL KL+     +G P   R+R
Sbjct: 1405 ESQSKK-----EGD--------GINEEDDKSTSDAVDLLLSKLRGV---EGKPEPLRRR 1447

 Score = 38.9 bits (89), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%)

Query: 662 ESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQL 721
           ES    +I  L D +Q+DE+ARRA+ E + L +  + +++E  +L  +    +  L+ QL
Sbjct: 504 ESTVQNSINELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGELIAQL 563

Query: 722 QSEVEQLER 730
           +S   Q+E+
Sbjct: 564 KSAHIQIEK 572

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  277 bits (709), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 150/480 (31%), Positives = 271/480 (56%), Gaps = 33/480 (6%)

Query: 1367 FERYPRPK-KKLKQLHWEKIDDPDNSIW-ENARAEKFADDLYEKGVLSELEKAFAAREIK 1424
            F   P+P+ K LKQ+HW+KI+D  +++W E        +DL EKGV +E+   F   E K
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLF---EQK 848

Query: 1425 SFKGRKKD------ENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQ 1478
            + + +KK       +N K++ LSRD++QQFGINLHM+SS  V  ++ K+L+CD D +   
Sbjct: 849  AVRMKKKSNVTASKKNEKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNH 908

Query: 1479 SAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIV 1538
            S +EF +K +   +  ++ RSF PY +DW+        K+P++D S+L+R+D+++L +  
Sbjct: 909  SVLEFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFY 962

Query: 1539 NLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYM 1598
            N++ YW  R   L +  TYEKDY D++ +L+ +D     I+ S  L+  F +++ +GN+M
Sbjct: 963  NMRYYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFM 1022

Query: 1599 NDTSKQAQGFKLSTLQRLTFIK-DEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVV 1657
            N+  K+ QG KLS+L +L+ +K +   +++FL+ +ERI+ + YP    F ++L  +  + 
Sbjct: 1023 NN--KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLG 1080

Query: 1658 KISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLL 1717
            KI+IE + ++ +E+   +  ++ S E G LS + K HPDD+   K+   LP A +KA LL
Sbjct: 1081 KINIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELL 1140

Query: 1718 ADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYE 1777
             ++ +L++ +F + M+  GE                  +  + +  + N++ +   R +E
Sbjct: 1141 HNQCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHE 1200

Query: 1778 RRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSA 1837
            +R+ ++Q+     ++ +  D+                D +D L++KL++  P +  P S+
Sbjct: 1201 QRQQLLQKASTETQVEKSADDEAA-------------DTIDILIKKLRSVDPQQTIPGSS 1247

 Score = 38.1 bits (87), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 60/110 (54%), Gaps = 11/110 (10%)

Query: 640 SIKQLKLLDALVTNV-------TFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESREL 692
           SIK   + ++++T +       +F   +TE  F  ++  + D +Q+ ++A+RA++E  E 
Sbjct: 429 SIKLFYVFNSILTYLCEHTLDGSFDETNTEQVFMTSLDHIMDNLQSHQIAKRAMMELDEK 488

Query: 693 TKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLE----RILEKSNRV 738
            K+++ I+ + D L      ++  L+ +L+++ E L+    RI E  +R+
Sbjct: 489 KKEFDGIQLQLDTLLQDKQVSKGDLLQKLENKEELLKSREIRIEELQDRL 538

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  276 bits (706), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 226/370 (61%), Gaps = 17/370 (4%)

Query: 1376 KLKQLHWEKIDDPDNSIWENARAEKFADD--LYEKGVLSELEKAFAA-----REIKSFKG 1428
            KLKQ+HW+KID+   ++W N   E+ +    L   GV  E+E  F       +   S   
Sbjct: 771  KLKQIHWDKIDNIKETVW-NEHNERISTSTKLETFGVFKEIEDLFKVVPATPKTASSNSP 829

Query: 1429 RKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPE 1488
             +   N KI  LS D++Q FGINLH++S      ++  +L C  + L  Q  IEF SK +
Sbjct: 830  TQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIEFFSKDD 889

Query: 1489 IVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRM 1548
            I  +  +  R FAPY T++         K+P+KDP+ L+R+D+++L L  NL+SYW++R 
Sbjct: 890  INHIPQSTQRMFAPYETNYLT------GKTPDKDPAVLERADRIYLELFYNLRSYWAARS 943

Query: 1549 RGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGF 1608
            + L ++ TYE+DY D++ KL+ +D A  AI+ S+ L+ +F +I+ +GNYMN+  KQA G 
Sbjct: 944  KYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN--KQALGI 1001

Query: 1609 KLSTLQRLTFIKDEK-NSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAND 1667
            +LS++ +L F K  K N+++F++ +ERI+   YP  ++F ++LE V  +  I ++ +  +
Sbjct: 1002 QLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIVQHVQQE 1061

Query: 1668 CNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLME 1727
              EF   ++N+ERSL +G LSDSS+FHP D+ L+K    +  ARKKA LL D+  L++ +
Sbjct: 1062 AQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQSTLTMGD 1121

Query: 1728 FENLMRMFGE 1737
            FE L+  +GE
Sbjct: 1122 FEKLVSYWGE 1131

 Score = 36.2 bits (82), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 634 YRDPAESIKQLKLL----DALVTNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILE 688
           +R  AE++K L LL    D L+ N     +   E     +I RL D +Q  +V RRA+ E
Sbjct: 429 FRTSAEALKLLNLLQATFDHLLENYHKEQMPSVEEALRSSISRLMDDLQAQQVNRRAVQE 488

Query: 689 SRELTKKYEEIK 700
             E+ +K  E+K
Sbjct: 489 MEEMKQKMIEMK 500

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  270 bits (690), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 163/483 (33%), Positives = 262/483 (54%), Gaps = 25/483 (5%)

Query: 1372 RPKKKLKQLHWEKIDDPDNSIWENARAEK-FADDLYEKGVLSELEKAFAAREI-----KS 1425
            +P KKLKQ+HW+K++D +++IW N    +     L   GVL E+E  F  +E      KS
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1426 FKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLS 1485
                       ++FLSRD++Q FGINLHM+S+L V   V K+L CD D +     +EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1486 KPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWS 1545
            + E+  +S++  R +APY   +       +  + E  P  L+R D++FL L   L+ YWS
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLPP-LERGDEIFLKLCYVLRDYWS 1045

Query: 1546 SRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQA 1605
             R   L ++ TYEKDY D++ KL+ L+ A+  +++S  L+N   +I+ +GNYMN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1606 QGFKLSTLQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQL 1664
             G K+S+L +L FIK   N +++FL+Y+ER++   YP    F+ +L+ V  + K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1665 ANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLS 1724
              +C+E+   +  +  +++ G LSD +K +P D VL K+      A  KA LL  +++LS
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1725 LMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYE-RRKLMI 1783
              +   LM+ +GE                  +  +K+    N + +E +R YE RRKL+ 
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1784 QEQQRRAKLVQEGDETTCARLSAISASG--------DDRDVMDKLLEKLKNAGPSKGDPS 1835
             +Q  R+K    G   + A   A +A G        D+ D +DKLL+KL+      G P 
Sbjct: 1284 DKQSSRSK---SGKGNSAA---ADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGKPR 1337

Query: 1836 SAR 1838
              R
Sbjct: 1338 ERR 1340

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  269 bits (687), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 147/417 (35%), Positives = 246/417 (58%), Gaps = 12/417 (2%)

Query: 1376 KLKQLHWEKIDDPDNSIW-ENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKKDEN 1434
            KLKQ+HW+K++D   +IW +    +  A  L   G L E+ + F   +    K + +  +
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELFRVNQSLPIKAKSETSS 979

Query: 1435 --NKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEIVEV 1492
              +K++ L RD++QQFGINLHM+S+L V   V+K+L CD+D ++ QS +EF ++ ++  +
Sbjct: 980  GKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLSII 1039

Query: 1493 STNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMRGLK 1552
              ++A    PY TD +        ++P  D  +L+R+D++FL L  NL+SYW  R   L 
Sbjct: 1040 PRSIASKLEPYATDHQP------NEAPLLDREKLERADRIFLELCYNLRSYWRPRSLCLL 1093

Query: 1553 LITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFKLST 1612
             ++TYEKDY DLI KL+ +D A+  I+ S  L++   +I+ +GNYMN   KQA G +LS+
Sbjct: 1094 TLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRLSS 1151

Query: 1613 LQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDCNEF 1671
            LQ+LTF+K  K+ +M+ L+ VER +     S   F+++L  VL +  + + Q+  D +E+
Sbjct: 1152 LQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFHEY 1211

Query: 1672 CSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEFENL 1731
               ++ V++SLE G LS    FHP+DR+L KV P +  A +KA+LL ++  L++   ENL
Sbjct: 1212 TQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALENL 1271

Query: 1732 MRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQQR 1788
            M+++GE                  + ++K+  + N + +  ER Y +RK ++Q + +
Sbjct: 1272 MKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSK 1328

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  264 bits (674), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 151/488 (30%), Positives = 264/488 (54%), Gaps = 42/488 (8%)

Query: 1371 PRP-KKKLKQLHWEKIDDPDNSIWENA-RAEKFADDLYEKGVLSELEKAFAARE------ 1422
            P P +K+LKQ+HW+K++D  +++WE+  + ++    L   G+ S++E  F  +       
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1423 ---------IKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKD 1473
                     + S  G+  +E  KI+FLSRD++QQFGINLHM+S L     V K+LKCD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1474 FLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLF 1533
             +   + ++F  K E+V +  ++   + PY+    G           K  S+LQR+D++F
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1534 LNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILA 1593
            L L +NL+ YW+ R + L  ++TYE+DY DLI KL+++D  +  + +S+  +N+  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1594 VGNYMNDTSKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEP 1652
            +GN+MN   +  +G KL +L +L F++   + +M+FL+++E+I+   YP    F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1653 VLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARK 1712
            V  + KIS+E +  +C+EF + + N+    + G LS+     P D+++ KV   +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1713 KANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEE 1772
            K+ LL D+ +L+L++   LMR +GE                  +  +K+  + N + +E 
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1773 ERAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKG 1832
            ER YE+RK +++ +    K     DE     ++         D +D L+ KL+     K 
Sbjct: 1277 ERVYEQRKNLLEMRTNGNKKCDGNDENEGEEVNT--------DAVDLLISKLREV---KK 1325

Query: 1833 DPSSARKR 1840
            DP   R+R
Sbjct: 1326 DPEPLRRR 1333

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 69/130 (53%), Gaps = 24/130 (18%)

Query: 635 RDPAESIKQLKLLDALV----------TNVTF-----SSIDTESGFNGAIQRLYDAMQTD 679
           R  +ESIK LKL+++L+          TN +F     S+ + +S F  ++ +L D++Q+D
Sbjct: 463 RPYSESIKLLKLMNSLLFYLIDSFQVPTNPSFDENIESAENADSVFQDSVNKLLDSLQSD 522

Query: 680 EVARRAILESRELTKKYEEI--------KAERDNLASKLSQAQNGLVGQLQSEVEQLERI 731
           E+ARRA+ E  +L KK   +           +D+L  KL +++  L+     E+E L+  
Sbjct: 523 EIARRAVTEIDDLNKKISHLNEKLDLVENCSKDHLIKKLDESE-ALISLKTKEIENLKVQ 581

Query: 732 LEKSNRVTDQ 741
           L+ + +  DQ
Sbjct: 582 LKTNKKKLDQ 591

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  262 bits (670), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 154/479 (32%), Positives = 260/479 (54%), Gaps = 26/479 (5%)

Query: 1373 PKKKLKQLHWEKIDDPDNSIWENARAE-KFADDLYEKGVLSELEKAFAARE--IKSFKGR 1429
            P K +KQ+HWEK+     S+WE+         +L   G+ SE+E  F +++  IK    +
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1430 KKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEI 1489
             + +N  +T L R+++QQFGINLHM+S +    +  K+L+CD       S IEF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1490 VEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMR 1549
              + +N+ R+F PY+ D++   S      P KD SEL R D +FL L  NL+SYW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKTPGS-----KPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1550 GLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFK 1609
             L ++ TYEKDY DL+ KL  LD+A+ AI+ S+ L++V  +I+A+GN+MN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1610 LSTLQRLTFIKDEKNS-MTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDC 1668
            LS+L +LT+IK    S  +FL+++ER++   YP    F  +L  V  +  ++++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1669 NEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEF 1728
            ++  S +  V RS++ G LS+    HP D +L KV   +  A  K  +L D+  L+ ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1729 ENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQQR 1788
            E L+  FGE                  +  +++  + N + +E +R YE+R+ ++ + + 
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLL-DSKI 1377

Query: 1789 RAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRALARKKL 1847
            +A+     DE             D +D +D+LL+KL+        P++A +R  + K+L
Sbjct: 1378 QAQWDSSMDE----------IEEDQQDAVDQLLKKLRGV----EQPTTAVRRRKSSKRL 1422

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  262 bits (670), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 150/472 (31%), Positives = 259/472 (54%), Gaps = 25/472 (5%)

Query: 1375 KKLKQLHWEKIDDPDNSIW-ENARAEKFADDLYEKGVLSELEKAFAAREIKSFK----GR 1429
            KKLKQ+HW ++++   +IW +N R      +L   GV   ++ +F  +++   K     +
Sbjct: 1141 KKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTDEAK 1200

Query: 1430 KKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEI 1489
             KD+    +FLSRD++QQFGINLH+++S  VS ++ K+L+CD D     + +EF +K E 
Sbjct: 1201 TKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNKEEF 1260

Query: 1490 VEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMR 1549
              +S ++AR++APY  D++            KD SEL+R+D++FL L  NL++YW+ R +
Sbjct: 1261 THISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAYWAERSQ 1314

Query: 1550 GLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFK 1609
             L L+ TYEKDY DL+ KL+ +D AV  +  S   +    ++L +GN+MN   K A+G  
Sbjct: 1315 CLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPAEGIL 1372

Query: 1610 LSTLQRLTFIK-DEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDC 1668
            +S+L +L FIK  E N+++FL+++E+ +   +P    F+ +L  V ++  +S++ +  +C
Sbjct: 1373 ISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHITMEC 1432

Query: 1669 NEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEF 1728
             EFC+ V     ++  G LS     HP D++L KV   + +A+ K+N L D+  L+    
Sbjct: 1433 KEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTNHSI 1492

Query: 1729 ENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMIQEQQR 1788
              +++ +GE                     +K+  + N   +E ER YE+RK M+  + +
Sbjct: 1493 VKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYMLDNKLQ 1552

Query: 1789 RAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKR 1840
            +      GD+      S +  + ++ D +DKLL KL+     +  P   R+R
Sbjct: 1553 KNN--SSGDD------SDLEKNTENDDAVDKLLLKLRGV---ENKPEPLRRR 1593

 Score = 37.4 bits (85), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 341 ANRLLKFVQRESLDILHDYD---ALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVE 397
            N LL F+   +++IL + D       +NAY  C + + N   G    LKSK ++   V+
Sbjct: 246 TNFLLTFINEVNINILAEIDYKITSNLQNAYLNCFKSILNHENGRYYILKSKKIVQYFVQ 305

Query: 398 GLLSSRLSTRRV 409
            LLS + ST R+
Sbjct: 306 -LLSDKQSTIRI 316

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  260 bits (665), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 140/412 (33%), Positives = 240/412 (58%), Gaps = 12/412 (2%)

Query: 1374 KKKLKQLHWEKIDDPDNSIWENARAEKFAD-DLYEKGVLSELEKAFAARE--IKSFKGRK 1430
            KKKLKQ+HW+KI++  N++W++A   +    +L   G+  +++  F+ ++  +K  +   
Sbjct: 856  KKKLKQIHWDKIENVKNTLWDHADGRQDTILELEHAGIFEKVQGMFSVQDLVVKPKRAVN 915

Query: 1431 KDENNKI-TFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEI 1489
              E+NK+ +FLSRD SQQ  INLH+++ L    V+ K+L CD D +   S +EF  K E+
Sbjct: 916  VRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKDEM 975

Query: 1490 VEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMR 1549
            V + +   R F PY+ D+   S     + P K+P EL+R+D+LFL L  NL+ YW+ R +
Sbjct: 976  VNIGSARIRHFTPYSADYLNAS-----EQPAKNPDELERADKLFLYLPFNLRRYWAERSQ 1030

Query: 1550 GLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFK 1609
             L +I+TYE++Y D++  L+ +D A+  I+ SE  +    +I+ +GNYMN  +K  +G +
Sbjct: 1031 CLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEGIR 1088

Query: 1610 LSTLQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDC 1668
            L++L +L FIK   N + +FL++VE+++  +YP    F+ +L  V  + KI+I+Q+   C
Sbjct: 1089 LNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQLQC 1148

Query: 1669 NEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEF 1728
             E+C+ +  +  S+  G LSD ++ HPDD++L KV   +  A+ K+ LL  + +L+  +F
Sbjct: 1149 EEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNNDF 1208

Query: 1729 ENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRK 1780
               M  +GE                     +++    N + +E +RAYE+RK
Sbjct: 1209 RKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRK 1260

 Score = 40.8 bits (94), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 638 AESIKQLKLLDALVTNV--TFS----SIDTESGFNGAIQRLYDAMQTDEVARRAILESRE 691
           +E+IK  K  ++LVT +   F     S+ +E+ F  A+ +L D++ ++E+ +RA+ E +E
Sbjct: 462 SETIKIYKSTNSLVTYLMDNFQNNQKSVASETLFQEAVTKLMDSLHSNEITKRAMSELKE 521

Query: 692 LTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNR 737
           L K  + +  E D    +L +  N   G +  E++Q   ++E  +R
Sbjct: 522 LEKTVQSLNEEID----RLREINNMDKGDVLEELKQANELIESRDR 563

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  260 bits (664), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 148/491 (30%), Positives = 262/491 (53%), Gaps = 41/491 (8%)

Query: 1371 PRPKKKLKQLHWEKIDDPDNSIWENA-RAEKFADDLYEKGVLSELEKAFAARE------- 1422
            P P+++LKQ+HW++++D  +++WE+A + ++   +L   GV S++E  F  R        
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1423 --------IKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDF 1474
                    + S  G+  +E  K++FLSRD++QQFGINLHM+S L     V K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1475 LSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFL 1534
            +   + ++F  K E+  +  ++   + PY+   EG           K  S+LQR+D++FL
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1535 NLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAV 1594
             L +NL+SYW+ R + L  ++TYE+DY DL+ KL+ +D  +  +  S   +N+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1595 GNYMNDTSKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEPV 1653
            GN+MN   K  +G KL +L +L F++   + +M+FL+++E+I+   YP    F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1654 LQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKK 1713
              + KIS+E +  +C+EF + + N+    + G LS      P D+++ KV   +  A+ K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1714 ANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEE 1773
            + LL  + +L+L++   LM+ +GE                  +  +K+  + N + +E E
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1774 RAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGD 1833
            R YE+RK +++ +    K     DE     ++         D +D L+ KL+     K D
Sbjct: 1278 RVYEQRKSLLEMRTNNNKKSNGNDENEGEEVNT--------DAVDLLISKLREV---KKD 1326

Query: 1834 PSSARKRALAR 1844
            P   R+R   R
Sbjct: 1327 PEPLRRRKSTR 1337

 Score = 43.9 bits (102), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 67/127 (52%), Gaps = 24/127 (18%)

Query: 638 AESIKQLKLLDALVTNVT-------FSSID--------TESGFNGAIQRLYDAMQTDEVA 682
           +ESIK LKL+++L+  +         SS D         +S F  ++ +L D++Q++E+A
Sbjct: 467 SESIKLLKLINSLLFYLIDSFQAPICSSFDENLDLAQNVDSVFQDSVNKLLDSLQSNEIA 526

Query: 683 RRAILESRELTKKYEEIKAE--------RDNLASKLSQAQNGLVGQLQSEVEQLERILEK 734
           RRA+ E  +L  K  ++  +        +D+L +KL +++  LV     E+E L+  L+ 
Sbjct: 527 RRAVTEIDDLNNKILDLNEKLNLVENYSKDHLIAKLDESE-ALVSLKTKEIESLKLQLKA 585

Query: 735 SNRVTDQ 741
           + +  DQ
Sbjct: 586 NKKKLDQ 592

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  258 bits (658), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 144/487 (29%), Positives = 264/487 (54%), Gaps = 41/487 (8%)

Query: 1371 PRPKKKLKQLHWEKIDDPDNSIWENA-RAEKFADDLYEKGVLSELEKAFAARE------- 1422
            P  +K+LKQ+HW+K++D  +++WE+  + ++   +L   G+ S++E  F  +        
Sbjct: 872  PPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIANK 931

Query: 1423 --------IKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDF 1474
                    + S  G+  +E  KI+FLSRD++QQFGINLHM+S L     V K+L CD D 
Sbjct: 932  RNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 991

Query: 1475 LSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFL 1534
            +   + ++F  K E+V +  +M   + PY+   +G           K  S+LQR+D++FL
Sbjct: 992  VQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRIFL 1040

Query: 1535 NLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAV 1594
             L +NL+ YW++R + L  ++TYE+DY DLI KL+ +D A+  + +S   +++  +I  +
Sbjct: 1041 ELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIITEI 1100

Query: 1595 GNYMNDTSKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEPV 1653
            GN+MN   +  +G KL +L +L F++   + +++FL+++E+++   YP    F+ +L+ +
Sbjct: 1101 GNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLKNI 1158

Query: 1654 LQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKK 1713
              + KIS+E + ++C+EF   + ++    ++G LS      P D+++ KV   +  A+ K
Sbjct: 1159 EDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAKTK 1218

Query: 1714 ANLLADEVQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEE 1773
            + LL  + +L+L++   LM+ +GE                  +  +K+  + N + +E E
Sbjct: 1219 SELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEEME 1278

Query: 1774 RAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGD 1833
            R YE+RK ++  +    K     DE    ++        +RD +D L+ KL+     K D
Sbjct: 1279 RVYEQRKSLLDMRTSSNKKSNGSDENDGEKV--------NRDAVDLLISKLREV---KKD 1327

Query: 1834 PSSARKR 1840
            P   R+R
Sbjct: 1328 PEPLRRR 1334

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 68/127 (53%), Gaps = 24/127 (18%)

Query: 638 AESIKQLKLLDALV----------TNVTF-----SSIDTESGFNGAIQRLYDAMQTDEVA 682
           +ESIK LKL+++L+          TN +F     S+ + +  F  ++ +L D++Q+DE+A
Sbjct: 466 SESIKLLKLINSLLFYLIDSFQVSTNPSFDETLESAENVDYVFQDSVNKLLDSLQSDEIA 525

Query: 683 RRAILESRELTKKYEEIKA--------ERDNLASKLSQAQNGLVGQLQSEVEQLERILEK 734
           RRA+ E  +L  K   +          ++D+L +KL +++  L+     E+E L+  L+ 
Sbjct: 526 RRAVTEIDDLNAKISHLNEKLNLVENHDKDHLIAKLDESE-SLISLKTKEIENLKLQLKA 584

Query: 735 SNRVTDQ 741
           + +  DQ
Sbjct: 585 TKKRLDQ 591

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  251 bits (642), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 139/415 (33%), Positives = 232/415 (55%), Gaps = 25/415 (6%)

Query: 1376 KLKQLHWEKIDDPDNSIW-ENARAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKKD-- 1432
            +LKQ+HWEK++D ++++W ++AR E+ A +L   G+  ++   F   ++K+ K +K+D  
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTF---QVKNIKMKKRDTT 908

Query: 1433 ---ENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSKPEI 1489
               +    T L R+++QQFGINLHM+SSL     V K+L+C+ D +S  S +EF +K E+
Sbjct: 909  TASKKQNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEEL 968

Query: 1490 VEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSSRMR 1549
              + T++ + F PY          E+ KS      EL+R+D++F  L   L SYW  R  
Sbjct: 969  TSIPTSLIQKFTPY---------AENIKSK----FELERADRIFFELCFQLHSYWRERSN 1015

Query: 1550 GLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQGFK 1609
             L ++ TYEKDY DL+ KL+ +D  +  +  S   R+   +I+ +GNYMN   K   G +
Sbjct: 1016 CLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGIR 1073

Query: 1610 LSTLQRLTFIKDE-KNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLANDC 1668
            + +L +L F+K    N+++FL+++E+I+   YP   SF+ EL  +  + K+SI+QL  D 
Sbjct: 1074 IGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYDS 1133

Query: 1669 NEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLMEF 1728
             EFCS +  +   LE G LS + +  P D++L K    +  A+ K+ L+  +++L   ++
Sbjct: 1134 QEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHDY 1193

Query: 1729 ENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRKLMI 1783
              +MR FGE                  I  +K+  + N + +E ER YE+R+ M 
Sbjct: 1194 AKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMF 1248

 Score = 37.4 bits (85), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 10/98 (10%)

Query: 635 RDPAESIKQLKLLDALVTNV------TFSSIDTESGF----NGAIQRLYDAMQTDEVARR 684
           R  +ESIK    + +L+T +      T SS +  +        +I+RL D +++DEVARR
Sbjct: 439 RTYSESIKLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLESDEVARR 498

Query: 685 AILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQ 722
           A+ E RE     +++  E  NL  + + ++  ++ QL+
Sbjct: 499 AMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLE 536

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  237 bits (605), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 124/424 (29%), Positives = 238/424 (56%), Gaps = 26/424 (6%)

Query: 1374 KKKLKQLHWEKIDDPDNSIWENA-RAEKFADDLYEKGVLSELEKAFAAREIKSFKGRKKD 1432
            K +LKQ+HW+K+++  +++WE+  + ++   +L   G+ S++E  F  ++      +K  
Sbjct: 879  KNRLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNG 938

Query: 1433 -----------ENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAI 1481
                       +++ ++FLSRD++QQFGINLHM+S +     V K+L CD + +   + +
Sbjct: 939  NSSTSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNIL 998

Query: 1482 EFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQ 1541
            +F  K E+V +  +M   + PY+    G           K  S+LQR+D++FL L +NL+
Sbjct: 999  KFFCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINLR 1047

Query: 1542 SYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDT 1601
            SYW++R + L  ++TYE+DY DLI KL+ +D  +  + +S   +++  +I  +GN+MN  
Sbjct: 1048 SYWNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN-- 1105

Query: 1602 SKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKIS 1660
             K  +G KL +L +L F++   + +++FL+++E+++   YP    F+ +L+ +  + K+S
Sbjct: 1106 KKMVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVS 1165

Query: 1661 IEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADE 1720
            +E +  +C EF + V       + G LS+     P D+++ KV   +  A+ K++LL D+
Sbjct: 1166 LEHVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQ 1225

Query: 1721 VQLSLMEFENLMRMFGEXXXXXXXXXXXXXXXXXXILEYKRAQEFNRKIDEEERAYERRK 1780
             +L+L++   LM+ +GE                  +  +K+  + N + +E ER YE+RK
Sbjct: 1226 CKLTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRK 1285

Query: 1781 LMIQ 1784
             +++
Sbjct: 1286 NLLE 1289

 Score = 39.7 bits (91), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 53/98 (54%), Gaps = 19/98 (19%)

Query: 635 RDPAESIKQLKLLDALV----------TNVTF--------SSIDTESGFNGAIQRLYDAM 676
           R  +ESIK L+L+++L+           N +F        ++ + +S F  +I +L D++
Sbjct: 465 RPYSESIKLLRLINSLLFYLIDSFQVPLNASFDEALDQPQNTQNVDSVFQDSIDKLLDSL 524

Query: 677 QTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQ 714
           Q+D++ARRA++E  +L  K   +  ER +L    S+ Q
Sbjct: 525 QSDDIARRAVIEIDDLNCKISTLN-ERISLVENYSKDQ 561

>TPHA0P00170 Chr16 complement(31006..33000) [1995 bp, 664 aa] {ON}
            Anc_8.14 YLR072W
          Length = 664

 Score = 34.3 bits (77), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 935  KYKGFGIDFNED---PELMSLRLANGSVDLDGPT--IDLESSAPLDPAHLDAKIEEMTKI 989
            K KGF +D+  +   P+LMSL +A G  + D  +  ++ ES    D  ++     ++ ++
Sbjct: 572  KMKGFIVDYIHNIVSPQLMSLEMACGGTESDAASSVVNSESKTVFDMEYMGNIELQVNQL 631

Query: 990  LDRLNKLKKDIDM 1002
             D  ++++KDI M
Sbjct: 632  RDTCSRMQKDIRM 644

>Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa] {ON}
            YLR106C (REAL)
          Length = 4909

 Score = 33.9 bits (76), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 802  QKALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADF 858
            Q   +D   ++ KDL ++    +T PAP R + ++ S MD   K+    E  NFAD 
Sbjct: 3571 QHIYEDSKLESSKDLVKNISSWSTRPAPLRNIDVVTSNMDSYLKKISSQEFPNFADL 3627

>ZYRO0B03718g Chr2 complement(306092..309439) [3348 bp, 1115 aa] {ON}
            highly similar to uniprot|P40069 Saccharomyces cerevisiae
            YER110C KAP123 Karyopherin beta mediates nuclear import
            of ribosomal proteins prior to assembly into ribosomes
            and import of histones H3 and H4 localizes to the nuclear
            pore nucleus and cytoplasm exhibits genetic interactions
            with RAI1
          Length = 1115

 Score = 33.9 bits (76), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 1768 KIDEEERAYERRKLMIQEQQRRAKLVQE--GDETTCARLSAISASGDDRDVMDKLLEKLK 1825
            +IDE+ R +  + LM     R++K+ Q   G E T A   A+  + ++ D+ D+L  + +
Sbjct: 270  EIDEDVRVFSVQFLMSALSYRKSKISQAKLGPEITMA---ALKVASEEIDINDELNNEDE 326

Query: 1826 NAGPSKGDPSSARKR--ALARKKLMGGREGSIILEGLDVDDLQSA 1868
             A   +  PS+   R  A A  +L   +  S+I+E L V  LQSA
Sbjct: 327  AAENEENTPSTTAVRLLAFASSELPPSQVASVIVEHLPV-MLQSA 370

>Suva_15.410 Chr15 (713004..715397) [2394 bp, 797 aa] {ON} YHR204W
           (REAL)
          Length = 797

 Score = 33.5 bits (75), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 11/99 (11%)

Query: 372 LRVLTNLREGMQEALKSKLVIS---SVVEGLLSSRLSTRRVATETL--LYMLSDDELKTA 426
           L V  +L   +++  KSK   +   +V+ G L  R+ T  V +ETL  LY+L D+E +  
Sbjct: 427 LNVAVHLLRDLKQRFKSKCGFAGFQNVITGELQDRMETF-VLSETLKYLYLLFDEENELH 485

Query: 427 DTGQDAIF-----PLLVALDQESKFAANIHLRGRLHETN 460
            +G D +F     P+ +  D  SK+  +    G  + ++
Sbjct: 486 KSGSDVVFSTEAHPMWLPQDVRSKYKRDAKFSGATYSSH 524

>Smik_6.403 Chr6
            complement(649777..650406,650816..650909,651311..651321)
            [735 bp, 244 aa] {ON} YPL198W (REAL)
          Length = 244

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 1555 TTYEKDYNDL---IIKLRSLDKAVGAIQKSENLRNVFDV-ILAVGNYMNDTSKQAQGFKL 1610
            + Y+K+Y      II+ +   KA G+       + VF V I  +        K  Q  +L
Sbjct: 49   SAYQKEYETAERDIIQAKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRL 108

Query: 1611 STLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQ 1648
            + +   TF+K  K ++  L  +E  V+  YPS+++  Q
Sbjct: 109  TRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQ 146

>CAGL0G03443g Chr7 complement(331868..335209) [3342 bp, 1113 aa] {ON}
            highly similar to uniprot|P40069 Saccharomyces cerevisiae
            YER110c KAP123 RAN-binding protein
          Length = 1113

 Score = 33.5 bits (75), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 1765 FNRKIDEEERAYERRKLMIQEQQRRAKLVQE--GDETTCARLSAISASGDDRDVMDKLLE 1822
             N +IDE+ R Y  + ++     R++K++Q   G E T   L+A+  + ++ DV D+L  
Sbjct: 267  INTEIDEDVRVYATQFIISALSCRKSKIIQAKLGPEIT---LTALKIAAEEIDVQDELNN 323

Query: 1823 KLKNAGPSKGDPS--SARKRALARKKLMGGREGSIILEGL 1860
            + +     +  PS  + R  A A  +L   +  ++I+E L
Sbjct: 324  EDEAGENEENTPSMVAIRLLAFASTELPPSQVAAVIIEHL 363

>KLTH0H15312g Chr8 complement(1327047..1328756) [1710 bp, 569 aa]
           {ON} weakly similar to uniprot|Q12420 Saccharomyces
           cerevisiae YOR308C SNU66 66kD U4/U6.U5 snRNP associated
           protein
          Length = 569

 Score = 33.1 bits (74), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 910 VEERVNELFYEKKNKALDRLRDLENKYKGFGIDF---NEDPELMSLRLANGSVDLDGPTI 966
           V+E V +   + K   L R+ + + K KG G +F   NED E  SLRL NG + +D  T+
Sbjct: 168 VDEGVTQDLQQAKRLELKRM-NQDRKRKGVGANFVSENEDQEATSLRLVNGKI-VDEETL 225

Query: 967 DLE 969
            L+
Sbjct: 226 TLQ 228

>Suva_7.194 Chr7 complement(357161..357790,358262..358357) [726 bp,
            241 aa] {ON} YGL076C (REAL)
          Length = 241

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 1555 TTYEKDYNDL---IIKLRSLDKAVGAIQKSENLRNVFDV-ILAVGNYMNDTSKQAQGFKL 1610
              Y+K+Y      II+ +   KA G+       + VF V I  +        K  Q  +L
Sbjct: 46   AAYQKEYETAERDIIQAKRDAKATGSYYVEAQRKLVFVVRIKGINKIPPKPRKVLQLLRL 105

Query: 1611 STLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQ 1648
            + +   TF+K  K ++  L  +E  V+  YPS+++  Q
Sbjct: 106  TRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQ 143

>Skud_7.206 Chr7 complement(367578..368207,368667..368765) [729 bp,
            242 aa] {ON} YGL076C (REAL)
          Length = 242

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 1555 TTYEKDYNDL---IIKLRSLDKAVGAIQKSENLRNVFDV-ILAVGNYMNDTSKQAQGFKL 1610
              Y+K+Y      II+ +   KA G+       + VF V I  +        K  Q  +L
Sbjct: 47   AAYQKEYETAERDIIQAKRDAKAAGSYYIEAQHKLVFVVRIKGINKIPPKPRKVLQLLRL 106

Query: 1611 STLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQ 1648
            + +   TF+K  K ++  L  +E  V+  YPS+++  Q
Sbjct: 107  TRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQ 144

>Suva_16.109 Chr16 (183481..183543,183974..184603) [693 bp, 230 aa]
            {ON} YPL198W (REAL)
          Length = 230

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 4/98 (4%)

Query: 1555 TTYEKDYNDL---IIKLRSLDKAVGAIQKSENLRNVFDV-ILAVGNYMNDTSKQAQGFKL 1610
              Y+K+Y      II+ +   KA G+       + VF V I  +        K  Q  +L
Sbjct: 35   AAYQKEYETAERDIIQAKRDAKATGSYYVEAQRKLVFVVRIKGINKIPPKPRKVLQLLRL 94

Query: 1611 STLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQ 1648
            + +   TF+K  K ++  L  +E  V+  YPS+++  Q
Sbjct: 95   TRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQ 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 162,435,428
Number of extensions: 6288660
Number of successful extensions: 22338
Number of sequences better than 10.0: 118
Number of HSP's gapped: 22804
Number of HSP's successfully gapped: 208
Length of query: 1918
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1794
Effective length of database: 39,262,815
Effective search space: 70437490110
Effective search space used: 70437490110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 73 (32.7 bits)