Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR668W1.83ON55655626810.0
Ecym_10871.83ON57051517350.0
KLLA0C02343g1.83ON58153416740.0
SAKL0C02662g1.83ON54852416240.0
Suva_5.41.83ON59053016210.0
SAKL0C02684gsingletonON58850916120.0
Kwal_33.134011.83ON55953016070.0
SAKL0C02640gsingletonON54850915880.0
Smik_5.241.83ON59050915880.0
YEL063C (CAN1)1.83ON59050915760.0
Smik_14.671.83ON57354015740.0
NDAI0A006101.83ON56553915610.0
CAGL0J08184g1.83ON57254915620.0
Skud_5.261.83ON59053015630.0
KLTH0F02398g1.83ON55553715590.0
NCAS0B085701.83ON53251815550.0
KNAG0C007901.83ON57950915520.0
YNL270C (ALP1)1.83ON57353515440.0
Skud_14.701.83ON57356515400.0
TDEL0C061801.83ON58350915390.0
KLTH0F02420g1.84ON62151915380.0
Kwal_33.134111.84ON56052215290.0
NDAI0F042001.83ON56652015200.0
KNAG0C05920singletonON59952815200.0
SAKL0C02728g1.84ON56251715150.0
Suva_14.731.83ON49744015080.0
Kpol_2000.651.83ON59554615170.0
KAFR0D007001.83ON57455015080.0
Ecym_10881.84ON56755315050.0
NCAS0A006001.83ON54448914930.0
TPHA0B044801.83ON60350914970.0
TBLA0A054501.83ON60650914880.0
Smik_14.681.84ON61150414870.0
NDAI0F041901.84ON59950914810.0
Kpol_2000.641.84ON61052214800.0
KLLA0C02365g1.84ON57954914750.0
YNL268W (LYP1)1.84ON61152914780.0
Suva_14.751.84ON61150814690.0
Skud_14.711.84ON61250814670.0
NCAS0A006101.84ON60750914620.0
KAFR0D039401.83ON59756414560.0
TPHA0B044701.84ON59956614560.0
AFR667C1.84ON56351014510.0
TDEL0C061701.84ON57352714510.0
ZYRO0F16654g1.83ON58050914500.0
CAGL0J08162g1.84ON59750914480.0
TBLA0A054601.84ON60852914410.0
KNAG0F004801.84ON59754714370.0
ZYRO0F16632g1.84ON60751013411e-179
SAKL0G14916gna 1ON5815108371e-104
KNAG0L02470singletonON6385328411e-104
TPHA0M00130singletonON6114868371e-104
Smik_6.473na 1ON6064818271e-102
Suva_16.40na 1ON6064818271e-102
TBLA0A07060na 1ON6254818261e-102
YPL265W (DIP5)na 1ON6084818221e-102
Kpol_358.3na 1ON5755258151e-101
KAFR0B06430singletonON5934788151e-101
Skud_16.12na 1ON6075218121e-100
Ecym_2480na 1ON5864828061e-99
CAGL0A01199gna 1ON6134818081e-99
ZYRO0D17908gna 1ON5185028002e-99
TDEL0C00930singletonON5955348043e-99
Kwal_33.15545na 1ON5765208007e-99
ZYRO0D03762g1.244ON6005248002e-98
TPHA0B010901.244ON6064907992e-98
Kwal_26.69407.44ON5705137953e-98
NCAS0D02260na 1ON5975267974e-98
KLLA0E16281gna 1ON6055167974e-98
NDAI0I02660na 1ON5944937922e-97
SAKL0F09790gsingletonON5585037883e-97
AFR156W7.44ON5585227883e-97
Ecym_60211.244ON6004857904e-97
Kwal_27.126811.244ON5935357791e-95
TDEL0A08030singletonON5144787703e-95
NDAI0B052201.244ON6114987775e-95
KLTH0B01166gna 1ON5774787746e-95
SAKL0C01232gsingletonON6134957776e-95
KLTH0D01474g7.44ON6244707761e-94
Kpol_543.791.244ON6055007671e-93
SAKL0B10956g7.44ON5725147622e-93
Ecym_80357.44ON5635237605e-93
SAKL0G14014g5.158ON6055107592e-92
Skud_11.2751.244ON6025187582e-92
YKR039W (GAP1)1.244ON6025187582e-92
KNAG0C02140singletonON5984947564e-92
KLTH0E15642g1.244ON5965117548e-92
Kwal_23.4026singletonON5344737491e-91
Ecym_47895.158ON5884777521e-91
Smik_11.3021.244ON5534997472e-91
AFR230C1.244ON6044637503e-91
CAGL0B01012g1.50ON6235177506e-91
Suva_2.716singletonON6035387486e-91
SAKL0D00836gna 2ON6014897452e-90
CAGL0L03267g1.244ON5974657442e-90
TDEL0F02830na 3ON5615237361e-89
Suva_11.2731.244ON6015167363e-89
SAKL0C01650g1.50ON6134957365e-89
Kwal_33.154075.158ON5875157337e-89
SAKL0D04664g1.244ON5934957331e-88
KNAG0L02460singletonON5885197312e-88
Kwal_33.14276na 2ON5964907303e-88
NCAS0J00140na 4ON5585147264e-88
CAGL0B03773g5.158ON6054937287e-88
NDAI0E038007.44ON6215207281e-87
NDAI0D021605.158ON5875207223e-87
KNAG0E003907.44ON5994927234e-87
NCAS0B079001.244ON6195007226e-87
Smik_6.482na 5ON5585157179e-87
ACL135Wna 1ON5885367181e-86
TDEL0H040707.44ON5774887152e-86
Kpol_367.77.44ON5844997144e-86
KLTH0C05170g3.284ON5985027155e-86
NCAS0B085801.50ON6275117141e-85
CAGL0K05753g1.50ON6604857161e-85
TPHA0H028507.44ON6015097121e-85
KAFR0D00510na 6ON6174997131e-85
Suva_8.4027.44ON6835467163e-85
YGR191W (HIP1)5.158ON6034857103e-85
CAGL0E05632g7.44ON5984997093e-85
Smik_16.1155.158ON6034737103e-85
TDEL0E05750singletonON5485107054e-85
KNAG0F002701.50ON6345107115e-85
KAFR0D00520na 7ON5984897085e-85
KAFR0D005001.50ON6174977096e-85
Suva_2.6881.50ON6614877126e-85
KLTH0B02046g5.158ON5894877067e-85
NCAS0A106803.284ON5934777051e-84
Skud_16.2na 5ON4964726971e-84
NDAI0A01340singletonON5545097012e-84
YOR348C (PUT4)7.44ON6275067062e-84
Skud_4.7841.50ON6635197082e-84
Kpol_543.78singletonON6055007043e-84
Smik_4.7901.50ON6634867073e-84
AGR319W5.158ON6265207044e-84
Suva_7.4855.158ON6035137024e-84
CAGL0M00154gsingletonON5505216968e-84
Smik_15.5327.44ON6315067028e-84
NCAS0A071105.158ON5924846981e-83
SAKL0D02948gna 8ON5944646981e-83
Suva_4.3073.284ON6094986991e-83
KAFR0C051607.44ON5845346972e-83
YBR068C (BAP2)3.284ON6094996982e-83
NDAI0C029505.158ON6094926972e-83
SAKL0A09724gna 9ON5514846933e-83
KLLA0C01606g1.50ON6205086965e-83
TDEL0C065101.50ON6425156976e-83
Skud_2.1913.284ON6094986948e-83
YDR508C (GNP1)1.50ON6634866971e-82
TPHA0A002405.158ON6034926921e-82
KAFR0E018505.158ON5604806891e-82
KLLA0A06886gsingletonON5874976901e-82
Kpol_1010.325.158ON5995076912e-82
Kwal_33.132041.50ON6074936912e-82
ZYRO0G07172gna 3ON5674936873e-82
TPHA0E036601.50ON6475076915e-82
Ecym_26643.285ON5754826865e-82
AFR698C1.50ON6094796885e-82
NDAI0A006401.50ON6414796906e-82
KLLA0F23419g7.44ON5735246857e-82
Skud_15.5157.44ON6265106888e-82
Skud_7.5255.158ON6034906869e-82
KAFR0A011203.284ON5925126859e-82
NDAI0G060301.368ON5994866851e-81
KLTH0F01584g1.50ON5964916851e-81
Kpol_2000.921.50ON6375286872e-81
KLLA0A06930g1.244ON5875226832e-81
NCAS0E022607.44ON5935196832e-81
KLTH0D07128gna 9ON5434906792e-81
KLLA0A11770g5.158ON5814946822e-81
Ecym_10561.50ON6064946833e-81
Smik_3.531.50ON6335056853e-81
NCAS0D018705.158ON5954916805e-81
NDAI0A056203.284ON5714726786e-81
KLTH0A00308gsingletonON5415196758e-81
KAFR0F02250singletonON5544936768e-81
ZYRO0A00308gsingletonON5645226751e-80
Kwal_27.105383.284ON6024796772e-80
KAFR0C004003.284ON5825076752e-80
KLLA0F27093gsingletonON5634786724e-80
KNAG0H011503.284ON6174466764e-80
YCL025C (AGP1)1.50ON6335036765e-80
Suva_3.1891.50ON6334996758e-80
KAFR0D04120na 7ON6484836751e-79
KLTH0F01606gna 7ON6044836721e-79
Smik_2.2013.284ON6095006721e-79
KLTH0H13398g1.368ON5874906701e-79
Suva_13.517singletonON5475116672e-79
Kwal_26.9612singletonON5434896662e-79
CAGL0H08393g3.284ON6124876702e-79
TBLA0B077605.158ON6584806723e-79
TBLA0C01240singletonON6295136703e-79
KNAG0L00110na 4ON5714916664e-79
Suva_2.2033.284ON6044646684e-79
SAKL0D02970g3.284ON6014546666e-79
KNAG0G009005.158ON6135156677e-79
SAKL0C13992gsingletonON5524896629e-79
KAFR0D041401.50ON6374946671e-78
TPHA0A047005.158ON5694926621e-78
NDAI0A074903.284ON5964926632e-78
Skud_3.381.50ON6334986652e-78
AGR039Cna 8ON5864436603e-78
NDAI0F043901.50ON6675206654e-78
TBLA0A051801.50ON6764846631e-77
NCAS0A089201.368ON5994866571e-77
Smik_4.2843.284ON6045106581e-77
KNAG0J022003.284ON6074926572e-77
Kwal_8.590na 10ON6294916582e-77
NCAS0I015303.284ON5954946543e-77
NCAS0A004201.50ON6794646594e-77
YDR046C (BAP3)3.284ON6044646536e-77
YOL020W (TAT2)1.368ON5924866527e-77
TDEL0C053403.397ON5755126509e-77
Kpol_2002.441.50ON6274826539e-77
Suva_15.1481.368ON5924866519e-77
Smik_15.1461.368ON5934866511e-76
Kpol_526.103.397ON5805116501e-76
AAR038W3.397ON5664796481e-76
Skud_2.1923.285ON6194956521e-76
Skud_15.1381.368ON5924866492e-76
TPHA0G03770singletonON6044836502e-76
TBLA0A05190na 7ON6674976542e-76
TBLA0G031203.284ON6735016542e-76
ZYRO0C18502g7.44ON5755136472e-76
AGR040C3.285ON5734836473e-76
Smik_13.1singletonON5234646424e-76
Skud_4.3003.284ON6044646484e-76
CAGL0D02178g1.368ON5774866454e-76
Ecym_26623.284ON5894676456e-76
KLTH0B00154gna 10ON5564646436e-76
Ecym_34303.397ON5595236428e-76
Skud_6.2na 4ON5585216428e-76
Ecym_2663na 8ON5894946431e-75
CAGL0L07546g3.284ON6344996452e-75
Kwal_26.8097na 9ON5444976392e-75
ZYRO0F17446g1.50ON6334716442e-75
AEL030W1.368ON5824866403e-75
NCAS0I008503.397ON5844786403e-75
Ecym_27161.368ON5925426404e-75
AGR038C3.284ON5804696385e-75
Kwal_34.16254singletonOFF4814636316e-75
Kwal_YGOB_34.162541.368ON4914636317e-75
NDAI0A081903.397ON5864926378e-75
Sklu_YGOB_Anc_1.3681.368ON5414446349e-75
Suva_4.3813.397ON5905216361e-74
KLTH0C08052gna 11ON5994366361e-74
SAKL0D02926g3.285ON5834436351e-74
YLL061W (MMP1)na 12ON5835346352e-74
Skud_2.2603.397ON5985216334e-74
Smik_2.2023.285ON6174666344e-74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR668W
         (556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...  1037   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   672   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   649   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   630   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   629   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   625   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   623   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   616   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   616   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   611   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   610   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   605   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   606   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   606   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   605   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            603   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              602   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   599   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   597   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   597   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   597   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   593   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            590   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            590   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   588   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   585   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   588   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   585   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   584   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   579   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   581   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   577   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   577   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   575   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   574   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   572   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   573   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   570   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   569   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              567   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   565   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   565   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   563   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   563   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   563   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   562   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   559   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                558   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   521   e-179
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   327   e-104
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             328   e-104
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     327   e-104
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   323   e-102
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   323   e-102
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   322   e-102
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   321   e-102
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   318   e-101
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   318   e-101
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   317   e-100
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   315   1e-99
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   315   1e-99
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   312   2e-99
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   314   3e-99
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   312   7e-99
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   312   2e-98
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   312   2e-98
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   310   3e-98
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              311   4e-98
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   311   4e-98
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   309   2e-97
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   308   3e-97
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   308   3e-97
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   308   4e-97
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   304   1e-95
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            301   3e-95
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   303   5e-95
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   302   6e-95
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   303   6e-95
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   303   1e-94
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   300   1e-93
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   298   2e-93
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   297   5e-93
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   296   2e-92
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   296   2e-92
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   296   2e-92
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   295   4e-92
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   295   8e-92
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   293   1e-91
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   294   1e-91
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   292   2e-91
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   293   3e-91
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   293   6e-91
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   292   6e-91
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   291   2e-90
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   291   2e-90
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   288   1e-89
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   288   3e-89
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   288   5e-89
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   286   7e-89
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   286   1e-88
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             286   2e-88
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   285   3e-88
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      284   4e-88
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   285   7e-88
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     285   1e-87
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    282   3e-87
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   283   4e-87
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   282   6e-87
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   280   9e-87
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   281   1e-86
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   280   2e-86
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   279   4e-86
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   280   5e-86
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   279   1e-85
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   280   1e-85
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   278   1e-85
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      279   1e-85
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   280   3e-85
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   278   3e-85
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   277   3e-85
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   278   3e-85
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            276   4e-85
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   278   5e-85
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   277   5e-85
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      277   6e-85
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   278   6e-85
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   276   7e-85
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   276   1e-84
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   273   1e-84
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              274   2e-84
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   276   2e-84
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   277   2e-84
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   275   3e-84
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   276   3e-84
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   275   4e-84
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   275   4e-84
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   272   8e-84
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   275   8e-84
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   273   1e-83
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   273   1e-83
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   273   1e-83
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   273   2e-83
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   273   2e-83
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    273   2e-83
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   271   3e-83
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   272   5e-83
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   273   6e-83
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   271   8e-83
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   273   1e-82
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   271   1e-82
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   270   1e-82
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   270   1e-82
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   270   2e-82
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   270   2e-82
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   269   3e-82
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   270   5e-82
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   268   5e-82
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   269   5e-82
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   270   6e-82
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   268   7e-82
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   269   8e-82
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   268   9e-82
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   268   9e-82
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   268   1e-81
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   268   1e-81
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   269   2e-81
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   267   2e-81
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     267   2e-81
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   266   2e-81
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   267   2e-81
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   267   3e-81
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   268   3e-81
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   266   5e-81
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            265   6e-81
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   264   8e-81
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              265   8e-81
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   264   1e-80
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   265   2e-80
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                264   2e-80
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   263   4e-80
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              265   4e-80
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   265   5e-80
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   264   8e-80
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   264   1e-79
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   263   1e-79
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   263   1e-79
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   262   1e-79
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   261   2e-79
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   261   2e-79
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   262   2e-79
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   263   3e-79
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   262   3e-79
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   261   4e-79
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   261   4e-79
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   261   6e-79
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   261   7e-79
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   259   9e-79
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              261   1e-78
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   259   1e-78
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   259   2e-78
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   260   2e-78
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   258   3e-78
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   260   4e-78
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   259   1e-77
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   257   1e-77
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   258   1e-77
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   257   2e-77
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   258   2e-77
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              256   3e-77
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   258   4e-77
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   256   6e-77
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   255   7e-77
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   254   9e-77
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   256   9e-77
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   255   9e-77
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   255   1e-76
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   254   1e-76
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   254   1e-76
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   255   1e-76
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   254   2e-76
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   254   2e-76
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   256   2e-76
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              256   2e-76
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   253   2e-76
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   253   3e-76
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    251   4e-76
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   254   4e-76
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   253   4e-76
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   253   6e-76
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   252   6e-76
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   251   8e-76
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      251   8e-76
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   252   1e-75
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   253   2e-75
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   250   2e-75
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   252   2e-75
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   251   3e-75
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   251   3e-75
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   251   4e-75
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   250   5e-75
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   247   6e-75
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   247   7e-75
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   249   8e-75
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   248   9e-75
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   249   1e-74
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   249   1e-74
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   249   1e-74
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   249   2e-74
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   248   4e-74
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   248   4e-74
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   248   4e-74
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   246   8e-74
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   248   1e-73
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   245   2e-73
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   246   3e-73
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   246   4e-73
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   245   5e-73
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              246   6e-73
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   245   6e-73
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                244   6e-73
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   244   1e-72
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   244   1e-72
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   243   2e-72
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   244   2e-72
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              243   2e-72
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   243   3e-72
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   243   4e-72
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   242   5e-72
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   242   7e-72
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   241   8e-72
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   241   2e-71
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   242   2e-71
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   241   3e-71
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   240   3e-71
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   240   3e-71
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   241   4e-71
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   239   4e-71
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   240   6e-71
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   239   1e-70
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   238   1e-70
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   239   1e-70
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      237   4e-70
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   237   5e-70
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   236   5e-70
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   237   6e-70
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   236   8e-70
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    236   9e-70
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   236   1e-69
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                235   1e-69
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   236   1e-69
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   235   1e-69
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                235   2e-69
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   235   2e-69
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   235   2e-69
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   234   7e-69
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   234   9e-69
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   234   2e-68
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   231   5e-68
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   230   1e-67
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   228   6e-67
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   229   7e-67
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   228   1e-66
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   226   4e-66
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   224   8e-65
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              223   1e-64
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   223   2e-64
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   221   7e-64
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   212   1e-61
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   215   3e-60
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   208   4e-59
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   206   7e-59
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              207   7e-59
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   210   2e-58
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   210   2e-58
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   201   2e-55
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   201   2e-55
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   196   1e-54
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   197   1e-53
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   191   3e-53
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     185   6e-53
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     184   8e-53
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   190   2e-51
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   189   4e-51
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   186   3e-50
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   186   4e-50
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   186   5e-50
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   186   6e-50
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   179   3e-49
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   183   5e-49
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   182   2e-48
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   180   3e-48
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   177   6e-48
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   176   2e-46
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   171   1e-44
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   171   1e-44
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   169   5e-44
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   166   4e-43
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         157   7e-43
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   150   3e-41
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          97   2e-22
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      96   2e-21
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    91   1e-20
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     94   3e-20
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          89   5e-20
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      77   2e-16
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    79   9e-16
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      50   9e-07
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    51   5e-06
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    44   0.001
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    41   0.009
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    40   0.012
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    40   0.017
Skud_8.8 Chr8 (14282..15922) [1641 bp, 546 aa] {ON} YHL036W (REAL)     37   0.11 
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    37   0.12 
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    37   0.14 
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              35   0.19 
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    36   0.22 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    36   0.26 
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    35   0.58 
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    35   0.68 
Smik_8.5 Chr8 (9962..11602) [1641 bp, 546 aa] {ON} YHL036W (REAL)      34   0.86 
Kwal_33.14546 s33 complement(714860..715813) [954 bp, 317 aa] {O...    34   1.0  
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...    34   1.1  
CAGL0E04004g Chr5 complement(383622..385205) [1584 bp, 527 aa] {...    33   1.4  
Suva_8.15 Chr8 (27845..29485) [1641 bp, 546 aa] {ON} YHL036W (REAL)    33   1.4  
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    33   1.5  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    33   1.5  
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    33   1.7  
TPHA0F00170 Chr6 (21183..22853) [1671 bp, 556 aa] {ON} Anc_4.5 Y...    33   1.9  
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    33   1.9  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    33   2.0  
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    33   2.2  
KLTH0A03278g Chr1 (283065..284783) [1719 bp, 572 aa] {ON} highly...    33   2.8  
NDAI0H00180 Chr8 (18650..20356) [1707 bp, 568 aa] {ON} Anc_4.5         33   2.9  
TBLA0C07150 Chr3 complement(1735741..1736784) [1044 bp, 347 aa] ...    32   4.7  
TDEL0G01860 Chr7 complement(374829..376436) [1608 bp, 535 aa] {O...    32   5.7  
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    32   6.9  
Smik_12.284 Chr12 (536350..537537) [1188 bp, 395 aa] {ON} YLR226...    31   9.9  
YLR226W Chr12 (589354..590541) [1188 bp, 395 aa] {ON}  BUR2Cycli...    31   9.9  

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/556 (93%), Positives = 521/556 (93%)

Query: 1   MTNIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTM 60
           MTNIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTM
Sbjct: 1   MTNIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTM 60

Query: 61  XXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV 120
                          ASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV
Sbjct: 61  ISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV 120

Query: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAI 180
           FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAI
Sbjct: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAI 180

Query: 181 NLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVS 240
           NLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVS
Sbjct: 181 NLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVS 240

Query: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
           QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS
Sbjct: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300

Query: 301 LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
           LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN
Sbjct: 301 LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL
Sbjct: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ
Sbjct: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480

Query: 481 GFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXX 540
           GFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTV                  
Sbjct: 481 GFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAIIWD 540

Query: 541 XXKPTTLWGKIWYHLS 556
             KPTTLWGKIWYHLS
Sbjct: 541 DDKPTTLWGKIWYHLS 556

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/515 (64%), Positives = 403/515 (78%), Gaps = 6/515 (1%)

Query: 7   EPKGDGSSSSTITAKPGAIKAE---VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXX 63
           +   + S SS +       K E   +   N SEVESL    +  DVKR+LKPRH++M   
Sbjct: 18  DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGN-DDPDVKRDLKPRHMSMISL 76

Query: 64  XXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFAS 123
                       ASPIR AGPVGSLLAY+F+ T+A+CVTQSLGEMATFIPVTSSFT++  
Sbjct: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136

Query: 124 RFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLI 183
           RF+SPALGAANGYLYW SWC+TFALE+S+IG+LI YW+ AVP++ W+ +FW+LLTA N+I
Sbjct: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMI 196

Query: 184 PVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEI 243
           PV+FYGE EFWIA+LKV++I  FL Y LV+VCGGS  G +GFRYWK+PGPWG+G++S   
Sbjct: 197 PVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNK 256

Query: 244 HTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLV 303
           + A+FLGWVSSLIKAAFT+QGTELVG+TAGE+KNPR+TVPKAIN VFFRIL FYI SL  
Sbjct: 257 YEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316

Query: 304 IGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363
           +GLLV Y DP+L    S ++ N SPFV+AI  +GTKVLP + NGVI+VTI+SAGNSNIY+
Sbjct: 317 VGLLVPYTDPRL-STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYI 375

Query: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423
           GSRVLYGL +SGLAP+   +T  +GVP+ AVL +S+FG L YLN+S  +  VFDWLL+IT
Sbjct: 376 GSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTIT 435

Query: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483
           AV+GFF WLLIS+SHIRFMQ LK RGISR+DLPFKAKFMP+GAYYAAFF+ VIIL+QGF 
Sbjct: 436 AVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFD 495

Query: 484 AFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           +F P F   +F+A YIS F+F+V WL FQ LFK R
Sbjct: 496 SFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTR 530

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/534 (58%), Positives = 398/534 (74%), Gaps = 1/534 (0%)

Query: 20  AKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPI 79
           +K   +  E ++ ++S +        Q++VKR LKPRHV+M               + P+
Sbjct: 44  SKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103

Query: 80  RNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYW 139
            NAGPVGSL+A++ + T+AY VTQSLGEMATFIPVTSSFTVF+ RF+SPA+GAANGY+YW
Sbjct: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163

Query: 140 LSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199
            SW ITFALE+S++G++I YW+DAVP+ AW+AIFWVLL + N+ PVK+YGEFEFW+AS+K
Sbjct: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223

Query: 200 VIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAA 259
           VIAI+ FL Y L +VCG    G IGFRYW+ PGPWG GI+++ ++ A+FLGWVSSLI AA
Sbjct: 224 VIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAA 283

Query: 260 FTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDG 319
           FT+QGTELVG+TAGETKNPR+ VP+AIN VFFRIL+FYIGSL  IGLLV Y+DP+L    
Sbjct: 284 FTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSD 343

Query: 320 STTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379
           + +    SPF++AI    T VLP I N VI+ TIISAGNSN+YVGSR+L+GL ++ LAP 
Sbjct: 344 NGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPK 403

Query: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439
           F S+TT  GVP++AVL T++FG L YLNVS+ +  VFDWLL+ITA++GF TWLLIS+SHI
Sbjct: 404 FFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHI 463

Query: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYI 498
           RFMQ LK RGISRDDLP+KAKFMPY AYYAAFF+ VII++QGFTAF P F+  DF A YI
Sbjct: 464 RFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYI 523

Query: 499 SAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           S F+F ++W +FQ +++ + F T+                    +P  LW K W
Sbjct: 524 SVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFW 577

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/524 (59%), Positives = 389/524 (74%), Gaps = 4/524 (0%)

Query: 30  LNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLL 89
           +  +   +ESL     ++ VKR LKPRH++M               ++P+ NAGPVG+L+
Sbjct: 24  IAEDAVSMESLGSV-KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82

Query: 90  AYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           AY+F+ T+AY VTQSLGEMATFIPVTSSFTVF  RF+SPALG+ANGYLYWLSW ITFALE
Sbjct: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209
           +SV+G++I +W+DAVP+TAW+AIFWV+LT  NL PVK+YGE EFWIA +KV+AI+ F+ Y
Sbjct: 143 LSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIY 202

Query: 210 GLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
             ++VCG  K G +GFRYW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG
Sbjct: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPF 329
           +TAGE  NPR+TVP+AIN VFFRIL FYI SLL IGLLV ++DP+L  + S    ++SPF
Sbjct: 263 ITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYI--SSSPF 320

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           V+AI  +GTKVLP I N VI+ TIISAGNSN+YVGSR+ Y +  +GLAP +++ TT  G+
Sbjct: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGI 380

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           PY AVL TS+ G L YL  SS + +VF+WLL+ITAV+GFFTW+LIS+SHIRFMQ LK +G
Sbjct: 381 PYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQG 440

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWL 508
           ISRDDLPFKAKFMP+GAYYAAFF+ VII++QGFTAF P F   DF   YIS  +F V W+
Sbjct: 441 ISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWI 500

Query: 509 LFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
            FQ  F+G  F                       KP  LW K W
Sbjct: 501 GFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/530 (57%), Positives = 396/530 (74%), Gaps = 10/530 (1%)

Query: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           +++ ++ + +  EV++       ++VKRELK RH+ M               ++P+ NAG
Sbjct: 66  SMEEDIQDEDEGEVQN-------AEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAG 118

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
           PVG+L++Y+F+ ++AY VTQSLGEMATFIPVTSSFTVF+ RF+SPA GAANGY+YW SW 
Sbjct: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
           +TFALE+SV+G++I +W+ AVP+ AW++IFWV++TA+N+ PVK+YGEFEFW+AS+KVIAI
Sbjct: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238

Query: 204 LCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
           + FL Y   +VCG    G +GFRYW++PG WG GI+S+  + A+FLGWVSSLI AAFTFQ
Sbjct: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           GTELVG+TAGE  NPR+TVP+AI  V FRIL FYIGSLL IGLLV Y+DP+L    +T+ 
Sbjct: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTS--ATSY 356

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
            + SPF++AI  +GTKVLP I N VI+ TIISA NSNIYVGSRVL+GL +S LAP F S+
Sbjct: 357 VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSK 416

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
           TT  GVPY+AV ATS+FGAL Y+  S+  G VF WLL+IT V+GFF WL ISVSHIRFMQ
Sbjct: 417 TTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQ 476

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFI 502
            LK RGISRD+LPFKAK MP  AYYA FF++VIIL+QGFT+FTP F+ V+F+A YIS F+
Sbjct: 477 ALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFL 536

Query: 503 FVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           F+ IW+LF+ +F+ R+   +                    +P TLW K W
Sbjct: 537 FLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFW 586

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/509 (59%), Positives = 384/509 (75%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
             ++VKR LKPRH++M               +SP+ +AGPVG+L+AY+F+ T+AY VTQS
Sbjct: 78  QDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQS 137

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSSFTVF  RF+SPA G ANGYLYW SWCITFALE+SV+G++I +W+ AV
Sbjct: 138 LGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAV 197

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW+AIFWV+LT  NL PVK+YGE EFWIA +KV+AI+ F+ Y  ++VCG  K G +G
Sbjct: 198 PLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 257

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG+TAGE+KNPRRTVP+
Sbjct: 258 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPR 317

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AIN VFFRIL FYI SLL IGLLV ++DP+L  + S    ++SPFV+AI  +GTKVLP I
Sbjct: 318 AINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHI 375

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI+ TIISAGNSNIYVGSRVLYGL ++ LAP   +R T  GVPY++VL T+ FG L 
Sbjct: 376 FNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLA 435

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           YLN+S+ +  VFDWLL+ITA++GFF WL IS++HIRFMQ LK R +SR+DLPFKAKFMP+
Sbjct: 436 YLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPW 495

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
           GAYY+AFF+ +II++QGFTAF P F+  +F A YIS F+F+ IW++FQ  F+ R+  T  
Sbjct: 496 GAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKN 555

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                               P   W K W
Sbjct: 556 DVDIDTDRRDIDCIVWEEETPKNAWDKFW 584

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/530 (57%), Positives = 390/530 (73%), Gaps = 5/530 (0%)

Query: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           A+  E  +   S++ S     N   V+R+LKPRHV+M                SP+RNAG
Sbjct: 30  ALDQEAQSSQDSQLGSSGHGRNA--VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAG 87

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
           PVG+L++Y+F+ ++AYCVTQSLGEMATFIPVTSSFTVF  RF+S  LGAANGY+Y  SW 
Sbjct: 88  PVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWS 147

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
           +T+ALE+S++G++I YW+ AVP  AW+AIFWV +T  NL+PVKFYGEF+FWIA +KV+AI
Sbjct: 148 VTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAI 207

Query: 204 LCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
           + FL Y L +VCG  K G +GFRYW++PGPWG GI+S +IH  +FLGWVSSL+ AAFT+Q
Sbjct: 208 IGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQ 267

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           GTELVG++AGE+ NPR+TVPKAIN VFFRILLFY+GSL  IGLLV ++D +L    S + 
Sbjct: 268 GTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTS--SDSY 325

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
           +  SPF++AI  +GTK+LPDI N VI+ TIISA NSN+YVGSRVLYGL +  LAP F +R
Sbjct: 326 SAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFAR 385

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
           T   GVP VAVL  + FG LGYL+VS+ +   FDWLL+ITA++GFF+WL IS+ H+RFMQ
Sbjct: 386 TNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQ 445

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFI 502
            LK +GISRDDLPFKAK MP+GAYY+AFF+ +II++QGFT+  P F+  +F A YIS F+
Sbjct: 446 ALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPTFNVSNFFAAYISVFM 505

Query: 503 FVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           F+VIW +FQ  ++ R  H +                    +PTTLWGK W
Sbjct: 506 FLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQWDNTEPTTLWGKFW 555

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/509 (58%), Positives = 379/509 (74%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
            ++ VKR LKPRH++M               ++P+ NAGPVG+L+AY+F+ T+AY V+QS
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSSF VF  RF+SPALGAANGY+Y+LSW ITFALE+SV+G++I +W+DAV
Sbjct: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+TAW+ I WV+L + NL PVKFYGE EFWIA +KV+AI+ F+ Y  ++VCG  K G +G
Sbjct: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AIN VFFRIL FYI SLL IGLLV ++DP+L  + S    ++SPFV+AI  +GTKVLP I
Sbjct: 278 AINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHI 335

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI+ TIISAGNS++Y+ SRVLY +G +GLAP +++ TT  G+PY AVL TS+ G L 
Sbjct: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           YL  S  +  VFDWLL+ITAV+GFF W+LISV+HIRFMQ LK +GISRDDLPFKAKFMP+
Sbjct: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
           GAYYAAFF+ VII++QGFTAF P F+  DF   Y+S  +F  +W+ FQ  F+G  F    
Sbjct: 456 GAYYAAFFIGVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE 515

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                              +P  LW K W
Sbjct: 516 DIDLDTDRREIDNDVWEEDEPKNLWEKFW 544

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/509 (58%), Positives = 381/509 (74%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
             ++VKRELK RH+ M               + P+ NAGPVG+L++Y+F+ ++AY VTQS
Sbjct: 80  RNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQS 139

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSSFTVF+ RF+SPA GAANGY+YW SW ITFALE+SV+G++I +W++ V
Sbjct: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKV 199

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW++IFWV++T +NL PVK+YGEFEFW+AS+KV+AI+ FL Y   +VCG    G +G
Sbjct: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PG WG GI+S++ +  +FLGWVSSLI AAFTFQGTELVG+TAGE  NPR+TVP+
Sbjct: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 319

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AI  V FRIL FYIGSLL IGLLV Y+DP+L    +T+  + SPF++AI  +GTKVLP I
Sbjct: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTT--ATSYVSVSPFIIAIENSGTKVLPHI 377

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI+ TIISA NSNIYVGSR+L+GL ++ LAP F+SRTT  GVPY+AV  T++FGAL 
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALA 437

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           Y+  S+    VF+WLL+IT V+GFF WLLIS+SHIRFMQ LK RGISRD+LPFKAK MP 
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            AY+AA F+I+IIL+QGFTAF P F  +DF+A YIS F+F+ IW+LF+ +F+ R+   + 
Sbjct: 498 LAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIE 557

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                              +P T W K W
Sbjct: 558 DVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/509 (58%), Positives = 378/509 (74%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
             ++VKRELK RH+ M               ++P+ NAGPVG+L++Y+F+ ++AY VTQS
Sbjct: 80  QNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQS 139

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSSFTVF+ RF+SPA GAANGY+YW SW ITFALE+SV+G++I +W+  V
Sbjct: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW++IFWV++T +NL PVK+YGEFEFW+AS+KV+AI+ FL Y   +VCG    G +G
Sbjct: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PG WG GI+S++ +  +FLGWVSSLI AAFTFQGTELVG+TAGE  NPR++VP+
Sbjct: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AI  V FRIL FYIGSLL IGLLV Y+DP+L Q  ST+  + SPF++AI  +GTKVLP I
Sbjct: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQ--STSYVSTSPFIIAIENSGTKVLPHI 377

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI+ TIISA NSNIYVGSR+L+GL ++ LAP F+SRTT  GVPY+AV  T+ FGAL 
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           Y+  S+    VF+WLL+IT V+GFF WL IS+SHIRFMQ LK RGISRD+LPFKAK MP 
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            AYYAA F+ +II++QGFTAF P F+ V F A YIS F+F+ +W+LFQ +F+ R+   + 
Sbjct: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                              +P T W K W
Sbjct: 558 DVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/540 (56%), Positives = 391/540 (72%), Gaps = 6/540 (1%)

Query: 19  TAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASP 78
           T +  A K+ + N +  E E+   K    +VKR+LK RH+ M                 P
Sbjct: 38  TEEAVAGKSSINNDSAKETETSPRK--GGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPP 95

Query: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLY 138
           + +AGPVG+L++Y+F+ T+ Y VTQSLGEMATFIPVTSSF+VFA RF+SPALGA NGY+Y
Sbjct: 96  LAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMY 155

Query: 139 WLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASL 198
           WLSWC TFALE+SV+G++I YW+DAVP+ AW+ IFW LLT +N+ PVK+YGEFEF IAS+
Sbjct: 156 WLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASI 215

Query: 199 KVIAILCFLFYGLVVVCG-GSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIK 257
           KVIA+L F+F+   +VCG G   G IGFRYW++PG WG GI+S+  +  +FLGWVSSLI 
Sbjct: 216 KVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLIN 275

Query: 258 AAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ 317
           AAFT+QGTELVG+TAGE  NPRR VP+AI  V  RIL+FYI SL  IGLLV Y+DP+L  
Sbjct: 276 AAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS 335

Query: 318 DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLA 377
           +G  T  ++SPF+++I  +GTKVLPDI N V+++TI+SAGNSN+Y+GSRVLY L ++ LA
Sbjct: 336 EG--TFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393

Query: 378 PAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVS 437
           P F+S  T  GVPY AVL+TS FG L +L  S+ SG VF+WLL+IT V+GFF WLLIS+S
Sbjct: 394 PRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLS 453

Query: 438 HIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAY 496
           HIRFMQ +KKRGISRDDLP++A+ MP+ AYYA+FF+ +I+L+QGFTAF P F  +DF+A 
Sbjct: 454 HIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAA 513

Query: 497 YISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIWYHLS 556
           YIS F+F+ IWLLFQ  FK R+   +                    +  T W  +W  LS
Sbjct: 514 YISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/539 (54%), Positives = 388/539 (71%), Gaps = 8/539 (1%)

Query: 15  SSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXX 74
           ++++ + P  I  E     + E E    +  +++VKRELK RH+ M              
Sbjct: 30  TNSVHSIPSQITIE-----SQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIG 84

Query: 75  XASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAAN 134
            ++P+ NAGPVG+L+AY+F+ T+ Y VTQSLGEMATFIPVTSSFTVF+ RF+SP+ GAAN
Sbjct: 85  LSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAAN 144

Query: 135 GYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFW 194
           GY+YW SW ITFALE+SV+G++I +W+ AVPI AW++IFWVLL A+N+ PV+FYGEFEFW
Sbjct: 145 GYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFW 204

Query: 195 IASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSS 254
           +AS+KV+AI+ FL Y L +VCG    G +GFRYW++PGP G GI+++ ++ A+FLGWVSS
Sbjct: 205 VASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSS 264

Query: 255 LIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQ 314
           LI AAFT+QGTELVG+TAGE  NPR++VP+AI  V FRIL FYIGSL  IGLLV Y+DP+
Sbjct: 265 LINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPK 324

Query: 315 LIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRS 374
           L  D S     ASPF+++I  +GT +LP I N VI+ TIISA NSN+YVGSR+++GL +S
Sbjct: 325 LTSDDSYV--AASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKS 382

Query: 375 GLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLI 434
            LAP  +SRT   GVP+V+V+ T +FGAL Y+  S+   + F+WLL+IT V+GFF+WL I
Sbjct: 383 KLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFI 442

Query: 435 SVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDF 493
           S+SH+RFMQ L+ RGISRDDLPFKAKFMP  AYYA FF+ +II++QGFT+F P F  +DF
Sbjct: 443 SISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDF 502

Query: 494 VAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           +A YIS F+F+ IW++FQ  F+ R    +                     P T W K W
Sbjct: 503 LAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFW 561

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/549 (55%), Positives = 390/549 (71%), Gaps = 9/549 (1%)

Query: 11  DGSSSSTITAKPGAI--KAEVLNHNTSEVESLCEKPNQ----SDVKRELKPRHVTMXXXX 64
           DG+ S +  +  G +  +    + ++++ E L  + ++     DVKR LK RH+ M    
Sbjct: 22  DGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALG 81

Query: 65  XXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASR 124
                      A+P+ NAGPVG+L+AY+F+ T+ + VTQSLGEMATFIPVTSSF+VFA R
Sbjct: 82  GTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQR 141

Query: 125 FVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP 184
           F+SPALGAANGY+Y+LSWC TFALE+SV+G++I +W+  VP+ AW++IFWVLLTA N+ P
Sbjct: 142 FLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFP 201

Query: 185 VKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIH 244
           VKFYGEFEFWIAS+KV+A++ FL Y L +VCG  K G IGFRYW++PG  G GI+S    
Sbjct: 202 VKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTG 261

Query: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304
            A+FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+ VP+AI  V  RILLFYIGSL  I
Sbjct: 262 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFI 321

Query: 305 GLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVG 364
           GL V Y+DP+L    S    ++SPF++ I  AGT+VLP I N VI+ TIISAGNSN+YVG
Sbjct: 322 GLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVG 379

Query: 365 SRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITA 424
           SR+L+ + ++GLAP F+++TT +GVPY++VLA S FG+L Y+ +S+     F+WLL+IT 
Sbjct: 380 SRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITG 439

Query: 425 VSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA 484
           V+GFF WLLIS SH+RFMQ LK RGISRDDLP+KA +MP+ AYYA FF++VIIL+QGFT+
Sbjct: 440 VAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTS 499

Query: 485 FTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXK 543
           F P FS  DFVA YIS  +F+V W  FQ  F+ R    +                     
Sbjct: 500 FAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDA 559

Query: 544 PTTLWGKIW 552
           P TLW K W
Sbjct: 560 PKTLWDKFW 568

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/530 (56%), Positives = 391/530 (73%), Gaps = 10/530 (1%)

Query: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           +++  + + +  EV++       ++VKRELK RH+ M               ++P+ NAG
Sbjct: 66  SMEENLQDEDEGEVQN-------AEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAG 118

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
           PVG+L+AY+F+ ++A+ VTQSLGEMATFIPVTSSFTVF+ RF+SPA GAANGY+YW SW 
Sbjct: 119 PVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
           ITFALE+SV+G++I +W+  VP+ AW++IFWVL+T +NL PVK+YGEFEFW+AS+KVIAI
Sbjct: 179 ITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAI 238

Query: 204 LCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
           + FL Y   +VCG    G +GFRYW++PG WG GI+S+  +  +FLGWVSSLI AAFTFQ
Sbjct: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQ 298

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           GTELVG+TAGE  NPR+TVP+AI  V FRIL FYIGSLL IGLLV Y+DP+L +  +T+ 
Sbjct: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTE--ATSY 356

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
            + SPF+VAI  +GTKVLP I N VI+ TIISA NSNIYVGSR+L+GL ++ LAP F+SR
Sbjct: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
           T+  GVPY+AV AT++FGAL Y+  S+    VF+WLL+IT V+GFF WL IS+SHIRFMQ
Sbjct: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFI 502
            LK RGISRD+LPFKAK MP  AYY++FF+I+II++QGFTAF P F+   F+A YIS F+
Sbjct: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFL 536

Query: 503 FVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           F+ +W+LF+ +F+ R+   +                    +P T W K W
Sbjct: 537 FIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/537 (56%), Positives = 387/537 (72%), Gaps = 11/537 (2%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSD--------VKRELKPRHVTMXXXXXXXXXXXXXXXA 76
           IK      ++S  + + E+ +Q D        ++R LKPRHV+M               A
Sbjct: 17  IKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIA 76

Query: 77  SPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGY 136
           +P+R+AGPVGSL++Y+F+ ++A+ VTQSLGEMATFIPV SSFTVF  RF+SPALGAANGY
Sbjct: 77  NPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGY 136

Query: 137 LYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIA 196
           +Y  SWCITFALE+S++G +I YW+  VP  AW+ IFWV ++  NL+ VKFYGEF+FWIA
Sbjct: 137 MYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIA 196

Query: 197 SLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256
            +KVIAI+ FL Y L +VCG  K G +GFRYW++PGPWG GI+S+     +FLGWVSSL+
Sbjct: 197 LIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLV 256

Query: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316
            AAFT+QGTELVGV+AGE+ NPR+TVPKAI  VF RILLFY+GSL  IGLLV ++DP+L 
Sbjct: 257 NAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKL- 315

Query: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
            D +   + +SPF++AI  +GT+ LPDI N VI+ TIISA NSN+YVGSRVLYGL + GL
Sbjct: 316 -DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGL 374

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
           AP  I R    GVPY+ V   S+FG LGYL+VSS S   FDWLL+ITA++GFF WL IS+
Sbjct: 375 APKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISL 434

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVA 495
            HIRFMQ LK +GISRDDLPFKAK MP+GAYYAAFF+++II++QGFTAF P F+  +F A
Sbjct: 435 CHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFA 494

Query: 496 YYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
            Y+S F+F+ +W++FQ +FK R  H V                    +PT LWGK W
Sbjct: 495 AYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFW 551

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/518 (57%), Positives = 374/518 (72%), Gaps = 2/518 (0%)

Query: 35  SEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFV 94
            E+  +  +     V+RELK RH+ M               ++P+ NAGPVG+L+AY+F+
Sbjct: 13  EEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFM 72

Query: 95  ATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIG 154
           AT+AY VTQSLGEMATFIPVTSSFTVF+ RFVSPA GAANGY+YW SWCITFALE+SV+G
Sbjct: 73  ATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132

Query: 155 RLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVV 214
           ++I +W+ AVP+ AW++IFWVLLT +N+ PVK+YGEFEFW+A +KV+AI+ FL Y   +V
Sbjct: 133 QVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192

Query: 215 CGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGE 274
           CG    G +GFRYW+ PG +G GI++++ + A+FLGWVSSLI AAFTFQGTELVG+TAGE
Sbjct: 193 CGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGE 252

Query: 275 TKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAIN 334
             NPR+TVP+AI  V FRIL FYI SL  IGLLV YDD +L    S    +ASPF++AI 
Sbjct: 253 AANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYV--SASPFIIAIE 310

Query: 335 AAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAV 394
            +GT VLP I N VI+ TIISAGNSNIYVGSR++YGL  S LAP  +SRTT  GVP+VAV
Sbjct: 311 NSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAV 370

Query: 395 LATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDD 454
           L TS+FGAL Y+  S+     F+WLL+IT V+GFFTWL IS+SHIRFMQ L+ RGISRDD
Sbjct: 371 LVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDD 430

Query: 455 LPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLF 514
           LPFKAK+MP  AYY  FF+ +II++QGFT+F P++ +DF+  YIS F+F+ IW+ FQ  F
Sbjct: 431 LPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGIDFLTAYISVFMFIAIWIAFQAWF 490

Query: 515 KGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           + R    V                    +P   W K W
Sbjct: 491 RCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFW 528

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/509 (57%), Positives = 375/509 (73%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + ++VKRELK RH+ M               ++P++ AGPVG+L++YIF+ T+ Y VTQS
Sbjct: 69  HDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQS 128

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSSFTVFA RF+SP++GAA GY+YW SW +TFALE+SVIG++I YW+ AV
Sbjct: 129 LGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAV 188

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW++IFWV++TA N+ PVK+YGE EFWIA +KVIAI+ FL Y L +VCG    G +G
Sbjct: 189 PLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPVG 248

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PGPWG GI+S++ + A+FLGWVSSLI  AFT+QGTELVG++AGE  NPR+ VP+
Sbjct: 249 FRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPR 308

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AI  V FRIL FYIGSL  IGLLV Y+D  L  + + +   +SPF++AI  +GT VLP I
Sbjct: 309 AIKKVVFRILFFYIGSLFFIGLLVPYNDDAL--NNTDSYVASSPFIIAIKNSGTPVLPHI 366

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI  TI+SAGNSN+YVGSR+L+GL ++ LAP  +SRTT  GVP++AVL TS+ GAL 
Sbjct: 367 FNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALA 426

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           Y+  S+   + F+WLL+ITAV+GFFTWL IS+SHIRFMQ LK RGISRDDLPFKA  MP 
Sbjct: 427 YMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPG 486

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            AYYA+F + VII++QGFTAF P FS  DF A YIS F+F+ IW LFQ +F+ R+ H V 
Sbjct: 487 LAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVE 546

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                              +P T+W K W
Sbjct: 547 DVDIDTDRRDIEAVVWEDAEPKTVWDKFW 575

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/535 (55%), Positives = 384/535 (71%), Gaps = 4/535 (0%)

Query: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           AI  E    + +  E+      + +VKR+LK RH+ M                 P+ +AG
Sbjct: 41  AITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAG 100

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
           PVG+L++Y+F+ T+ Y VTQSLGEM TFIPVTSSF+VFA RF+SPALGA NGY+YWLSWC
Sbjct: 101 PVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
            TFALE+SV+G++I YW++AVP+ AW+ IFW LLT++N+ PVK+YGEFEF IAS+KVIA+
Sbjct: 161 FTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIAL 220

Query: 204 LCFLFYGLVVVCG-GSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
           L F+ +   VVCG G   G IGFRYW++PG WG GI+S + +  +FLGWVSSLI AAFT+
Sbjct: 221 LGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY 280

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
           QGTELVG+TAGE  NPR+ +P+AI  V  RIL+FYI SL  IGLLV Y+DP+L  DG   
Sbjct: 281 QGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDG--I 338

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
             ++SPF+++I  +GTKVLPDI N V+++TI+SAGNSN+Y+GSRVLY L ++ LAP F+S
Sbjct: 339 FVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLS 398

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
             T  GVPY +VL+TS+FG L +L VS+ SG  F+WLL+IT V+GFF WLLIS SHIRFM
Sbjct: 399 NVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFM 458

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAF 501
           Q ++KRGISRDDLP+KA+ MP+ AYYA+FF+ +I+L+QGFTAF P F  +DFVA YIS F
Sbjct: 459 QAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIF 518

Query: 502 IFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIWYHLS 556
           +F+ IWL FQ  FK R    +                    +  T W ++W  LS
Sbjct: 519 LFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/565 (53%), Positives = 392/565 (69%), Gaps = 18/565 (3%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTS-------EVESLCEKPNQS------DVKREL 53
           E K + +S+ TI  K   + A+    +TS        +E+   K  ++      +V+R+L
Sbjct: 12  EGKREANSAPTIKEKE-LVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKL 70

Query: 54  KPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP 113
           K RH+ M                 P+ +AGPVG+L++Y+F+ T+ Y VTQSLGEMATFIP
Sbjct: 71  KERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIP 130

Query: 114 VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIF 173
           VTSSF+VFA RF+SPALGA NGY+YWLSWC TFALE+SV+G++I YW+ AVP+ AW+ IF
Sbjct: 131 VTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIF 190

Query: 174 WVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCG-GSKLGRIGFRYWKDPG 232
           W LLT +N+ PVK+YGEFEF IAS+KVI +L F+ +   +VCG G   G IGFRYW++PG
Sbjct: 191 WCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPG 250

Query: 233 PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFR 292
            WG GI+S   +  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+ VP+AI  V  R
Sbjct: 251 AWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIR 310

Query: 293 ILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVT 352
           IL+FYI SL  IGLLV Y+DP+L  DG  T  +ASPF+++I  +GTKVLPDI N V+++T
Sbjct: 311 ILVFYILSLFFIGLLVPYNDPKLDSDG--TFVSASPFMISIENSGTKVLPDIFNAVVLIT 368

Query: 353 IISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKS 412
           I SAGNSN+Y+GSRVLY L ++ LAP  +S  T  GVPY+AVL TS+FG L +L  S+ S
Sbjct: 369 IFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGS 428

Query: 413 GSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFF 472
           G  F+WLL+IT V+GFF WLLIS SHIRFMQ +KKRGISRDDLP+KA+ MP+ AYYA+FF
Sbjct: 429 GKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFF 488

Query: 473 VIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXX 531
           + +I+L+QGFTAF P F  VDFVA YIS F+F +IWL FQ  FK R    +         
Sbjct: 489 IALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDR 548

Query: 532 XXXXXXXXXXXKPTTLWGKIWYHLS 556
                      +  T W ++W  LS
Sbjct: 549 REIEEQVWIEPECKTRWQRVWDILS 573

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/509 (58%), Positives = 375/509 (73%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           ++++VKR LK RH+ M               ++P+ NAGPVG L+AY+F+AT+ Y V QS
Sbjct: 73  HEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQS 132

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTS+FTVF+SRF+SPA GAA+GY+YW SW ITFALE+SV+G++I +W+ AV
Sbjct: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW+ IFWVLLT  NL PVK+YGEFEFWIA +KVIA++ F+ Y L +VCG    G +G
Sbjct: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVG 252

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PG WG GI+S++ +  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+
Sbjct: 253 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 312

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AI  V FRIL+FY    + IGLLV Y+DP+L  + S +  ++SPF++AI  +GTKVLP I
Sbjct: 313 AIKKVVFRILVFYYPIAVFIGLLVPYNDPKL--NSSDSYVSSSPFIIAIENSGTKVLPHI 370

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N V++ TIISAGNSN+YVGSR++YGL +  LAP+F  RT + GVPY AV  TS FGAL 
Sbjct: 371 FNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALA 430

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           Y+ +S+   S F+WLL+IT V+GFFTW+LIS  HIRFMQ LK RGISRDDLPFKAKFMP+
Sbjct: 431 YMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPW 490

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            AYYA FF++VIIL+QGFTAF P FS VDF A Y+S F+F+ IWL  Q  F+ R FH + 
Sbjct: 491 LAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLD 550

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                               P TLW K W
Sbjct: 551 EVDIDTDRRDIEAVVWDDEPPKTLWDKFW 579

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/519 (56%), Positives = 374/519 (72%), Gaps = 3/519 (0%)

Query: 35  SEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFV 94
           S+ ES      +  VKR LKPRHV+M               ASP+  +GPVG+L+AYIF+
Sbjct: 101 SDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFM 160

Query: 95  ATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIG 154
            T+ Y VTQS+GEMATFIPVTSS TVF+SRF+SPA G ANGY+YW +W ITFA+E+SV G
Sbjct: 161 GTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTG 220

Query: 155 RLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVV 214
           ++I YW++AVP  AW+AIFWVL+T  N  PV+FYGE EFW+AS+KV+AI+ +L Y LV+V
Sbjct: 221 QVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIV 280

Query: 215 CGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGE 274
           CGGSK G IGFRYW++PGPWG GI+S++    +FLGWV+SLI A+FT+QGTELVG+TAGE
Sbjct: 281 CGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGE 340

Query: 275 TKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAIN 334
             NPRRTVP+AIN VFFRIL FYI SL  +GLLV Y+   L  D +TT   +SPFV++I 
Sbjct: 341 AANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL--DKTTTVIASSPFVISIQ 398

Query: 335 AAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAV 394
            AGT+ LPDI N V++VTIISA NSN+YVGSRVL+ L  +G+AP   S  T +GVP++ V
Sbjct: 399 NAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGV 458

Query: 395 LATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDD 454
           + TS+ G L +L V+  +   F+WL++I+ ++G   WL IS+SHIRFMQCLK+RGISRDD
Sbjct: 459 IVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDD 518

Query: 455 LPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFL 513
           LPFK+K MPYGAYYAAF+V VII VQGF AF+P F   +F   YIS  + VV++   Q  
Sbjct: 519 LPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLF 578

Query: 514 FKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           ++ R+F+ +                    +PTTLWGK W
Sbjct: 579 YRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFW 617

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/522 (55%), Positives = 375/522 (71%), Gaps = 4/522 (0%)

Query: 32  HNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAY 91
           HN+S  E       +  VKR LKPRHV+M               ASP+ +AGPVG+L+AY
Sbjct: 38  HNSS-FEDDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAY 96

Query: 92  IFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEIS 151
           IF+ ++ Y VTQS+GEMATFIPVTSS TVF++RF+SPA G ANGY+YW +W IT+A+EIS
Sbjct: 97  IFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEIS 156

Query: 152 VIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGL 211
           VIG++I YW+ AVP+ AW+ IFWV +T  N  PV+FYGE EFW+AS+KVIAI+ +L Y L
Sbjct: 157 VIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYAL 216

Query: 212 VVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVT 271
           ++VCGGSK G IGFRYW++PGPWG GI+S +    +FLGWV+SLI A+FT+QGTELVG+T
Sbjct: 217 IIVCGGSKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGIT 276

Query: 272 AGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVV 331
           AGE  NPR+TVPKAIN VFFRIL FYI SL  +GLLV Y+ P L  D  T+   +SPFV+
Sbjct: 277 AGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL--DKHTSVIASSPFVI 334

Query: 332 AINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPY 391
           +I +AGT++LPDI N V++VTIISA NSN+YVGSR+L+ L  +G+AP   S  T++GVPY
Sbjct: 335 SIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPY 394

Query: 392 VAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGIS 451
           + V+ T++ G L +L V   +   F+WL++I+ ++G   WL IS+SHIRFMQCLK+RGIS
Sbjct: 395 LGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGIS 454

Query: 452 RDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLF 510
           RDDLPFK+K MPYGAYYAAF+V VII VQGF AF P F   +F   YIS  +  V++ L 
Sbjct: 455 RDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLA 514

Query: 511 QFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           Q  ++ R+F+ +                    +PTTLWGK W
Sbjct: 515 QLYYRCRFFNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFW 556

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/520 (56%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 34  TSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIF 93
           + E  S  EK    +VKR+L  RH+ M               A+P+  +GPVGSL+AY+F
Sbjct: 45  SKENVSENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLF 104

Query: 94  VATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVI 153
           + T+ Y VTQSLGEMATFIPVT+SFT+F+ RF+SPALGAANGY+YW SW +TFALE+SV+
Sbjct: 105 LGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164

Query: 154 GRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVV 213
           G++I +W+ AVP+ AW++IFWV+LT  NL PV+ YGE EFWIA LKV AIL F+ Y   +
Sbjct: 165 GQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224

Query: 214 VCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAG 273
           VCG  K G +GFRYW++PGPWG GI+S  I  A+FLGW SSLI AAFTFQGTELVG+TAG
Sbjct: 225 VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAG 284

Query: 274 ETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAI 333
           E  NPR+TVPKAI  V FRIL+FYI SL  IGLLV YDD +L  + S    ++SPF++AI
Sbjct: 285 EAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAI 342

Query: 334 NAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVA 393
             +GTK+LP I NGVI+VTIISAGNSN+Y+GSR+L+GL ++G  P   ++TT  GVP  A
Sbjct: 343 ENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFA 402

Query: 394 VLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRD 453
           V+ TS+FGAL ++  S+     F WLL++  V+GFF+WLLIS +HIRFMQCL+ RGISR+
Sbjct: 403 VVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRN 462

Query: 454 DLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQF 512
           DLPFKAKFMPY AYYA   +I+II  QGFTAF P F  ++F A YIS F+F + W  FQ 
Sbjct: 463 DLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQL 522

Query: 513 LFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
            FK R+   +                     P  LWGK W
Sbjct: 523 WFKCRYVWKLVDIDIDKDRREIEDRVWQDTTPANLWGKFW 562

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/528 (55%), Positives = 375/528 (71%), Gaps = 5/528 (0%)

Query: 32  HNTSEVESLC--EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLL 89
            + +   +LC  E      VKR LKPRH+ M               A P+RNAGPVG+L+
Sbjct: 74  QSATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALI 133

Query: 90  AYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           AYIFV T+ + VTQSLGEM TFIPVTSSFTVF+ RF+SPA GAANGY+YW SW +TFA+E
Sbjct: 134 AYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVE 193

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209
           +SV+G++I +W+ AVP+ AW+ IFW LLT  N+ PVK+YGE EFWIA LKV++++ FL +
Sbjct: 194 LSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIF 253

Query: 210 GLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
            L +  G    G  GFRYW+DPG WG GI++++   A+FLGWVSSLI AAFT+QGTELVG
Sbjct: 254 CLCITSGAGPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVG 313

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPF 329
           +TAGE  NPR+ VPKAI  V  RIL FY+GSL  IG+LV ++DP+L    +T+  ++SPF
Sbjct: 314 ITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTS--ATSFVSSSPF 371

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           ++AI  +G  +LP I NGVI++TIISAGNSN+YVGSR+L+GL  S LAP F +RTT  GV
Sbjct: 372 IIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGV 431

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           P+VAVL TS+FG+L +L +++    VF+WLLSI A++GFF WLLIS+SHIRFM+ L+ RG
Sbjct: 432 PFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRG 491

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWL 508
           ISR+ LPFKA FMP+ AYYA  F+I+IIL+QGFTAF P F+  DFVA YIS  +FV+IW 
Sbjct: 492 ISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWG 551

Query: 509 LFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIWYHLS 556
           +FQ + K R F  V                     P T W K+W  L+
Sbjct: 552 VFQAMKKCRIFWKVEDIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/517 (55%), Positives = 372/517 (71%), Gaps = 7/517 (1%)

Query: 41  CEKPN----QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVAT 96
           CEK      +++VKR LKPRH++M               ASP+  +GPVG+L+AYIF+ +
Sbjct: 44  CEKGEGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGS 103

Query: 97  MAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRL 156
           + Y VTQSLGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W IT+A+EI+V+G++
Sbjct: 104 IVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQV 163

Query: 157 ILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCG 216
           I YW+DAVP+ AW+AIFWVL+T  N  PVKFYGE EFW+AS+KVIAI+ +L Y LV+VCG
Sbjct: 164 IQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCG 223

Query: 217 GSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETK 276
           GS  G IGFRYW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG+TAGE  
Sbjct: 224 GSHQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 283

Query: 277 NPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAA 336
           NPR+TVP+AIN VFFRIL FYI SL  IGLLV YDD +L    +T    +SPFV++I  A
Sbjct: 284 NPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRL--SNTTAVIASSPFVISIQNA 341

Query: 337 GTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLA 396
           GTKVLP I N ++M+TIISA NSN+YVGSRVLY L  SG AP      T +GVPY+ V+ 
Sbjct: 342 GTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIV 401

Query: 397 TSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLP 456
           T++ G L +L V++ +   F+WL++I+ ++G   WL IS+SH+RFMQCLK RGISR+DLP
Sbjct: 402 TALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLP 461

Query: 457 FKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFK 515
           FKAK MP+GAYYAAFF+ VII++QGF AFTP F   DF   YIS  +  V++L  Q  ++
Sbjct: 462 FKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYR 521

Query: 516 GRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
            R+  ++                    +P  LW K W
Sbjct: 522 CRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLWEKFW 558

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/440 (65%), Positives = 354/440 (80%), Gaps = 4/440 (0%)

Query: 78  PIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYL 137
           P+ +AGPVG+L++YIF+ T+ Y VTQSLGEMATFIPVTSSF+VFA RF+SPALGA NGY+
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197
           YWLSWC TFALE+SV+G++I YW+DAVP++AW+ IFW LLT +N+ PVK+YGEFEF IAS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 198 LKVIAILCFLFYGLVVVCG-GSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256
           +KVIA+L F+ Y   +VCG G   G IGFRYW++PG WG GI+S + +  +FLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316
            AAFT+QGTELVG+TAGE  NPR+ VP+AI  V  RIL+FYI SL  IGLLV Y+DP+L 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
            DGS  +A  SPF+++I  +GTKVLPDI N V+++TI+SAGNSN+Y+GSRVLY L ++ L
Sbjct: 259 SDGSFVSA--SPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDL 316

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
           AP F+S  T  GVPY AVLATS+FG L +L  S+ SG  F+WLL+IT V+GFF WLLIS 
Sbjct: 317 APRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISF 376

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVA 495
           SHIRFMQ + KRGISR+DLP+KA+ MPY AYYA+FF+ +I+L+QGFTAF P F  VDFVA
Sbjct: 377 SHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVA 436

Query: 496 YYISAFIFVVIWLLFQFLFK 515
            YIS F+FV IW  FQ  FK
Sbjct: 437 AYISVFLFVAIWFSFQLWFK 456

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/546 (55%), Positives = 392/546 (71%), Gaps = 7/546 (1%)

Query: 12  GSSSSTITAKPGAIKAEVLNHNTS--EVESLCEKP--NQSDVKRELKPRHVTMXXXXXXX 67
           GSSS  +      +     +H+ S  E E   ++     ++VKRELK RH+ M       
Sbjct: 48  GSSSIVVDGSSRHLHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTI 107

Query: 68  XXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVS 127
                   ++P++NAGPVGSL+AY+F+AT+ + VTQSLGEMATFIPVTSSFTVF+SRF+S
Sbjct: 108 GTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFIS 167

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
           P++GAANGY+YW SW ITFALE+SV+G++I +W+DAVP++AW+ I+W +LT +N+ PVKF
Sbjct: 168 PSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKF 227

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQ 247
           YGEFEFW+AS+KVIAI+ FL Y L +VCG    G +GFRYW++PGPWG GI+S ++   +
Sbjct: 228 YGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGR 287

Query: 248 FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLL 307
           FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+AI  V FRIL+FYI SL  IGLL
Sbjct: 288 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLL 347

Query: 308 VRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRV 367
           V +DDP+L      +  ++SPF++AI  +GTKVLP I N VI+ TIISAGNSNIYVGSRV
Sbjct: 348 VPFDDPKLSS--DDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRV 405

Query: 368 LYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSG 427
           ++GL ++ LAP +   TT  GVPY+AVL TS FGAL +L VSS     F+WLL+I  V+G
Sbjct: 406 MFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAG 465

Query: 428 FFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
           FF WLLIS++H+RF+Q L+ RGISRDDLPFKA  MP+ AYYA FF+I+II++QGFTAF P
Sbjct: 466 FFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAP 525

Query: 488 -FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTT 546
            F+  DFVA YIS F+F  +W+ FQ  F+ + + ++                     P T
Sbjct: 526 TFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKT 585

Query: 547 LWGKIW 552
            W + W
Sbjct: 586 FWDRFW 591

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/550 (54%), Positives = 391/550 (71%), Gaps = 15/550 (2%)

Query: 16  STITAKPGAIKAEVLNH----NTSEVESLCEKP--NQSDVKRELKPRHVTMXXXXXXXXX 69
           ST++      K  ++      +T+E E +      + ++VKRELK RH+ M         
Sbjct: 23  STMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGT 82

Query: 70  XXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPA 129
                 ++P+ ++GPVGSL+AYIFV T+ Y VTQSLGEMATFIPVTSSFTVFASRF+SP+
Sbjct: 83  GLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPS 142

Query: 130 LGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYG 189
           +GAA GY+YW SW +TFALE+SV+G+++ YW+ AVPI AW++IFWV+LTA+N+ PVKFYG
Sbjct: 143 IGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYG 202

Query: 190 EFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGI------VSQEI 243
           E EFW+A++KV+AI+ FL Y L +VCG    G +GFRYW++PGPWG G+      +S+  
Sbjct: 203 EIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNK 262

Query: 244 HTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLV 303
           +T +FLGW +SLI AAFT+QGTELVG+TAGE  NPR+TVP+AI  V FRILLFYIGSL  
Sbjct: 263 NTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFF 322

Query: 304 IGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363
           IGLLV +DDP+L      +  ++SPF++AI  +GTK+LPDI N +I++TIISAGNSNIYV
Sbjct: 323 IGLLVPFDDPKLSS--DDSYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYV 380

Query: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423
           GSR+L+ L ++GLAP  +SRTT +GVP+V+VLAT++FG L Y+  +    +VFDWL++IT
Sbjct: 381 GSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNIT 440

Query: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483
           A++GF+ WL I +SHIRFMQ LK RGISRDDLPFKA  MP  AYYA F +++II+ QGFT
Sbjct: 441 AIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFT 500

Query: 484 AFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXX 542
           AFTP F   DF A YIS  +F +IW  FQ  FK RW   +                    
Sbjct: 501 AFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDP 560

Query: 543 KPTTLWGKIW 552
           +P T W K W
Sbjct: 561 EPKTFWDKFW 570

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/553 (51%), Positives = 384/553 (69%), Gaps = 5/553 (0%)

Query: 1   MTNIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTM 60
           +T   Y  K  G++ S I  +  +I  +  +    E E   +  ++++VKR LK RH++M
Sbjct: 15  LTRERYSKKAKGNNGSEIALE--SITPDSGDEFPEEHEQEGDY-HETEVKRALKARHISM 71

Query: 61  XXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV 120
                          ASP+R AGPVGSL+AYIF+ T+ Y +TQSLGEMATFIPVTSS TV
Sbjct: 72  IALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTV 131

Query: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAI 180
           F+ RF+SPA G ANGY+YW +W ITFA+E+SV+G++I YW+  VP+ AW+ IFW+++T +
Sbjct: 132 FSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAWITIFWIIVTLL 191

Query: 181 NLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVS 240
           N  PV+FYGE EFWIAS+KVI I+ +L Y  +VVCGGS  G IGFR W++PGPWG G++S
Sbjct: 192 NFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSSQGPIGFRNWRNPGPWGTGVIS 251

Query: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
                A+FLGWVSSLIKAAFT+QGTELVG+TAGE+KNPR+TVPKAIN VFFRIL FYI S
Sbjct: 252 SNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 311

Query: 301 LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
           L  +GLLV Y+DP++  + S T+ NASPFV++I  AGTK+LPDI N V++VT++SA NSN
Sbjct: 312 LFFVGLLVPYNDPRM-DNTSDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSN 370

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           +Y+GSRV+Y L +SG AP         GVP + V+ T++ G + +L V++ + + F+WL+
Sbjct: 371 VYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLV 430

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           +I+ ++G   WL IS++HIRFMQCLK+RGISRD LPFKAKFMP+ AYYAA FV VII +Q
Sbjct: 431 NISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQ 490

Query: 481 GFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXX 539
           G+TAF+P F    F   YIS  + +V+++  Q  +K R+   +                 
Sbjct: 491 GYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVW 550

Query: 540 XXXKPTTLWGKIW 552
              +P  LW K W
Sbjct: 551 EDDEPKNLWDKFW 563

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/489 (58%), Positives = 370/489 (75%), Gaps = 4/489 (0%)

Query: 31  NHNTSEVESLCE-KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLL 89
           N   + + +L + +  Q DVKRELK RH++M               A P+  AGP+G+L+
Sbjct: 16  NDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALI 75

Query: 90  AYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           AY+F+ T+ + VTQSLGEM TFIPVT+SFTVFA RF+SPA GAANGY+YW SW +TFALE
Sbjct: 76  AYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALE 135

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209
           +SV+G++I +W+ AVP+ AW++I WVLLT  NL PV+ YGE EFWIAS+KV+AIL F+ Y
Sbjct: 136 LSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIY 195

Query: 210 GLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
           G+ ++CG    G +GFRYWK+PGPWG+GI+S  ++ A+F GWVSSLI AAFTFQGTELVG
Sbjct: 196 GICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVG 255

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPF 329
           +TAGE + PR+TVPKAI  V FRIL+FYIGSLLVIGLLV Y+DP+L  + S    ++SPF
Sbjct: 256 ITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYV--SSSPF 313

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           ++ I  AGTK+LP I N VI++TIISAGNSN+Y+GSR+LYGL ++  AP F + T+  GV
Sbjct: 314 IITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGV 373

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           PYV VL TSMFG+L Y+  ++     F WLL+I  V+GFF WLLIS SHIRFM+ LK+RG
Sbjct: 374 PYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRG 433

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWL 508
           ISR+DLP+KA  MP+ AYYA FF+++II++QGFT+F P F   +F A YIS F+F++ W+
Sbjct: 434 ISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWV 493

Query: 509 LFQFLFKGR 517
            FQ  FK R
Sbjct: 494 AFQIWFKCR 502

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/509 (57%), Positives = 378/509 (74%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
            +++VKR+LK RH+ M               A+P+ NAGPVG+L+AY+F+AT+ + VTQS
Sbjct: 93  KEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSSFTVF+SRF+SPA+GAANGY+YW SW +TFALE+SV+G++I +W+ AV
Sbjct: 153 LGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAV 212

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P++AW+ I+WV+LT +NL PVKFYGEFEFW+AS+KV+AI+ FL Y L +VCG    G +G
Sbjct: 213 PLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVG 272

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 273 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 332

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AI  V FRIL+FYI SL  IGLLV YDD +L    S    +ASPF++AI  +GTK+LP I
Sbjct: 333 AIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYI--SASPFIIAIENSGTKILPHI 390

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI+ TIISAGNSN+YVGSR+L+GL ++ LAP +   T+  GVPY +V  TS FGAL 
Sbjct: 391 FNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALA 450

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           +L VSS     F+WLL+I +V+GFF WLLIS++H+RFMQ LK RGISRDDLPFKA+FMP+
Sbjct: 451 FLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPH 510

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            AYY+ FF+ +II++QGFTAF P F+  DFVA YIS F+F  +WL FQ  F+ +   TV 
Sbjct: 511 LAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVE 570

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                               P T W K W
Sbjct: 571 EVDIDTDRRDVDAIIWEDSGPKTFWDKFW 599

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/509 (57%), Positives = 367/509 (72%), Gaps = 5/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
            ++ VKRELKPRH+ M               A+PI+NAGPVGSL+AYIF+ T+ + VTQS
Sbjct: 98  EEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQS 157

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSSFTVFASRFVS   GAA GY+YW SW ITFALE+SV+G++I +W+  V
Sbjct: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW++IFWVL+  +N  PVK YGEFEFW+AS+KVIAI+ F+ Y L +VCG    G +G
Sbjct: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW+ PGPWG GI+S++ + A+FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+
Sbjct: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AI  V  RILLFYI SL  IGLLV Y+DP+L    + +  +ASPF++AI  +GTKVLP I
Sbjct: 338 AIKKVSVRILLFYILSLFFIGLLVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLPHI 395

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI+ TIISA NSN+YVGSR+LYGL  + LAP F  +T + GVP++AVL T+ FGAL 
Sbjct: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFGALA 454

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           Y+  S+   + F+WLL+IT V+GFF WL IS+SHIRFMQ LK RG+SRDDLP+KA  MP 
Sbjct: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            AYY AFFV +IIL+QGFTAF P F +  F+  YIS F+F+ I+++ Q  F+ R + T+ 
Sbjct: 515 LAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL- 573

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                               P T W K W
Sbjct: 574 DDVDIDTDRRDIDTVIWEEGPQTFWDKFW 602

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/504 (55%), Positives = 361/504 (71%), Gaps = 2/504 (0%)

Query: 49  VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108
           VKR LK RH+ M               ++P+ NAGPVGSL+AYIF+ T+ Y +TQSLGEM
Sbjct: 106 VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGEM 165

Query: 109 ATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITA 168
           ATFIPVTSS TVF+ RF+SPA G +NGY+YW +W IT+A+E+SVIG++I YW+D VP+ A
Sbjct: 166 ATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLAA 225

Query: 169 WMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYW 228
           W+AIFWVL+T +N  PVK YGEFEFW+AS+KV+AI+ +L Y LV+VCGGS  G IGFRYW
Sbjct: 226 WIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRYW 285

Query: 229 KDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINT 288
           ++PG WG GI+S+     +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+AIN 
Sbjct: 286 RNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINK 345

Query: 289 VFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGV 348
           V FRI++FYI SL  IGLLV Y++P+L    S+    +SPFV++I  AGT  LPDI N V
Sbjct: 346 VVFRIVIFYIMSLFFIGLLVPYNEPRL--SPSSAVIASSPFVISIQNAGTYALPDIFNAV 403

Query: 349 IMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNV 408
           +++T+ISA NSN+YVGSRVLY L +SG AP      T +GVPY+ VL+T+  G L +L V
Sbjct: 404 VLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVV 463

Query: 409 SSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYY 468
           ++ + + F+WL+SI+ ++G   WL IS++HIRFMQ LK+RGISRDDLPFKAK MPYGAYY
Sbjct: 464 NNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYY 523

Query: 469 AAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXX 528
           A+FFV +II +QGF AF PFS  +F   YIS  +  V+++  Q  +K R+   +      
Sbjct: 524 ASFFVTIIIFIQGFQAFCPFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 529 XXXXXXXXXXXXXXKPTTLWGKIW 552
                         +P  LW K W
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFW 607

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/509 (55%), Positives = 362/509 (71%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + + VKR LK RH+ M               A+P+ N+GPVGSL+AY+F+ ++ Y +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W ITFA+EISV+G++I YW+D V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW+AIFWVL+T +N  PVK YGE EFWIA +KV+AI+ +L Y L++VCGGS  G IG
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PGPWG GI+S++++T +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AIN V FRI LFYI SL  IG+LV Y+D +L    +     +SPFV++I  AGTKVLPDI
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVI--ASSPFVISIQNAGTKVLPDI 386

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N ++M+TIISA NSN+YVGSRVLY L  SG AP   +  T  GVPY+ V+ TS  G L 
Sbjct: 387 FNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLA 446

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           +L V++ + + F+WL++I+ ++G   WL IS+SHIRFMQ LK RGISRDDLPFKAK MP+
Sbjct: 447 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPF 506

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
           GAYYA FFV VII +QGF AF+P +    F   YIS  I  V+++  Q  ++ R+F  V 
Sbjct: 507 GAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVE 566

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                              +P TLW K W
Sbjct: 567 DIDIDSDRREIEAVIWEDDEPKTLWDKFW 595

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/522 (54%), Positives = 363/522 (69%), Gaps = 3/522 (0%)

Query: 32  HNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAY 91
           H+  E ++   +   + VKR LK RH+ M               A+P+ NAGPVGSL+AY
Sbjct: 87  HDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAY 146

Query: 92  IFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEIS 151
           IF+ ++ Y VTQSLGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W IT+A+EIS
Sbjct: 147 IFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIS 206

Query: 152 VIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGL 211
           VIG++I YW+ AVP+ AW+ IFWV++T +N  PVK YGEFEFWIAS+KV+AI+ +L Y L
Sbjct: 207 VIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYAL 266

Query: 212 VVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVT 271
           ++VCGGS  G IGFRYW++PGPWG GI+S +   A+FLGWVSSLI AAFT+QGTELVG+T
Sbjct: 267 IIVCGGSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGIT 326

Query: 272 AGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVV 331
           AGE  NPR++VP+AIN V FRI LFYI SL  IGLLV ++D +L  D +     +SPFV+
Sbjct: 327 AGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVI--ASSPFVI 384

Query: 332 AINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPY 391
           +I  AGT+ LPDI N V+++TIISA NSN+YVGSRVLY L  +G AP   S  T  GVPY
Sbjct: 385 SIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPY 444

Query: 392 VAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGIS 451
           + V+ T+  G L +L V++ + + F+WL++I+ ++G   WL IS+SHIRFMQ LK RGIS
Sbjct: 445 MGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGIS 504

Query: 452 RDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLF 510
           RDDLPFKAK MP+GAYYA+FFV VII +QGF AFTP F    F   YIS  +  V++   
Sbjct: 505 RDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGC 564

Query: 511 QFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           Q  ++ R+   V                    +P  LW K W
Sbjct: 565 QLYYRCRFIWKVEDIDIDSDRREIEAIIWEEDEPKNLWEKFW 606

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/549 (53%), Positives = 386/549 (70%), Gaps = 5/549 (0%)

Query: 9   KGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXX 68
           K   +   +I      + +E+ +H  +E E      ++++VKR LKPRHV+M        
Sbjct: 35  KRSKAGEDSIELSDVQVSSELYDH--AESEEGEGDFHETEVKRALKPRHVSMIALGGTIG 92

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                  A P+  +GPVGSL+AYIF+ ++ Y VTQSLGEMATFIPVTSS TVF+ RF+SP
Sbjct: 93  TGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSP 152

Query: 129 ALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFY 188
           A G ANGY+YW +W IT+A+E+SV+G++I YW+DAVP+ AW+AIFWVLLTA N  PVK+Y
Sbjct: 153 AFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWY 212

Query: 189 GEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQF 248
           GEFEF +AS+KVIAI+ +L Y L++VCGGS  G IGFRYW++PGPWG G +++ ++ A+F
Sbjct: 213 GEFEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARF 272

Query: 249 LGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLV 308
           LGWV SL+ A+FT+QGTELVG+TAGE  NPR+TVPKAIN VFFRIL+FYIGSL  +GLLV
Sbjct: 273 LGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLV 332

Query: 309 RYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVL 368
            Y+ PQL  + ++    +SPFV++I  AGTKVLPDI N V++VTI+SAGNSN+YVGSRVL
Sbjct: 333 PYNSPQL--ESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVL 390

Query: 369 YGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGF 428
           Y L  SG AP   S  T +GVPY+ V+ T++ G L +L  +  + + F+WL++I+ ++G 
Sbjct: 391 YSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGL 450

Query: 429 FTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP- 487
             W  ISV+HIRFMQCLK RGISRD LPFKAK MP+GAYYAAFFV +I+ +QGFTAF P 
Sbjct: 451 CAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPR 510

Query: 488 FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTL 547
           F   +F   YIS  + VV+++L Q  ++ R+   +                    +P  L
Sbjct: 511 FDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIWEDDEPKNL 570

Query: 548 WGKIWYHLS 556
           W K W  L+
Sbjct: 571 WEKFWVALA 579

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/529 (53%), Positives = 370/529 (69%), Gaps = 5/529 (0%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSD--VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           + +V++H T ++    E+ +  D  VKR LK RH+ M               ++P+ NAG
Sbjct: 82  RLQVVSHET-DINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAG 140

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
           PVGSL+AYIF+ T+ Y VTQSLGEMATFIPVTSS TVF+ RF+SPA G +NGY+YW +W 
Sbjct: 141 PVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA 200

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
           IT+A+E+SVIG++I YW+D VP+ AW+AIFWV++T +N  PVK YGEFEFW+AS+KV+AI
Sbjct: 201 ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAI 260

Query: 204 LCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
           + +L Y L++VCGGS  G IGFRYW++PG WG GI+S +    +FLGWVSSLI AAFT+Q
Sbjct: 261 MGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQ 320

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           GTELVG+TAGE  NPR+TVP+AIN V FRI+LFYI SL  IGLLV Y+D +L    S+  
Sbjct: 321 GTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSA--SSAV 378

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
             +SPFV++I  AGT  LPDI N V+++T++SA NSN+YVGSRVLY L R+G AP     
Sbjct: 379 IASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGY 438

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
            T +GVPY+ V+ T+  G L +L V++ + + F+WL++I+ ++G   WL IS++HIRFMQ
Sbjct: 439 VTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQ 498

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIF 503
            LK RGISRDDLPFKAK MPYGAYYAAFFV VII +QGF AF PF   +F   YIS  + 
Sbjct: 499 ALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLILL 558

Query: 504 VVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
            V+++  Q  +K R+   +                    +P  LW K W
Sbjct: 559 AVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFW 607

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/508 (54%), Positives = 358/508 (70%), Gaps = 2/508 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
               V+R LK RH+ M               ++P+ NAGPVGSL+AYIF+ T+ Y VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSS TVF+ RF+SPA G +NGY+YW +W IT+A+E+SVIG++I YW+  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+  W+AIFWVL+T +N  PVK YGEFEFW+AS+KV+AI+ +L Y LV+VCGGSK G IG
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PG WG GI+S + +  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AIN V FRI+LFYI SL  IGLLV Y DP+L    S+    +SPFV++I  AGT  LPDI
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSA--SSAVIASSPFVISIQNAGTYALPDI 399

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N ++++T+ISA NSN+YVGSRVLY L ++G AP      T +GVPY+ VL+T+  G L 
Sbjct: 400 FNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLA 459

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           +L V++ + + F+WL++I+ ++G   WL IS+SHIRFMQ L +RGISRDDLPFKAKFMPY
Sbjct: 460 FLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPY 519

Query: 465 GAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXX 524
           GAYYA+FFV VII +QGF +F PF   DF   YIS  +  V++   Q  +K R+   +  
Sbjct: 520 GAYYASFFVTVIIFIQGFQSFCPFRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLED 579

Query: 525 XXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                             +P  LW K W
Sbjct: 580 IDIDSDRREIEAIIWEDDEPKNLWEKFW 607

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/508 (54%), Positives = 358/508 (70%), Gaps = 2/508 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
               VKR LK RH+ M               ++P+  AGPVGSL++YIF+ T+ Y +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W IT+A+E+SVIG++I YW+D V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+  W+AIFWVL+T +N  PVK YGEFEFW+AS+KV+AI+ +L Y LV+VCGGS  G IG
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PG WG GI+S + +  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AIN V FRI+LFYI SL  IGLLV Y++P+L    S+    +SPFV++I  AGT  LPDI
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSA--SSAVIASSPFVISIQNAGTYALPDI 400

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N V+++T+ISA NSN+YVGSRVLY L ++G AP      T +GVPY+ VL+T+  G L 
Sbjct: 401 FNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLA 460

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           +L V++ + + F+WL++I+ ++G   WL IS++HIRFMQ L++RGISRDDLPFKAK MPY
Sbjct: 461 FLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPY 520

Query: 465 GAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXX 524
           GAYYAAFFV VII +QGF AF PF   DF   YIS  +  V++   Q  +K R+   +  
Sbjct: 521 GAYYAAFFVTVIIFIQGFQAFCPFKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLED 580

Query: 525 XXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                             +P  LW K W
Sbjct: 581 IDIDTDRREIEAIIWEDDEPKNLWEKFW 608

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/509 (54%), Positives = 360/509 (70%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + ++VKR LK RH+ M               + P+ N+GPVGSL+AY+F+ ++ Y +TQS
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W IT+A+EISV+G++I YW+  V
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW+AIFWV +T +N  PVK YGE EFWIA +KV+AI  +L Y L++VCGGS  G IG
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIG 276

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PGPWG GI+S++ +T++FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+
Sbjct: 277 FRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 336

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AIN V FRI LFYI SL  IGLLV YDDP+L     +    +SPFV++I  AGTK+LPDI
Sbjct: 337 AINKVVFRIALFYIMSLFFIGLLVPYDDPRLSS--DSAVVASSPFVISIQNAGTKILPDI 394

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N ++M+T+ISA NSN+YVGSRVLY L ++G AP   +  T  GVPY+ VL T+  G L 
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           +L V++ + + F+WL++I+ ++G   WL IS+SHIRFMQ LK RGISRDDLPFKAKFMP+
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            AYYA FFV VII +QGF AF+P F    F   YIS  I  V+++  Q  ++ R+F  + 
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLE 574

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                              +P T W K W
Sbjct: 575 DIDIDTDRREIEEVIWEDDEPKTYWDKFW 603

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/564 (50%), Positives = 381/564 (67%), Gaps = 18/564 (3%)

Query: 5   IYEPKGDGSSSSTITAKPGAIKAEVLNHNTS------EVESLCEKPNQSD--VKRELKPR 56
           I E + + S  ++I  K    +   L H  S      E +   E+ +  D  VKRELK R
Sbjct: 32  IIEIQHNDSKDNSIKKKIPNSELASLTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQR 91

Query: 57  HVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTS 116
           H+ M               A+P+ +AGPVG+L+AYIF+ ++ Y VTQ+LGEMATFIPVTS
Sbjct: 92  HIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTS 151

Query: 117 SFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVL 176
           S TVF+ RF+SPA G ANGY+YW +W ITFA+EISV+G++I YW+DAVP+ AW+AIFWVL
Sbjct: 152 SITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVL 211

Query: 177 LTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWG 235
           +T +N  PVK YGE EFW+A +KVIAI+ +L Y L++VCGGS K G IGFRYW++PG WG
Sbjct: 212 VTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWG 271

Query: 236 VGIVSQ------EIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTV 289
            G+ S         +  +FLGWV+SLI AAFT+QGTELVG+TAGE  NPR+TVP+AIN V
Sbjct: 272 NGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKV 331

Query: 290 FFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVI 349
            FRI+LFYI SL  IGLLV + D +L  D  TT   +SPFV++I  AGTK+LPDI N ++
Sbjct: 332 VFRIVLFYIMSLFFIGLLVPFTDSRLSDD--TTVIASSPFVISIENAGTKILPDIFNAIV 389

Query: 350 MVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVS 409
           MVT++SA NSN+YVGSRVLY L  + +AP   +R T +GVP++ V+ TS+ G L +L V 
Sbjct: 390 MVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVD 449

Query: 410 SKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYA 469
           + + + F+WL+ I+ ++G   WL IS++H+RFMQ LK+RGISRDDLPFKAKFMP+G+YYA
Sbjct: 450 NNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYA 509

Query: 470 AFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXX 528
           AF+V VII VQGF AF+P F    F   YIS  +  V+++  Q  ++ R+   +      
Sbjct: 510 AFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDID 569

Query: 529 XXXXXXXXXXXXXXKPTTLWGKIW 552
                         +P T+W K W
Sbjct: 570 SDRREIEDAIWEDDEPKTIWDKFW 593

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/566 (50%), Positives = 375/566 (66%), Gaps = 17/566 (3%)

Query: 2   TNIIYEPKGDGS-SSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSD------------ 48
           TN  Y+   D   S     A  G + ++ L++N S  ++        D            
Sbjct: 32  TNKKYDSDTDMEPSQRKKAAMAGKLFSDQLSYNVSVADNSSAANGDLDLSDTEEAGHVQD 91

Query: 49  --VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLG 106
             VKR LK RH+ M               ++P+ NAGPVG+L+AYIF+ ++ Y +TQSLG
Sbjct: 92  TRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLG 151

Query: 107 EMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPI 166
           EMATFIPVTSS TVF+ RF+SPA G  NGY+YW +W IT+A+EISV+G++I YW+DAVP+
Sbjct: 152 EMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDAVPL 211

Query: 167 TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFR 226
            AW+AIFWV +T +N  PVK YGE EFW+AS+KV+AI+ +L Y LV+VCGGS  G IGFR
Sbjct: 212 AAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSSQGPIGFR 271

Query: 227 YWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAI 286
           YW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+AI
Sbjct: 272 YWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 331

Query: 287 NTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMN 346
           N V FRI LFYI SL  IGLLV Y+D  L    S     +SPFV++I  AGT  LPDI N
Sbjct: 332 NKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYI--ASSPFVISIQNAGTYALPDIFN 389

Query: 347 GVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYL 406
            V+M+TIISA NSN+YVGSRVLY L ++G AP   +  T  GVP++ V+ T+  G L +L
Sbjct: 390 AVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFL 449

Query: 407 NVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGA 466
            V++ + + F+WL++I+ ++G   W  I++SHIRFMQ LK RGISRDDLPFKAK MP+GA
Sbjct: 450 VVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGA 509

Query: 467 YYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXX 526
           YY+AFFV VII +QGF AFTP+    F   YIS  + VV+++  Q  ++ R+   V    
Sbjct: 510 YYSAFFVFVIIFIQGFEAFTPWDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVEDID 569

Query: 527 XXXXXXXXXXXXXXXXKPTTLWGKIW 552
                           +P  LW K W
Sbjct: 570 IDTDRREIEAIIWEDDEPKNLWEKFW 595

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/510 (54%), Positives = 358/510 (70%), Gaps = 3/510 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
            +++VKR LK RH++M               ASP+R AGPVGSLLAYIF+ T+ Y +TQS
Sbjct: 51  QETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQS 110

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W ITFA+E+SV+G++I YW+D V
Sbjct: 111 LGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRV 170

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           PI AW+ IFWVL+T +N  PV+FYGE EFWIAS+KV+ I+ +L Y  ++VCGGSK G IG
Sbjct: 171 PIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIG 230

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQ-FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
                     G    S+       FLGWVSSLIKAAFT+QGTELVG+TAGE+ NPR+ VP
Sbjct: 231 LPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVP 290

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
           KAIN VFFRIL FYIGSLL +GLLV YDDP+L  + S+T+ NASPFV++I  AGTK+LPD
Sbjct: 291 KAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSE-SSTDVNASPFVISIKNAGTKILPD 349

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I N V+++T+ISA NSN+Y+GSRV Y L  +G AP  ++  T +GVPY  VL TS+ G +
Sbjct: 350 IFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLM 409

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L ++  + + FDWL++I+ ++G   WL IS++HIRFMQCLK RGISRDDLPFKAKFMP
Sbjct: 410 SFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMP 469

Query: 464 YGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTV 522
           + AYYA FFV VII +QG+TAFTP F    F   YIS F+ +++++  Q  +K R+   V
Sbjct: 470 WAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAV 529

Query: 523 XXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                               +P  +W K W
Sbjct: 530 EDIDIDSDRREIDAIVWEEDEPKNIWDKFW 559

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/527 (53%), Positives = 367/527 (69%), Gaps = 13/527 (2%)

Query: 37  VESLCEKPNQSD----------VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVG 86
           V ++C+   + D          VKR LK RH+ M               A+P+ NAGPVG
Sbjct: 45  VTNVCDGLEEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVG 104

Query: 87  SLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITF 146
           SL+AY+F+ ++ Y +TQSLGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W IT+
Sbjct: 105 SLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITY 164

Query: 147 ALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCF 206
           A+EISVIG++I +W+ AVP+ AW+AIFWV ++ +N  PVK YGE EFW+AS+KVIAI+ +
Sbjct: 165 AVEISVIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGY 224

Query: 207 LFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTE 266
           L Y LV+VCGGS  G IGFRYW++PGPWG GI+S + +  +FLGWVSSLI AAFT+QGTE
Sbjct: 225 LIYALVIVCGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTE 284

Query: 267 LVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANA 326
           LVG+TAGE  NPR++VP+AIN V FRI++FYI SL  +G+LV ++DP+L  + +     +
Sbjct: 285 LVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVI--AS 342

Query: 327 SPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTS 386
           SPFV++I  AGT+VLP I N V+M+TIISA NSN+YVGSRVLY L ++G AP      T 
Sbjct: 343 SPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTR 402

Query: 387 RGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLK 446
            GVPY+ V+ATS+ G L +L V++ + + F+WL++I+ ++G   WL IS+SHIRFMQ LK
Sbjct: 403 HGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALK 462

Query: 447 KRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVV 505
            RGISRDDLPFKAK MP+GAYYAAFFV VII +QGF AF+P F    F   YIS  I VV
Sbjct: 463 FRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVV 522

Query: 506 IWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
           + +  Q  ++ R+   +                    +P  LW K W
Sbjct: 523 LLIGCQLYYRCRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEKFW 569

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/509 (55%), Positives = 365/509 (71%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
             ++VKR LKPRH+ M               + P++NAGPVG L+AY+F+AT+A+ V QS
Sbjct: 70  RSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQS 129

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMAT+IPVTS+F+VF+ RF+SPA GAANGY+YW SW ITFALE+SVIG+++ YW+  V
Sbjct: 130 LGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKV 189

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW++IFWVL+  +N  PVKFYGEFEFWIA +KV+AI+ F+ Y  ++VCG  K G +G
Sbjct: 190 PVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGPVG 249

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW+    +G GI+S+  + A+FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVPK
Sbjct: 250 FRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPK 309

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           +I    +RIL+FYI SLL +GLLV ++D  L QD S + A +SPF++AI  +GTK LPDI
Sbjct: 310 SIKRTLWRILIFYIFSLLFVGLLVPFNDHGL-QD-SRSYAASSPFILAIKNSGTKALPDI 367

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N VI+ T+ISA NS++YVGSRV+Y + R+ LAP  +++ +  GVPY AVL TS  GAL 
Sbjct: 368 FNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALA 427

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           YL  SS   +VF+WL++IT V+GFF+W LIS SH+RFM+ LK+RGISR+DLPFKA FMP+
Sbjct: 428 YLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPW 487

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
            A Y+ FF+ +IILVQGFT FTP F A DFVA YIS  +F VIW +FQ  F+      + 
Sbjct: 488 IAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIA 547

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                               P TLW K W
Sbjct: 548 EIDIDTDRRDVDAEVWEDEPPKTLWDKFW 576

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/509 (54%), Positives = 362/509 (71%), Gaps = 3/509 (0%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + + VKR LK RH+ M               ++P+ N+GPVG+L+AYIF+ T+ Y VTQS
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGEMATFIPVTSS TVF+ RF+SPA G ANGY+YW +W IT+A+E+SVIG++I YW+  V
Sbjct: 147 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKV 206

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
           P+ AW+ IFWVL+T +N  PVK YGEFEFW+AS+KVIAI+ +L Y L++VCGGS  G IG
Sbjct: 207 PLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIG 266

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
           FRYW++PG  G GI+S ++  A+FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+
Sbjct: 267 FRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 326

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           AIN V FRI+LFYI SL  +GLLV Y+DP+L    S+    +SPFV++I  AGTKVLPDI
Sbjct: 327 AINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSA--SSAVIASSPFVISIQNAGTKVLPDI 384

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
            N V++VT+ISA NSN+YVGSRVLY L +SG AP   +  T  GVPY+ V+ T++ G L 
Sbjct: 385 FNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLA 444

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           +L V+  + + F+WL++I+ ++G   WL IS++HIRFMQ LK RGISRDDLPFKAKFMP+
Sbjct: 445 FLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPW 504

Query: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVX 523
           GAYYA+FFV VII +QGF AF P F   +F   YIS  + VV++   Q  ++ R+   + 
Sbjct: 505 GAYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLE 564

Query: 524 XXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                              +P  LW K W
Sbjct: 565 DIDIDSDRREIDAIVWEDDEPQNLWEKFW 593

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/529 (51%), Positives = 370/529 (69%), Gaps = 10/529 (1%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           I ++  +H  +E +        + VKR LKPRH+ M               + P++ +GP
Sbjct: 85  ISSDEYDHQEAEFK-------DTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGP 137

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
           VGSL+AYIF+ T+ Y VTQ+LGEMATFIPVTSS TVF+SRF+SPA G +NGYLYW +W I
Sbjct: 138 VGSLIAYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAI 197

Query: 145 TFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
           T+A+EISV+G++I +W+  VP+ AW++IFWVL+TA+N  PV  YGE EFW+AS+KV+AI+
Sbjct: 198 TYAVEISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIV 257

Query: 205 CFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQG 264
            +L Y LV+VCGGSK G IGFRYW+     G G++S++ + A+FLGWV+SLI AAFT+QG
Sbjct: 258 GYLIYALVIVCGGSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQG 317

Query: 265 TELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNA 324
           TELVG+TAGE  NPR++VP+AIN V FRI++FYI SL  IGLLV Y+DP+L  + +T+  
Sbjct: 318 TELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKL--NSATSYI 375

Query: 325 NASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRT 384
            +SPFV++I  AGT+ LP I N +IM+TIISA NSN+YV SRVLY L  SG AP   +R 
Sbjct: 376 ASSPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARV 435

Query: 385 TSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQC 444
           T +GVP++ V+ T++ G L +L V++ +   F+WL++I+ ++G   WL IS+SH+RFM+ 
Sbjct: 436 TPQGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEA 495

Query: 445 LKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIF 503
           LK RGISRDDLPFKA+FMPYG+YYA FF+ VII +QGFTAF+P F    F   YIS  + 
Sbjct: 496 LKYRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILL 555

Query: 504 VVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
            V+++  Q  ++ R+F  V                    +P T W K W
Sbjct: 556 AVLFIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTAWDKFW 604

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/547 (51%), Positives = 372/547 (68%), Gaps = 10/547 (1%)

Query: 13  SSSSTITAKPGAIKAEVLNHNTSE------VESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           S+ + + +  G++    LN    +       + L  + +++ VKR LK RH+ M      
Sbjct: 50  STQADVHSVTGSLTRSRLNSRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGT 109

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                    ++P+  AGPVGSL+AYIF+ T+ Y VTQSLGEMATFIPVTSS TVF+ RF+
Sbjct: 110 IGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFL 169

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVK 186
           SPA G ANGY+YW +W IT+A+EISVIG++I YW+ AVP+ AW+AIFWVL+T +N  PVK
Sbjct: 170 SPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVK 229

Query: 187 FYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTA 246
            YGE EFWIA +KV+AI+ +L Y LV+VCGGS  G IGFRYW+ PG +G GI+S+  +T 
Sbjct: 230 VYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTG 289

Query: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306
           +FLGWV+SLI AAFT+QGTELVG+TAGE  NPR+TVP+AIN V FRI+LFYI SL  IG+
Sbjct: 290 KFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGM 349

Query: 307 LVRYDDPQL-IQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGS 365
           L+ Y+D +L  QD       +SPFV++I  A TKVLPDI N V+MVT++SA NSN+YVGS
Sbjct: 350 LLPYNDKRLSAQDAVIA---SSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGS 406

Query: 366 RVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAV 425
           RVLY L  +G AP   S  T  GVPY+ V+ T+  G L +L V++ + + F+WL++I+ +
Sbjct: 407 RVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTL 466

Query: 426 SGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF 485
           +G   WL IS++HIRFMQ LK RGISRDDLPFKAK MP+GAYYAAFFV VII +QG+ AF
Sbjct: 467 AGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAF 526

Query: 486 TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVXXXXXXXXXXXXXXXXXXXXKPT 545
            P+    F   YIS  +  V+ +  Q  ++GR+   +                    +P 
Sbjct: 527 CPWDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPK 586

Query: 546 TLWGKIW 552
           TLW K W
Sbjct: 587 TLWDKFW 593

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  521 bits (1341), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 262/510 (51%), Positives = 343/510 (67%), Gaps = 2/510 (0%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           K + + VKR LKPRH+ M               + P+  +GPVGSL+AYIF+ ++ Y VT
Sbjct: 96  KFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVT 155

Query: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSD 162
           QSLGEMATFIPVTSS TVF  RF+SPALG +NGY+YW +W ITFA E+SV G++I YW+ 
Sbjct: 156 QSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTY 215

Query: 163 AVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR 222
            VP+ AW+ IFWV++  +N  PVK YGE EFW++S+KV+AI+ +L Y LV+VCGGS+ G 
Sbjct: 216 KVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQGP 275

Query: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           IGFRYW+    +G G +S+    A+FLGWVSSLI AAFT+QGTELVG++AGE  NPR+TV
Sbjct: 276 IGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKTV 335

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLP 342
           P+AIN V FRI LFYI SL  IGLLV Y+D +L  DGS   A +SPFV+++  AGT  LP
Sbjct: 336 PRAINKVIFRIALFYILSLFFIGLLVPYNDKRL-SDGSAIIA-SSPFVISMLNAGTSALP 393

Query: 343 DIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGA 402
           DI N VI++T++SA NS++Y+ SRVLY L   G AP   +     GVPY+ V  T + G 
Sbjct: 394 DIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGW 453

Query: 403 LGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFM 462
           L +L VS+ + + F+WL++I+ ++G   W  I  +HIRFMQ LK +GISRDDLPFKA+FM
Sbjct: 454 LAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFM 513

Query: 463 PYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTV 522
           P+GAYYAAFFV +II +QG+ AFTP+    F   YIS  +F V++L     ++GR    +
Sbjct: 514 PWGAYYAAFFVGLIIFIQGYDAFTPWDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIKI 573

Query: 523 XXXXXXXXXXXXXXXXXXXXKPTTLWGKIW 552
                                P   W K W
Sbjct: 574 EDIDIDTDRKEVEAYVWEEDAPRNWWEKFW 603

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 292/510 (57%), Gaps = 32/510 (6%)

Query: 31  NHNTSEVESLCEKPNQSDV------------------KRELKPRHVTMXXXXXXXXXXXX 72
           N  + +VE+L +  NQ D+                  K+EL+ RHV+M            
Sbjct: 20  NTTSKDVENL-DLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLL 78

Query: 73  XXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGA 132
               + +  AGPV  L+AY FV  + Y V   LGEMAT+IP+   FT +ASR+  PALG 
Sbjct: 79  IGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGF 137

Query: 133 ANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWMAIFWVLLTAINLIPVKFYGE 190
           A GY Y   + I    +++    ++ YW   + V    W+ IF V++  IN++ VKF+GE
Sbjct: 138 AVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGE 197

Query: 191 FEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPG---PWGVGIVSQEIHTA 246
           FEFW++S KV+ +LC +    V++ GG     R+GFR++KDPG   P+   I   +    
Sbjct: 198 FEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSK---G 254

Query: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306
           +F+ +V+  + A F + GTEL G+ A E KNPRR VP+AI    +RI++FY+ ++ ++G+
Sbjct: 255 KFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGM 314

Query: 307 LVRYDDPQLIQ-DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGS 365
            V Y+DP L+Q    +T+A ASPFVVAI  AG  VLP I N  +++ + SA NS++YV S
Sbjct: 315 TVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVAS 374

Query: 366 RVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAV 425
           R LYGL     AP   ++T   GVPY +++   +F  L Y+NVSS S  VF++ +++ ++
Sbjct: 375 RSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSI 434

Query: 426 SGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF 485
            G  +W+ I +++I F + L+ +G+ +  L + A     GAY+A FF  +I L++ FT F
Sbjct: 435 FGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVF 494

Query: 486 --TPFSAVDFVAYYISAFIFVVIWLLFQFL 513
               F   +F+  YI   +F++ +  ++++
Sbjct: 495 LGHKFDYKNFITGYIGIPVFIICFFGYKYI 524

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/532 (35%), Positives = 296/532 (55%), Gaps = 33/532 (6%)

Query: 8   PKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDV---------------KRE 52
           PKGD +    +TA   A+  EV +  +S+  SLC+  + SDV               K++
Sbjct: 15  PKGDNAKE--VTASKLALNIEVQSDQSSK--SLCD--SASDVLASEIGDGKYEGIRLKKQ 68

Query: 53  LKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFI 112
           LK RH++M                  ++ AGPV +L+AY FV  M +     LGEMATFI
Sbjct: 69  LKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFI 128

Query: 113 PVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWM 170
           P+   FT +ASR+  PALG A GY Y + + I    +++    ++ YW   D V    W+
Sbjct: 129 PL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWV 187

Query: 171 AIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWK 229
            + + ++T IN+  V+F+GEFEFW++SLKV+ ++  +    V++ GG+    R+GFRYWK
Sbjct: 188 TLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWK 247

Query: 230 DPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTV 289
            PG +            +F+ +V+ L+   F + G EL G+ A E  NPRR+VPKAI   
Sbjct: 248 HPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLT 307

Query: 290 FFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNAN---ASPFVVAINAAGTKVLPDIMN 346
           F+RIL+FY+ S+ ++G+ V Y+D +L+    TTN N   ASPF +AI  AG  VLPDI N
Sbjct: 308 FYRILVFYVVSIFLLGMCVPYNDEKLV----TTNENSLTASPFSIAILNAGITVLPDIFN 363

Query: 347 GVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYL 406
           G +++ + SA NS++YV SR LY L     AP   + T   G+PY ++  + +F  L Y+
Sbjct: 364 GCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYM 423

Query: 407 NVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGA 466
            VSS S  VF + +++ +++G  TW+ I +++I F + ++ + + +    + A F PYGA
Sbjct: 424 TVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGA 483

Query: 467 YYAAFFVIVIILVQGFTAFT-PFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           Y + FF  +I +++ FT F   F    F+  YI   IFV+ +  ++   K  
Sbjct: 484 YVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSE 535

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/486 (36%), Positives = 283/486 (58%), Gaps = 14/486 (2%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           K + + +K++LK RH++M                + +R AGP   L+AY FV T+ +   
Sbjct: 76  KDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTM 135

Query: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160
            +LGEMA +IP+   FT +ASR+  PALG A GY Y   + I    +++    +I YW  
Sbjct: 136 AALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVD 194

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV---IAILCFLFYGLVVVCGG 217
            D V    W+ IF V++ AIN I VK++GEFEFW++S K+   I ++ FLF  ++++ GG
Sbjct: 195 RDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLF--VIMLGGG 252

Query: 218 SKLGRIGFRYWKDPG---PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGE 274
               R+GFRYWK PG   P+   +V+ E  T +F+ +V+  + A F + G EL G+ A E
Sbjct: 253 PNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAE 312

Query: 275 TKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANA-SPFVVAI 333
            +NPRR +P+AI    +RIL FY+ ++ ++G+ V YDDP L+   +   + A SPFVVAI
Sbjct: 313 AENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAI 372

Query: 334 NAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVA 393
             +G  VLP I N  +++ + SA NS++YVG+R LY L   G AP   ++T   GVPY A
Sbjct: 373 QNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNA 432

Query: 394 VLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRD 453
           +    +F  L Y+NVSS S  +F++ +++ ++ G  +W  I ++ I F + ++ +GI R 
Sbjct: 433 MGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRS 492

Query: 454 DLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQ 511
              + A F PYG+Y+A FF +++ L++ F+ F    F    F+  YI   ++   ++ ++
Sbjct: 493 TFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 512 FLFKGR 517
             +K +
Sbjct: 553 LYYKTK 558

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 174/481 (36%), Positives = 282/481 (58%), Gaps = 7/481 (1%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           K   + +K+ELK RH++M                + +   GPV  L+AY FV  + +   
Sbjct: 74  KDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTM 133

Query: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160
             LGEMA++IP+   FT +ASR+V PALG A GY Y   + I    +++    +I YW  
Sbjct: 134 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV-IAILCFLFYGLVVVCGGSK 219
            D V    W+ IF V++ AIN++ VKF+GEFEFW++S KV + +   L   ++++ GG  
Sbjct: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPD 252

Query: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
             R+GFRYW+DPG +     +    T +F  +V+  + + F++ G EL G+   E +NPR
Sbjct: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGT 338
           ++VPKAI    +RI++FY+ ++ ++G+ V Y+DP+L+   G + +A ASPFVVAI  +G 
Sbjct: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           KVLP I N  ++V + SA NS++YV SR LY L   G AP   ++T+  GVPY A++ + 
Sbjct: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
           +F  L Y+NVSS S  +F++ +++ ++ G  +W+ I + +I F +  + +GI +    + 
Sbjct: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516
           A    YGAY+A  F I+I L++ FT F    F    F+  YI   ++++ W  ++ ++K 
Sbjct: 493 APGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552

Query: 517 R 517
           +
Sbjct: 553 K 553

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/481 (35%), Positives = 282/481 (58%), Gaps = 7/481 (1%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           K   + ++++LK RH++M                + +   GPV  L+AY FV  + +   
Sbjct: 74  KDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTM 133

Query: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160
             LGEMA++IP+   FT +ASR+V PALG A GY Y   + I    +++    +I YW  
Sbjct: 134 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVS 192

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV-IAILCFLFYGLVVVCGGSK 219
            D V    W+ IF V++ AIN++ V+F+GEFEFW++S KV + +   L   ++++ GG  
Sbjct: 193 RDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPD 252

Query: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
             R+GFRYW+DPG +     +      +F+ + S  + + F++ G EL G+   E KNPR
Sbjct: 253 HDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPR 312

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGT 338
           ++VPKAI    +RI++FY+ ++ ++G+ V Y+DP+L+   G   +A ASPFVVAI  +G 
Sbjct: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGI 372

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           KVLP I NG ++V + SA NS++YV SR LY L   G AP   ++T+  GVPY A++ + 
Sbjct: 373 KVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSV 432

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
           +F  L Y+NVS+ S  +F++ +++ ++ G  +W+ I + +I F +  + +G+ +    + 
Sbjct: 433 LFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYV 492

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516
           A    YGAY+A FF I+I L++ FT F    F    F+  YI   I+V  W+ ++ ++K 
Sbjct: 493 APGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKT 552

Query: 517 R 517
           +
Sbjct: 553 K 553

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  322 bits (826), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/481 (35%), Positives = 283/481 (58%), Gaps = 8/481 (1%)

Query: 44  PNQSD-VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           P  +D +K+ L+ RHV+M                + +  AGP    +AY FV  + +   
Sbjct: 93  PKHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTM 152

Query: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160
            ++GEMA++IP+   FT +ASR+V PALG A GY Y   + I    +++    +I YW  
Sbjct: 153 AAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219
            D V    W+ IF V++  IN+  VKF+GEFEFW++S KV+ +L  +    +++ GG   
Sbjct: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPD 271

Query: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
             R+GFRYW+ PG +     + +    +F+ +VS  + A F + G EL G+ A E  NPR
Sbjct: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGT 338
           ++VP+A+    +RI++FY+ ++ ++G+ V Y+DP+L+   G+ T+A ASPFVVAI  +G 
Sbjct: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGI 391

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           +VLP I N  +++ + SA NS++YVGSR LY L   G APA   RTTS G+P+ ++    
Sbjct: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
           +F  L Y+NVSS S  VF++ +++ ++ G  +W+ I +++I FM+ +K +G+ R    + 
Sbjct: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516
           A F PYG Y++  + + I  ++ FT F    F   +F+  YI   +FV+ +  ++F+ K 
Sbjct: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571

Query: 517 R 517
           +
Sbjct: 572 K 572

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  321 bits (822), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/481 (35%), Positives = 283/481 (58%), Gaps = 7/481 (1%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           K   + ++++LK RH++M                + +   GPV  L+AY FV  + +   
Sbjct: 76  KDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTM 135

Query: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160
             LGEMA++IP+   FT +ASR+V PALG A GY Y   + I    +++    +I YW  
Sbjct: 136 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV-IAILCFLFYGLVVVCGGSK 219
            D V    W+ IF V++ AIN++ VKF+GEFEFW++S KV + +   L   ++++ GG  
Sbjct: 195 RDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPN 254

Query: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
             R+GFRYW+DPG +     +      +F+ +V+  + + F++ G EL G+   E +NPR
Sbjct: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGT 338
           ++VPKAI    +RI++FY+ ++ ++G+ V Y+DP+L+   G + +A ASPFVVAI  +G 
Sbjct: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           +VLP I N  ++V + SA NS++YV SR LY L   G AP   ++T+  GVPY A++ + 
Sbjct: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
           +F  L Y+NVSS S  +F++ +++ ++ G  +W+ I + +I F +  + +GI +    + 
Sbjct: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516
           A    YGAY+A FF I+I L++ FT F    F    F+  YI   ++++ W  ++ ++K 
Sbjct: 495 APGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554

Query: 517 R 517
           +
Sbjct: 555 K 555

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  318 bits (815), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/525 (32%), Positives = 290/525 (55%), Gaps = 25/525 (4%)

Query: 14  SSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSD-------------VKRELKPRHVTM 60
           S   +T     I+ ++++   +   SL     + D             +K+ELK RH++M
Sbjct: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISM 61

Query: 61  XXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV 120
                           + +R  GP   L+AY FV  + + V   LGEMAT+IP+   FT 
Sbjct: 62  IAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTS 120

Query: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPIT--AWMAIFWVLLT 178
           +A+R+  PALG A GY Y   + I    +++    +I YW D   +    W+ IF V++ 
Sbjct: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180

Query: 179 AINLIPVKFYGEFEFWIASLKVIAIL-CFLFYGLVVVCGGSKLGRIGFRYWKDPG---PW 234
            IN + V+++GEFEFW++S K++ +    LF  ++++ GG    R+GFRYWK+PG   P+
Sbjct: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240

Query: 235 GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRIL 294
              I   +    +F+ +V+  + A F + G EL G+ A E +NPRR +P+AI    +RI+
Sbjct: 241 SESITGSK---GKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297

Query: 295 LFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVLPDIMNGVIMVTI 353
           LFYI ++ ++G+ V Y+DP+L+     + + A+ PFVVAI  +G + LP I N  +++ +
Sbjct: 298 LFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFV 357

Query: 354 ISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSG 413
            SA NS++YVG+R LY L   G AP   ++T   GVPY A+    +F  L Y+NVSS S 
Sbjct: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSA 417

Query: 414 SVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFV 473
            +F++ +++ ++ G  +W+ I +++I F +    + + R+   ++A F PYGAY   FF 
Sbjct: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFC 477

Query: 474 IVIILVQGFTAFT-PFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           ++I  ++ FT F   F    F+  YI   ++V+ +  ++ ++K +
Sbjct: 478 VLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK 522

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  318 bits (815), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/478 (35%), Positives = 278/478 (58%), Gaps = 10/478 (2%)

Query: 49  VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108
           +K+ LK RHV+M                + +  AGP    + Y FV  + +     LGEM
Sbjct: 64  LKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEM 123

Query: 109 ATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPIT- 167
           A FIP+   FT +ASR+V PALG A GY Y   + I  A +++    ++ YW D   +  
Sbjct: 124 AAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNP 182

Query: 168 -AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGF 225
             ++ IF +L+  IN+  VK +GEFEFW++S KV+ +L  +    +++ GG     R+GF
Sbjct: 183 GVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGF 242

Query: 226 RYWKDPG---PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           RYW+DPG   P+   I+S    T +F+ + S  + A F + G EL G+ A E +NPR+ +
Sbjct: 243 RYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNI 302

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGTKVL 341
           PKAI    +RI++FY+ ++L++ + V Y+DP L++  G +T+A ASPFVVAI  +G  +L
Sbjct: 303 PKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINIL 362

Query: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401
           P I N  ++  ++SA NS++YV SR LY L     AP F  +T   G+PY ++  ++ F 
Sbjct: 363 PHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFS 422

Query: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461
            L Y+NVSS + +VF++ ++  ++ G  +W+ I V++I F +  K +G+ + +  + A +
Sbjct: 423 CLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPW 482

Query: 462 MPYGAYYAAFFVIVIILVQGFTAFT--PFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
            PYGAY+A FF  V+ LV+ FT F    F   +F+  YI   +F + ++ ++ ++K +
Sbjct: 483 QPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTK 540

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/521 (34%), Positives = 289/521 (55%), Gaps = 16/521 (3%)

Query: 3   NIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXX 62
           NI  E     S SST T+      +  +     E   L         +++LK RH++M  
Sbjct: 44  NIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRL---------RKDLKARHISMIA 94

Query: 63  XXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFA 122
                         + +   GPV  L+AY FV  + +     LGEMA++IP+   FT +A
Sbjct: 95  IGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYA 153

Query: 123 SRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWMAIFWVLLTAI 180
           SR+V PALG A GY Y   + I    +++    +I YW   D V    W+ IF V++ AI
Sbjct: 154 SRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAI 213

Query: 181 NLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVC-GGSKLGRIGFRYWKDPGPWGVGIV 239
           N+I VKF+GEFEFW++S KV+ +L  +    +++  GG    R+GFRYW+DPG +     
Sbjct: 214 NVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSA 273

Query: 240 SQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIG 299
           +      +F+ +++  + + F++ G EL G+   E +NPR++VPKAI    +RI++FY+ 
Sbjct: 274 AIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLC 333

Query: 300 SLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN 358
           ++ ++G+ V Y+DP+LI   G   +A ASPFVVAI  +G KVLP I N  ++V + SA N
Sbjct: 334 TVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACN 393

Query: 359 SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW 418
           S++YV SR LY L   G AP   S+T   GVPY A++ + +F  L Y+NVS+ S  +F++
Sbjct: 394 SDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNY 453

Query: 419 LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL 478
            +++ ++ G  +W+ I + +I F +  + +GI +    + A    YGAY+A  F I I L
Sbjct: 454 FVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIAL 513

Query: 479 VQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           ++ FT F    F    F+  YI   ++V  W+ ++ ++K +
Sbjct: 514 IKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTK 554

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  315 bits (806), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 174/482 (36%), Positives = 284/482 (58%), Gaps = 11/482 (2%)

Query: 49  VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108
           +K++L+ RHV+M                S +  AGP+  L+AY  +  + + V   LGEM
Sbjct: 58  LKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGEM 117

Query: 109 ATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPI 166
           A +IP+   FT +A+R+  PALG A GY Y   + +    +++    ++ YW     V  
Sbjct: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176

Query: 167 TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFL-FYGLVVVCGGSKLGRIGF 225
             W+ +F  ++  IN++ VKF+GEFEFW++S KV+ +LC +    ++V+ GG    R+GF
Sbjct: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNRLGF 236

Query: 226 RYWKDPG---PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           RYWKDPG   P+  G VS      +F+ + S  + A F + GTEL G+ A E KNPRR V
Sbjct: 237 RYWKDPGGFKPYS-GAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGTKVL 341
           P+AI    +RI++FY+ ++ ++GL V Y+DP L+Q   + T+A ASP+VVAI  AG  VL
Sbjct: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIPVL 355

Query: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401
           P I N  ++  + SA NS++YVGSR LYGL     AP   ++T S GVPY ++   ++F 
Sbjct: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415

Query: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461
            L Y+NVSS + ++F + +++T++ G  +W+ I +++I F +  + +GI ++ L ++A F
Sbjct: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475

Query: 462 MPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWF 519
            P  A+ A  F +++ LV+ FT F    F    F+  YI   ++++ ++ ++ + K +W 
Sbjct: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535

Query: 520 HT 521
            +
Sbjct: 536 KS 537

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  315 bits (808), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 167/481 (34%), Positives = 278/481 (57%), Gaps = 7/481 (1%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           K   + ++++LK RH++M                + +  AGP+   +AY FV  + +   
Sbjct: 80  KDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTM 139

Query: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSD 162
            +LGEMA++IP+   FT +ASR+  PALG A GY Y   + I    +++    +I YW D
Sbjct: 140 AALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD 198

Query: 163 AVPIT--AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL 220
              +    W+ IF V++ A+N I VKF+GEFEFW+++ KVI ++  +    V++ GG   
Sbjct: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258

Query: 221 -GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
             R+GFR++  PG +     S +    +F+ +V+ L+ A F + G EL G+ A E  NPR
Sbjct: 259 HDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPR 318

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGT 338
           +++PKAI    +RI++FY+ ++ ++G+ V YDDP L +   S T A ASP+VVAI  +G 
Sbjct: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGI 378

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           K LP I N  +++ + SA NS++YV SR LYGL     AP   + T   GVPY ++L +S
Sbjct: 379 KALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSS 438

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
            F  L Y++VSS S  +F++ +++ ++ G  +W+ I ++++ F + +K + + R    ++
Sbjct: 439 CFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYR 498

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516
           A F PYG+Y+   F I+I  ++ FT F    F   +F+  YI   +FV+ +  ++F+ K 
Sbjct: 499 APFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT 558

Query: 517 R 517
           +
Sbjct: 559 K 559

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  312 bits (800), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 168/502 (33%), Positives = 276/502 (54%), Gaps = 10/502 (1%)

Query: 21  KPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIR 80
           K G +  E       E ES        ++ RELKPR V++                S + 
Sbjct: 4   KKGTVVLERPASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALA 63

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWL 140
             GP+   +AY+F  ++   V  SL EMA+F P+   F+ + +R+V PA G A G+ Y+L
Sbjct: 64  KGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFL 123

Query: 141 SWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV 200
            + I  +  ++  G +I YW   V +  W+ + +V +  +N + VK++GE E  +   K+
Sbjct: 124 KYAIVLSANLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKL 183

Query: 201 IAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPG--PWGVGIVSQEIHTAQFLGWVSSLIK 257
           + ++      L++ CGG+      GFRYW++ G  P+ VG       T +FLGW + +++
Sbjct: 184 LVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGG-----GTGKFLGWWACVVQ 238

Query: 258 AAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ 317
           + F F G+E++G+  GET NP++T+PK+   VFFRI   Y+  + ++GL +   + +L+ 
Sbjct: 239 SIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVH 298

Query: 318 DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLA 377
             ST +ANASPFV+AI+++G KVLP+ +N  ++V IIS+ N++IY+ SR LYGL + G A
Sbjct: 299 AHST-DANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAA 357

Query: 378 PAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVS 437
           P          VP V  +  S+ G L Y+N    + +VF ++ S  +V G   W  I ++
Sbjct: 358 PKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIA 417

Query: 438 HIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF-TPFSAVDFVAY 496
           +I + + +K +GIS DD+PF+  F PY AY   FFV +I    G+ AF   F    F+  
Sbjct: 418 YINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITS 477

Query: 497 YISAFIFVVIWLLFQFLFKGRW 518
           YI  F  +++ + ++  FK ++
Sbjct: 478 YIGVFANILMVIGYKLYFKTKF 499

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  314 bits (804), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 192/534 (35%), Positives = 291/534 (54%), Gaps = 23/534 (4%)

Query: 1   MTNIIYEPKG-DGSSSSTITA-------KPGAIKAEV--LNHNTSEVESLCEKPNQSDVK 50
           + NI  EP   D S  S+  A       K    +AE   L+ N +E E +  K  QS +K
Sbjct: 21  VENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEMELDPNLTEAERIAIKTAQSPLK 80

Query: 51  RELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMAT 110
             LK RH+ M                + +R AGP G L+ +    TM Y +  ++GE+A 
Sbjct: 81  HHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAV 140

Query: 111 FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAW 169
             PV   FT +A+RFV  + G A  ++Y L W +   LEI      + YW +D      +
Sbjct: 141 VFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGF 200

Query: 170 MAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-IGFRYW 228
           +A+F+V++  IN+  VK YGE EF  + +KVI ++ F+   +V++CGG K  + IG +YW
Sbjct: 201 VALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYW 260

Query: 229 KDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINT 288
            +PG + VG  + +    QF G+ +  + AAF+F G+ELVG+   E + PR++VP A   
Sbjct: 261 YNPGAF-VGDTAGQ----QFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQ 315

Query: 289 VFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGV 348
           VF+RI LFYI  LL+IG+LV  D P+LI   S+ +A ASPFV+AI   G K LP ++N V
Sbjct: 316 VFWRITLFYILCLLLIGMLVPSDSPRLI-GASSVDAAASPFVIAIVNHGIKGLPSVVNVV 374

Query: 349 IMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNV 408
           I++ ++S GNS IY  SR L  L   G  P+        G P V +  ++ FG + ++  
Sbjct: 375 ILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQ 434

Query: 409 SSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYY 468
           S K G VF+WL++++ +S  FTW  I + HIR+   L  +G S D+LPF+A    +G+Y+
Sbjct: 435 SKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYW 494

Query: 469 AAFFVIVIILVQGFTAFTP----FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
             F  I++ + Q +    P     +A DF   Y+S  IF+ ++  F  ++K  W
Sbjct: 495 GFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALY-AFHKIWKRNW 547

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  312 bits (800), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 183/520 (35%), Positives = 293/520 (56%), Gaps = 13/520 (2%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           E K  G   S  T + G +  E      S  E +  K     +K+EL+ RHV+M      
Sbjct: 8   EKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGS 67

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                     S + +AGPV  L++Y FV  + Y V   LGEMA FIP+   FT +ASR+V
Sbjct: 68  LGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYV 126

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWMAIFWVLLTAINLIP 184
            PA+G A GY Y   + I    +++    ++ +W   D V    W+ IF  L+  IN + 
Sbjct: 127 DPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVG 186

Query: 185 VKFYGEFEFWIASLKVIAILCFLFYGLVVVC-GGSKLGRIGFRYWKDPG---PWGVGIVS 240
           V+F+GEFEFW++S+KV+ +L  +    +++  GG    R GFR+W+DPG   P+   I  
Sbjct: 187 VRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISG 246

Query: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
            +    +F+ + S    A F + GTEL G+ A E KNPRR+VP+AI    +RI++FY+ +
Sbjct: 247 SK---GKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303

Query: 301 LLVIGLLVRYDDPQLIQDGS-TTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNS 359
           +L++G+ V Y+DP+L++     T+A ASPFVVAI  A   VLP I N  ++V + SA NS
Sbjct: 304 ILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363

Query: 360 NIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWL 419
           ++YV SR LYGL   G AP   + T   GVPY ++  + +F  L Y+NVSS S  VF++ 
Sbjct: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423

Query: 420 LSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILV 479
           +++ ++ G  +W+ I +++IRF + ++ +   +  L + A F P+  Y A FF  +I L+
Sbjct: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483

Query: 480 QGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           + +T F    F    F++ YI   ++++ ++ ++ +++ +
Sbjct: 484 KNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTK 523

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  312 bits (800), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 186/524 (35%), Positives = 281/524 (53%), Gaps = 15/524 (2%)

Query: 3   NIIYEPKGDGSSSSTITAKPGAIKAEV--LNHNTSEVESLCEKPNQSDVKRELKPRHVTM 60
           N I E +     S     K    +AEV  L+ N +E E +     +S ++ +LK RH+ M
Sbjct: 36  NYIDEEEQGPPDSRWKKIKDSFKRAEVPELDPNLTEAEKIAIATARSPLQHQLKNRHLQM 95

Query: 61  XXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV 120
                           + +R AGP G L+ +I   +M YC+  S+ E+A   PV   FT 
Sbjct: 96  ISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAELAIAFPVAGGFTT 155

Query: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTA 179
           +A+RF+  + G AN + Y L W +T  LEI      + YW +D      ++A+FWV++  
Sbjct: 156 YATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRDGFVALFWVVIVI 215

Query: 180 INLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGI 238
           IN+  V+ YGE EF  +  K++ I+ F+   ++++CGG         RYW  PG +    
Sbjct: 216 INMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGARYWYHPGAF---- 271

Query: 239 VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI 298
            + +    +F G+ S  + AAF+F G+ELVG+ A E  NPR+ VP A   VF+RI +FY+
Sbjct: 272 -AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVFWRITMFYV 330

Query: 299 GSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN 358
             LL+IG+LV Y DP+LI  GS+ +A ASPFV+AI   G   LP ++N VI++ ++S GN
Sbjct: 331 LCLLLIGMLVPYTDPRLI-GGSSVDAAASPFVIAIKNQGISGLPTLVNVVILIAVLSVGN 389

Query: 359 SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW 418
           S +Y  SR L  L   G  P   S     G P V +  TS FG + ++  S K G VFDW
Sbjct: 390 SAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDW 449

Query: 419 LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL 478
           L++++ +S  FTW  I + HIRF + L  +G S ++L F +    +GA +  F  I+++ 
Sbjct: 450 LMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLFLCIIMLA 509

Query: 479 VQGFTAFTPF----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
            Q + A  P     SA DF   Y+S  I + +WL  + ++K  W
Sbjct: 510 AQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHK-IWKKNW 552

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  312 bits (799), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/490 (36%), Positives = 273/490 (55%), Gaps = 12/490 (2%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           ++   L+ N +E E +      + +K  LK RH+ M                + +R AGP
Sbjct: 65  VEVPELDPNLTEQERIAIITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGP 124

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
              ++ +    +M Y +  ++ EMA   P++  FT +A+RF+  + G AN + Y L W +
Sbjct: 125 ASLIIGWSITGSMIYSMVMAVAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLV 184

Query: 145 TFALEISVIGRLILYWSDAVPI-TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
              LEI      + YW         ++A+FW+++  INL  VK YGE EF  +++KVI +
Sbjct: 185 VLPLEIVSASITVNYWGTPTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITV 244

Query: 204 LCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
           + F+  GLV+VCGG   G     +YW DPG + VG  +     AQF G+ S  + AAF+F
Sbjct: 245 VGFIILGLVLVCGGGPTGGYVGAKYWHDPGAF-VGATA----GAQFQGFCSVFVTAAFSF 299

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            G+EL+G+   E +NPR+ VP A   VF+RILLFYI SLL IGLLV  +D +LI   S  
Sbjct: 300 SGSELIGIAGSEAENPRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLI-GSSNV 358

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
           +A ASPFV+AI   G + LP ++N VI++ ++S GNS IY  SR L  L   G  P  +S
Sbjct: 359 DAAASPFVIAITVHGIRGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVS 418

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
                G P V +  +S FG + ++  S K G VF+WLL+I+ +S FFTW  I + HIRF 
Sbjct: 419 YIDRSGRPLVGIAISSFFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFR 478

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYI 498
             LK +  S D+LPF +    +G+Y+  F +++++  Q + A  P     SA +F + Y+
Sbjct: 479 AALKAQNRSTDELPFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYL 538

Query: 499 SAFIFVVIWL 508
           S  + +V+++
Sbjct: 539 SLPVVLVMYI 548

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  310 bits (795), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 184/513 (35%), Positives = 278/513 (54%), Gaps = 20/513 (3%)

Query: 11  DGSSSSTITAKPGAI---KAEVLNH-NTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           D   +S +  + G +     E L+  NT   ES   +P+   +K+ L+ RH+ +      
Sbjct: 9   DAGQTSIVDKQTGQVFELDTESLSALNTGGSESQKREPHT--LKQGLQSRHIQLIALGGV 66

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTS-----SFTVF 121
                    +S +   GP G L +YI ++ + Y V  +LGEM  ++P +      S +  
Sbjct: 67  IGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKL 126

Query: 122 ASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAIN 181
            SR+  P+LG A G+ Y+  + I  A E +    ++ YW+  VP  AW+ IF  ++T +N
Sbjct: 127 VSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLN 186

Query: 182 LIPVKFYGEFEFWIASLKVIAILCFLFYGLVVV-CGGSKLGRIGFRYWKDPGPWGVGIVS 240
             PVKFYGE EFW A LK++ I+  LF   ++   GG    R+GFRYW+ PG +   I +
Sbjct: 187 FGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITT 246

Query: 241 QEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIG 299
              +T +FL   + +IK  F F  G ELV VT+ E  + RR + KA     +R++ FY+ 
Sbjct: 247 G--NTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVA 304

Query: 300 SLLVIGLLVRYDDPQLIQDGSTTNANA--SPFVVAINAAGTKVLPDIMNGVIMVTIISAG 357
           S L IG++V  +DP L    ++  A A  SPFV+AI  A  K+LP I+N  I+ +  S+G
Sbjct: 305 SALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSG 364

Query: 358 NSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFD 417
           NS ++  SR L  +   G+AP    +    GVPY AV  ++ F  L YLNVSS S   F 
Sbjct: 365 NSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFT 424

Query: 418 WLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVII 477
           W  +I+ +SGF  W+ I V+++RF + +  RG+  D +PFK+ F PYG Y+    V +I 
Sbjct: 425 WFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIIC 483

Query: 478 LVQGFTAFTP--FSAVDFVAYYISAFIFVVIWL 508
           L  G+  F P  +   DFVA YI+  +FVV+W+
Sbjct: 484 LTNGYATFIPRFWKGADFVAAYITLPVFVVLWV 516

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  311 bits (797), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 177/526 (33%), Positives = 299/526 (56%), Gaps = 15/526 (2%)

Query: 6   YEPKGDGSSSSTITAKPGAIKAEVLNH--------NTSEVESLCEKPNQSDVKRELKPRH 57
           ++P+    S +  T +   +  ++ N+        + ++  ++  K   + +K+ L+ R 
Sbjct: 20  FDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRV 79

Query: 58  VTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSS 117
           V+M                + +  AGPV  L+AY FV  + +    SLGEMA++IP+   
Sbjct: 80  VSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DG 138

Query: 118 FTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWMAIFWV 175
           FT +A+R+  PALG A GY Y   + I    +++    +I YW   + V    W+ IF V
Sbjct: 139 FTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLV 198

Query: 176 LLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPW 234
           ++ AIN + V+F+GEFEFW++S KV+ +   +    +++ GG     R+GFR+WK PG +
Sbjct: 199 VIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAF 258

Query: 235 GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRIL 294
                +    T +F+ +VS  + A F + GTELVG+  GE +NPR++VPKAI    +RI+
Sbjct: 259 NNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRII 318

Query: 295 LFYIGSLLVIGLLVRYDDPQLIQDGS-TTNANASPFVVAINAAGTKVLPDIMNGVIMVTI 353
           +FY+ S+L++G+ V YDDP L++  + +T+A ASPFVVAI  +G KVLP I N  ++V +
Sbjct: 319 IFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFV 378

Query: 354 ISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSG 413
            SA NS++YV SR LY L     AP   +RT   G+PY ++  + +F  L Y++VSS S 
Sbjct: 379 FSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSA 438

Query: 414 SVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFV 473
            +F++ +++ ++ G  +W+ I V+++ F + ++ +GI +    + A    YGAY+A FF 
Sbjct: 439 KIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFC 498

Query: 474 IVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
            +I L++ FT F    F    F+  YI   +F + +  ++ ++K +
Sbjct: 499 SLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTK 544

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  311 bits (797), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 183/516 (35%), Positives = 291/516 (56%), Gaps = 14/516 (2%)

Query: 11  DGSSSST---ITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXX 67
           DG S S    IT+  G+    V+ H TSE +    K +   +K+ L+ RHV+M       
Sbjct: 42  DGQSDSKVHGITSGHGSDVKNVVTH-TSEFDG---KHDGIRLKKALEARHVSMIAIGGSL 97

Query: 68  XXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVS 127
                    S +  AGP   L+AY FV  + + V   LGEMA +IP+   FT +++R+  
Sbjct: 98  GTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYAD 156

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPIT--AWMAIFWVLLTAINLIPV 185
           PALG A GY Y   + I    +++    +I YW D   +    W+ I  V +  IN + V
Sbjct: 157 PALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGV 216

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRI-GFRYWKDPGPWGVGIVSQEIH 244
           +F+GE E++I+++K+  +L  +   LV+ CGG     + GF+YWK+PG +     +    
Sbjct: 217 RFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGA 276

Query: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304
             +F+ + S  + A F + GTEL G+   E KNPR+ VPKAI    +RI++FY+ S+ ++
Sbjct: 277 KGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLL 336

Query: 305 GLLVRYDDPQLIQDGST-TNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363
           G+ V ++DP LI   S  T+A+ASPFVVAI  AG  VLP IMN  I++ + SA NS++YV
Sbjct: 337 GMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYV 396

Query: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423
            SR LYGL     AP   ++T  +GVPY ++L   +F  L Y+NVSS S  VF + ++  
Sbjct: 397 ASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCV 456

Query: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483
           ++ G  +W+ I +++IRF +  + +GI +  L +++   PYGA+++ FF I+I L++ F 
Sbjct: 457 SIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFP 516

Query: 484 AF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           AF    F    F+  YI    +++ ++ ++  +K +
Sbjct: 517 AFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTK 552

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  309 bits (792), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/493 (34%), Positives = 286/493 (58%), Gaps = 7/493 (1%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           + + ++  ++  K   + +K+ LK RHV+M                + +  AGPV +L+A
Sbjct: 50  SQDENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIA 109

Query: 91  YIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEI 150
           Y FV  + +     LGEMAT+IP+   FT +ASR+  PALG A GY Y   + I    ++
Sbjct: 110 YAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQL 168

Query: 151 SVIGRLILYWSDAVPIT--AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLF 208
           +    +I YW D   +    W+ IF V++ +IN+  V+F+GEFEFW++S KV+ +L  + 
Sbjct: 169 TAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLML 228

Query: 209 YGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTEL 267
              +++ GG     R+GFRYW+ PG +     +    T +F+ +VS  + A + + G EL
Sbjct: 229 LLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIEL 288

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANA 326
            G+ A E +NPR+++PKAI    +RI++FY+ S+ ++G+ V YDDP LI+   S+T+A A
Sbjct: 289 TGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAA 348

Query: 327 SPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTS 386
           SPFVVAI  +G   LP I+N  ++V + SA NS++YV SR LY L     AP   ++T  
Sbjct: 349 SPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNR 408

Query: 387 RGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLK 446
            G+PY A+  + +F  L Y+ VSS S  +F++ +++ ++ G  +W+ I +++I F + ++
Sbjct: 409 WGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVR 468

Query: 447 KRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFV 504
            +G+ +    + A F PYGA+++ FF  +I L++ FT F    F   +F+  YI   +F 
Sbjct: 469 AQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFF 528

Query: 505 VIWLLFQFLFKGR 517
             +  ++F +K +
Sbjct: 529 FCYFGYKFTYKTK 541

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  308 bits (788), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 182/503 (36%), Positives = 279/503 (55%), Gaps = 11/503 (2%)

Query: 23  GAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNA 82
           G   +  LN   S++E    K +++++++ L  RH+ +               +S + N 
Sbjct: 22  GETYSGTLNQLESQLEG--TKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNC 79

Query: 83  GPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSW 142
           GP+   L+++ ++ + Y V  +L EM  ++P   +     SR+V P+LG A G+ Y  S+
Sbjct: 80  GPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSY 139

Query: 143 CITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIA 202
            I  A E+S    ++ YW+D V +  W+ IF V++  +N  PVKFYGE EFW ASLK+I 
Sbjct: 140 SILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIIC 199

Query: 203 ILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFT 261
           IL  L   +V+  GG+    R+GFRYW +PGP+   I     +T +FL   +++IK+ F 
Sbjct: 200 ILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGG--NTGRFLDIWTAIIKSGFA 257

Query: 262 F-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ--D 318
           F    EL+G+   E K+ RR + KA     +RI+ FYI S L IG ++  DDP+LIQ   
Sbjct: 258 FILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALT 317

Query: 319 GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAP 378
                A +SPFV  I+ AG  VL  I+N VI+ +  S+ NS +Y  SR +  L + G AP
Sbjct: 318 SDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAP 377

Query: 379 AFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSH 438
              +R    GVPY AV  ++    L YLN SS S  VF WL +I  +SGF  W LI +++
Sbjct: 378 KVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITY 437

Query: 439 IRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP--FSAVDFVAY 496
           +RF + +    +  + +PFK+   PY  Y+   FV+++ L  G+  F P  ++A DFVA 
Sbjct: 438 LRFRKAIFYNNL-YERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAA 496

Query: 497 YISAFIFVVIWLLFQFLFKGRWF 519
           YI+  IF +++L  +  FK RW+
Sbjct: 497 YITLPIFFLLYLGHKIWFKTRWY 519

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  308 bits (788), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 181/522 (34%), Positives = 285/522 (54%), Gaps = 21/522 (4%)

Query: 12  GSSSSTITAKPGAIKAEVLN-HNTSEVESLCEKPNQSD---VKRELKPRHVTMXXXXXXX 67
            SS+S   A  G    +V   H+ + +E L  +   S+   + + L+ RH+ +       
Sbjct: 5   ASSASIEKADNGGYMHKVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCI 64

Query: 68  XXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVS 127
                   +  + N G    LL++I ++T+ Y +  SL EM  ++P   S     SR+V 
Sbjct: 65  GTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVD 124

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
           P+LG A G+ Y  ++ I  A E+S    ++ YW + VP+ AW+ IF V++  +N   VK+
Sbjct: 125 PSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKY 184

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTA 246
           YGE EFW AS+K+I IL  L   +V+  GG+    R GFRYWK+PGP+ + +      T 
Sbjct: 185 YGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGS--TG 242

Query: 247 QFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIG 305
           +FL    ++IK+AF F    EL+G+   E ++ RR   KA     +RI+ FY+   L+IG
Sbjct: 243 RFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIG 302

Query: 306 LLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363
           +++   DP+LI+  +     A +SPFV  I  AG  VL  ++N  I+ +  SAGNS +Y 
Sbjct: 303 VILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYA 362

Query: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423
            +R++  L R G AP F+++    GVPY AV+  ++   L YLNV + S +VF WL +I 
Sbjct: 363 STRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNIC 422

Query: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDL----PFKAKFMPYGAYYAAFFVIVIILV 479
            +SGF  W  + ++ IRF     +RGI  ++L    P++    PY AYY  F  +V+ L 
Sbjct: 423 TISGFIGWFAMGIAFIRF-----RRGIVFNNLQSRIPYQGPLQPYIAYYFTFMTVVVCLT 477

Query: 480 QGFTAFTP--FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWF 519
            GF  F    ++ VDFVA Y++  I++V++L  +  F+ RW+
Sbjct: 478 NGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWY 519

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  308 bits (790), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 181/485 (37%), Positives = 282/485 (58%), Gaps = 12/485 (2%)

Query: 30  LNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLL 89
           L+ N ++ + +    +QS ++R+LK RH+ M               +  +R AGP G L+
Sbjct: 65  LDPNLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILI 124

Query: 90  AYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
            +  +ATM  C+  SLGEMA   PV+  +T +A+RF+  + G AN   Y +   +   LE
Sbjct: 125 GWGLMATMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLE 184

Query: 150 ISVIGRLILYWSDAVPI-TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLF 208
           I      + YW        A++A+FW+ + +IN+  VK YGE EF  + +KV+ ++ F+ 
Sbjct: 185 IVAASITVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFII 244

Query: 209 YGLVVVCGGSKLGR-IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTEL 267
            G+++VCGG      IG ++W +PG + VG  + +    +F G  S  + AAF+F  TEL
Sbjct: 245 LGVILVCGGGPTHEYIGSKFWSNPGAF-VGDTAGQ----KFKGICSVFVTAAFSFANTEL 299

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS 327
           VG+ A ET++PR++VPKA   VF+RI LFYI SLL++GLLV Y DP+L+   S  +A AS
Sbjct: 300 VGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLL-GSSIVDAAAS 358

Query: 328 PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSR 387
           PFV+A+   G K LP ++N VI+  ++S GNS+++  SR L  L   G  P        +
Sbjct: 359 PFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRK 418

Query: 388 GVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKK 447
           G P V+++ +S FG L +L VS +   +FDW+LS++ +S  F WL IS+ HIRF + L  
Sbjct: 419 GRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSA 478

Query: 448 RGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYISAFIF 503
           +  S D+L F +    +G+YY+ F +IV++++Q + A  P     SA +F   Y+S  I 
Sbjct: 479 QNRSIDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIA 538

Query: 504 VVIWL 508
           V ++L
Sbjct: 539 VAMYL 543

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  304 bits (779), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 186/535 (34%), Positives = 288/535 (53%), Gaps = 30/535 (5%)

Query: 7   EPKGDGSSSSTITAKPGAIKA-----------------EVLNHNTSEVESLCEKPNQSDV 49
           E +  G SS    + PG  +A                 E L+ N +E E +     QS +
Sbjct: 18  EAQDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELEELDPNLTEAEKIAIITAQSPL 77

Query: 50  KRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA 109
           +R LK RH+ M                  +R  GP G L+ +  +  M YCV  S+GE+A
Sbjct: 78  QRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELA 137

Query: 110 TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPI-TA 168
              PV+  FT +A+RFV  + G A  Y Y L W +   LEI      + +W         
Sbjct: 138 VTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDG 197

Query: 169 WMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RY 227
           ++A+F++++  IN   V+ YGE EF  + +KVI ++ F+  G+V+VCGG  +G     +Y
Sbjct: 198 FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKY 257

Query: 228 WKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAIN 287
           W +PG +     S +   ++F G  S  + AAF+F GTELVG+ + ET NPR+ +P+A  
Sbjct: 258 WHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAK 312

Query: 288 TVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNG 347
            VF+RILLFYI SL +IGLLV +   +LI   S+ +A ASPFV+AI   G K LP ++N 
Sbjct: 313 QVFWRILLFYIISLCLIGLLVPHTSERLIGT-SSVDAAASPFVLAIQTHGIKGLPSVINV 371

Query: 348 VIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLN 407
           VI+++++S GNS +Y  SR +  L   G  P   +    +G P VA++ T +FG L ++ 
Sbjct: 372 VILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIA 431

Query: 408 VSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAY 467
            S K G VF+WLL+++ +S  F+W  I + HIRF + L  +G S D+L F +     G+Y
Sbjct: 432 QSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSY 491

Query: 468 YAAFFVIVIILVQGFTAFTPF----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           +    V+++++ Q + A  P     +A DF + Y+S F  ++ + +F  ++K  W
Sbjct: 492 FGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLS-FPVLLAFYIFHKIWKRNW 545

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  301 bits (770), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 163/478 (34%), Positives = 265/478 (55%), Gaps = 10/478 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           N++ + REL P  V++                + +   GP+   LAY+F  ++   V  S
Sbjct: 29  NEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSILAVVIFS 88

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           L EMA F P+   F+ + +++V PA G A G+ Y+L + I  +  ++  G +I YW   +
Sbjct: 89  LSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDI 148

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRI 223
            +  W+ + +     +N + V+++G+ E ++   K+  +L      LV+ CGG      I
Sbjct: 149 NVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGGPDHTTI 208

Query: 224 GFRYWKDPG--PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRT 281
           GFRYW++ G  P+ V     + +T +FLGW + +I++ F F G+E++G+  GET NPR+T
Sbjct: 209 GFRYWRESGFLPYLV-----KGNTGKFLGWWACVIQSIFGFMGSEMIGIIYGETANPRKT 263

Query: 282 VPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVL 341
           +PKA   V  RI +FYI  + V+GL V   + +L+   ST +ANASPFV+AI+ +G KVL
Sbjct: 264 IPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHST-DANASPFVIAISTSGIKVL 322

Query: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401
           P  +N  ++V I S+  ++IY+ SR LYGL + G AP    R     +P V  +  S+ G
Sbjct: 323 PSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCVVGSLLG 382

Query: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461
            L Y+N    + +VF ++ S  +V G   W  I V++I + + +K  G+  D++PF+  F
Sbjct: 383 FLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEIPFRMPF 442

Query: 462 MPYGAYYAAFFVIVIILVQGFTAFT-PFSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
            PY AY A FFV VI    G++AF   F+   F+  YI  F  V++ L ++  +K +W
Sbjct: 443 QPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVLGYKLYYKTKW 500

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  303 bits (777), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 175/498 (35%), Positives = 278/498 (55%), Gaps = 11/498 (2%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPV 85
           + E ++ N +E E +     ++ +K  LK RH+ M               ++ +R AGP 
Sbjct: 72  EKEEVDPNLTEAERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPA 131

Query: 86  GSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCIT 145
           G ++ +   +TM YC+  +LGE+A   PV+  FT +A+RF+  + G A+ + Y L W  T
Sbjct: 132 GIVIGWGLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLAT 191

Query: 146 FALEISVIGRLILYWSDAVPI-TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
             LEI      + YW         ++A+FW+++  INL  V+ +GE EF  +++KV+ ++
Sbjct: 192 LPLEIVSASITVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVI 251

Query: 205 CFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
            F+  G+V+V GG   G     RYW +PG +    V     T QF G  S  + AAF+F 
Sbjct: 252 GFIILGIVLVAGGGPEGGFVGGRYWHNPGAF----VGDNAGT-QFKGVCSVFVTAAFSFA 306

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           G+ELVG+TA E  NPR++VP+A   V +RI+LFY+GSL++IGLLV Y DP+LI   S+ +
Sbjct: 307 GSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLI-GASSVD 365

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
           A+ASPFV+AI   G + LP ++N VI++ ++S GNS I+ GSR +  L   G  P     
Sbjct: 366 ASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGY 425

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
              +G P V ++  S FG + ++  S K G VF WL++++ +S  FTW  I + HIRF  
Sbjct: 426 IDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRM 485

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIF 503
            LK +G S ++LPF +     G+ +  F ++++ + Q + A  P  +      +  +++ 
Sbjct: 486 ALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLS 545

Query: 504 VVIWLLFQF---LFKGRW 518
             I L F F   ++K  W
Sbjct: 546 FPIVLAFYFGHKIYKKNW 563

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  302 bits (774), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 171/478 (35%), Positives = 276/478 (57%), Gaps = 13/478 (2%)

Query: 49  VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108
           +K+ L+ RHV+M                S + +AGP   L++Y FV  + Y V   LGEM
Sbjct: 51  LKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEM 110

Query: 109 ATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPI 166
           A FIP+   FT +ASR+V PALG A GY Y   + I    +++    ++ YW   + V  
Sbjct: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169

Query: 167 TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVC-GGSKLGRIGF 225
             W+ IF VL+  IN + V+F+GEFEFW++S+KV+ +L  +    +++  GG    R GF
Sbjct: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGF 229

Query: 226 RYWKDPG---PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           RYW+DPG   P+   I   +    +F+ + S    A F + GTEL G+ A E KNPRR+V
Sbjct: 230 RYWRDPGAFKPYSEAISGSK---GKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSV 286

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGS-TTNANASPFVVAINAAGTKVL 341
           P+AI    +RI+LFY+ S+L++G+ V Y+DP LI+    +T+A ASPFVVAI  AG  VL
Sbjct: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVL 346

Query: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401
           P I N  +++ + SA NS++YV SR LYGL     AP   ++T   GVPY ++  + +F 
Sbjct: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406

Query: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461
            L Y+NVSS S  +F++ +++ ++ G  +W+ I ++++RF + +  +   +    + A F
Sbjct: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466

Query: 462 MPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
            P+  + + FF  +I L++ +T F    F    F++ YI   ++ + ++ ++ + + +
Sbjct: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  303 bits (777), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 168/495 (33%), Positives = 277/495 (55%), Gaps = 14/495 (2%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           N+   E  S       + +K+ +K RHV M                  +RN GP G ++ 
Sbjct: 78  NNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIG 137

Query: 91  YIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           Y  + +  YC+ Q+ GE+A  +  ++  F  + S  + PALG +  ++Y L W     LE
Sbjct: 138 YAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLE 197

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209
           +      I YW+ +V    ++AIF+V++  IN+   + Y E EF+  + KV+ I  FL  
Sbjct: 198 LVTASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLIL 257

Query: 210 GLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELV 268
           G++V CGG+   G IG +YW DPG +     S +     F G VS+L+ AAF F  TE +
Sbjct: 258 GIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFI 312

Query: 269 GVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASP 328
            +TA E  NPR+++P A   + +RIL+ Y+GS+++IG LV ++  +L+  G +   +ASP
Sbjct: 313 ALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSA-THASP 371

Query: 329 FVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRG 388
           +V+AI + G KV+P ++N VI++++IS GNS  Y  SR+L  L   G AP+F+      G
Sbjct: 372 YVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREG 431

Query: 389 VPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKR 448
            P +A++ +S+FG + ++  S K  +VF WLL+I+ +S  FTW  I +SHIRF + +K +
Sbjct: 432 RPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQ 491

Query: 449 GISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIF 503
           G S  +L FK++   +G+YYA   +++I++ Q +TA  P       A  F   Y++  I 
Sbjct: 492 GRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPIL 551

Query: 504 VVIWLLFQFLFKGRW 518
           + ++  ++ ++K  W
Sbjct: 552 IALYFGYK-VWKRDW 565

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  303 bits (776), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 174/470 (37%), Positives = 265/470 (56%), Gaps = 14/470 (2%)

Query: 49  VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108
           +K+ L+ RH+ +               +S +   GP G L +YI ++ + Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 109 ATFIPVTS-----SFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163
             F+P ++     S +   +R+  P+LG A G+ Y+  + I  A E +    ++ YW+ A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 164 VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GR 222
           VP  AW+AIF  ++T +N  PVK YGE EFW A LK++ I+  LF   ++  GG     R
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRT 281
           +GFRYW+ PG +   I +   +T +FL   + +IK  F F  G ELV +T+ E  + RR 
Sbjct: 285 LGFRYWQHPGAFAYHITTG--NTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 282 VPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQL---IQDGSTTNANASPFVVAINAAGT 338
           + KA     +R++ FY+ S L IG++V   DP L   + +G    A +SPFV+AI  A  
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKA-GAGSSPFVIAIQNAHI 401

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           KVLP I+N  I+ +  S+GNS ++  SR L  +   G AP  + R   +GVPY AV  ++
Sbjct: 402 KVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSA 461

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
            F  L +LNVSS S   F W  +I+ +SGF  W+ I V++++F + +  RG+  + +PFK
Sbjct: 462 AFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFK 520

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWL 508
           +   PYG Y+    V +I L  G+ +F  ++A DFVA YI+  IFVV+W+
Sbjct: 521 SPLQPYGTYFFIVVVSLICLTNGYASFVNWNASDFVAAYITLPIFVVLWV 570

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  300 bits (767), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 183/500 (36%), Positives = 287/500 (57%), Gaps = 13/500 (2%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           ++ E ++ N +++E +  K  +S ++ +LK RH+ M                  +R AGP
Sbjct: 64  VEVEEVDPNLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGP 123

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
            G L+ +    TM + +  +LGE+A   PV+  FT +A+RF+  + G A  + Y L W +
Sbjct: 124 AGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLV 183

Query: 145 TFALEISVIGRLILYWSDAVPIT-AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
              LEI      + YW   V  T  ++A+FW+++  IN+  V+ YGE EF  + +KV A+
Sbjct: 184 VLPLEIVAASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAV 243

Query: 204 LCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
           + F+  G+V+VCGG  +G     RYW +PG + VG  S +    +F G+ S  + AAF+F
Sbjct: 244 IGFIILGIVLVCGGGPVGGYVGARYWHNPGAF-VGSTSGQ----KFHGFCSVFVTAAFSF 298

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            G+EL+G+   E KNPR+ VP A   VF+RILLFYI  LL+IG LV Y+DP+LI   S+ 
Sbjct: 299 AGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISS-SSV 357

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
           +A+ASPFV+AI   G   LP ++N VI+++++S GNS IY  SR L  L   G  P  +S
Sbjct: 358 DASASPFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVS 417

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
               +G P V +  +S FG + ++  S+K   +F+WLL+I+ +S FFTW  I + HIRF 
Sbjct: 418 YIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFR 477

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYI 498
             LK +G   D+LPF +     G+Y+  F  I++++ Q + A  P     SA +F + Y+
Sbjct: 478 GALKAQGRGTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYL 537

Query: 499 SAFIFVVIWLLFQFLFKGRW 518
           +A + +  ++  + L+K  W
Sbjct: 538 AAPVILAFYIAHK-LWKKNW 556

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  298 bits (762), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 273/514 (53%), Gaps = 15/514 (2%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPN-QSDVKRELKPRHVTMXXXXX 65
           +  G+ + +   T +   I  E  +  +    S  + P     +K+ LK RH+ +     
Sbjct: 8   KDAGETTVTDKQTGQVYEIDIESYSQISGPKVSSSDAPQGDHTLKKGLKSRHIQLIALGG 67

Query: 66  XXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV----- 120
                     +S +   GP G   +Y  ++ + Y V  +LGEM  ++P   S +      
Sbjct: 68  CIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSSGGSISK 127

Query: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAI 180
             +R+V P+LG A G+ Y+  + I  A E +    ++ YW+ AVP  AW+ IF  ++  +
Sbjct: 128 LVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGAWITIFLGVVVLL 187

Query: 181 NLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIV 239
           N   VKFYGE EFW AS+K++ IL  LF   ++  GG     R+GFRYW+ PG +   I 
Sbjct: 188 NFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGAFAYHIT 247

Query: 240 SQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI 298
           S   +T +FL   + +IK  F F  G ELV +T+ E ++ RR + KA     +R++ FY+
Sbjct: 248 SG--NTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIFFYV 305

Query: 299 GSLLVIGLLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISA 356
            S L IG +V Y+D  L    D     A +SPFV+ I  AG KVLP I+N  I+ +  S+
Sbjct: 306 SSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSS 365

Query: 357 GNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVF 416
           GNS ++  SR L  + + G AP  + R    GVPY AV  TS+   + YLNVSS +  VF
Sbjct: 366 GNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTADVF 425

Query: 417 DWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVI 476
            W  +I+ +SGF  W+ I ++++RF + +  + +  + +PFK  F PYG ++    V VI
Sbjct: 426 TWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPFQPYGTWFFIIAVSVI 484

Query: 477 ILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWL 508
            L  G+  F P  ++  DF+A Y++  IF+V+W+
Sbjct: 485 CLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWI 518

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  297 bits (760), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 176/523 (33%), Positives = 275/523 (52%), Gaps = 14/523 (2%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPN-----QSDVKRELKPRHVTMX 61
           E K + S S         +K+    + TS      +  +     + ++K+ L  RH+ + 
Sbjct: 4   EIKKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLI 63

Query: 62  XXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVF 121
                         +S +   GP    L++I ++TM YC+  +L EM  ++P   S    
Sbjct: 64  ALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPEL 123

Query: 122 ASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAIN 181
            +R+V P+LG A G+ Y  S+ +  A E++    ++ YW+D VP   W+ IF +++  +N
Sbjct: 124 VTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLN 183

Query: 182 LIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVS 240
              V+FYGE EFW ASLK+I IL  L   +V+  GG+    R+GFRYW++PG +G  I  
Sbjct: 184 FSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITG 243

Query: 241 QEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIG 299
             +   +FL   +++IK+AF F    ELVG+   E K+ RR + KA     +RI+ FY+ 
Sbjct: 244 GNL--GRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLS 301

Query: 300 SLLVIGLLVRYDDPQLI--QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAG 357
           S L+IG++V  +D  L+   + +   A +SPFV  I  +G  VL  ++N  I+ +  SAG
Sbjct: 302 SSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAG 361

Query: 358 NSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFD 417
           NS  Y  SR +  L + G AP   S+    GVPY AV   S+   L YLNVSS S  VF 
Sbjct: 362 NSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQ 421

Query: 418 WLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVII 477
           WL +I  +SGF  W LI V++IRF + +    +  D +P+++   P+ AY+    V +I 
Sbjct: 422 WLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAIIT 480

Query: 478 LVQGFTAFTP--FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           L  G+  F    +   DF+  YIS  IF+  +L  + ++K R+
Sbjct: 481 LTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRF 523

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 172/510 (33%), Positives = 275/510 (53%), Gaps = 14/510 (2%)

Query: 15  SSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXX 74
           SS+  +K   IK++V  H +    ++ +  N S + ++L  RH+                
Sbjct: 56  SSSFDSKEN-IKSDV-PHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVN 113

Query: 75  XASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAAN 134
             + +   GP   ++A++ V+T  + +  +LGE+A   PV   F V+ +RFV P+ G A 
Sbjct: 114 SGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAV 173

Query: 135 GYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFW 194
              Y   W +   LE+      I YW++ +   AW+AIF+  +   N++ VK +GE EF 
Sbjct: 174 NINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFV 233

Query: 195 IASLKVIAILCFLFYGLVVVCGGSKLGR-IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVS 253
           ++ +K++AI+ F   G+V+ CGG   G  IG RYW DPG + VG    +    +F G  +
Sbjct: 234 LSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF-VG----DTPGRRFKGVCA 288

Query: 254 SLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDP 313
             + AAF++ GTELV V+A E+ NPR T+PKA    F+ I L YI  L +IG LV Y+D 
Sbjct: 289 VFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDE 348

Query: 314 QLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGR 373
           +L+   S+ +A ASP V+AI   G K LP +MN +I++ I+S  NS +Y  SR +  +  
Sbjct: 349 RLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAE 408

Query: 374 SGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLL 433
            G  P  ++    RG P  A+ AT +FG L ++  S K   VF WL +++ +S  F W  
Sbjct: 409 IGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFS 468

Query: 434 ISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----- 488
           I++SHIRF Q +K +  S ++LPF +    YG++Y    + ++++   +T+  P      
Sbjct: 469 INLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGA 528

Query: 489 SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
            A  F   Y+S  IF+V +L  + ++K  W
Sbjct: 529 DAESFFEGYLSLPIFIVCYLGHK-VYKKDW 557

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  296 bits (758), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 181/518 (34%), Positives = 279/518 (53%), Gaps = 13/518 (2%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           +  G GS           ++   ++ N +E E +     Q+ +K  LK RH+ M      
Sbjct: 44  DEAGSGSKWQDFKDSFRRVEPVEVDPNLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGA 103

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                     + +R  GP   L+ +    TM Y +  +LGE+A   P++  FT +A+RF+
Sbjct: 104 IGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGELAVIFPISGGFTTYATRFI 163

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPV 185
             + G AN + Y L W +   LEI      + +W +D      ++A+FW+++  IN+  V
Sbjct: 164 DESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLVIVIINMFGV 223

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIH 244
           K YGE EF  + +KVI ++ F+  G+++ CGG   G     +YW DPG +     + +  
Sbjct: 224 KGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTP 278

Query: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304
            A+F G  S  + +AF+F G+ELVG+ A E+ +PR++VPKA   VF+RI LFYI SLL++
Sbjct: 279 GAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMV 338

Query: 305 GLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVG 364
           GLLV Y+DP LI   S+ +A ASPFV+AI   G K LP ++N VI++ ++S GNS IY  
Sbjct: 339 GLLVPYNDPNLI-GASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYAC 397

Query: 365 SRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITA 424
           SR +  L      P   +    +G P V +  TS FG + ++  S K G VF+WLL+++ 
Sbjct: 398 SRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSG 457

Query: 425 VSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA 484
           +S  FTW  I + HIRF + L  +G   D+L FK+    +G+Y+  F V+++ + Q + A
Sbjct: 458 LSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVA 517

Query: 485 FTPF----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
             P     SA  F   Y+S F  VV   L   ++K  W
Sbjct: 518 LFPVGASPSAEGFFEAYLS-FPLVVAMYLGHKIYKRNW 554

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  296 bits (758), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 184/518 (35%), Positives = 277/518 (53%), Gaps = 13/518 (2%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           +  G GS           +K   ++ N SE E +     Q+ +K  LK RH+ M      
Sbjct: 44  DETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGA 103

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                     + +R  GP   L+ +    TM Y +  +LGE+A   P++  FT +A+RF+
Sbjct: 104 IGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFI 163

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPV 185
             + G AN + Y L W +   LEI      + +W +D      ++A+FW+ +  IN+  V
Sbjct: 164 DESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGV 223

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIH 244
           K YGE EF  + +KVI ++ F+  G+++ CGG   G     +YW DPG +     + +  
Sbjct: 224 KGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAF-----AGDTP 278

Query: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304
            A+F G  S  + AAF+F G+ELVG+ A E+  PR++VPKA   VF+RI LFYI SLL+I
Sbjct: 279 GAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMI 338

Query: 305 GLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVG 364
           GLLV Y+D  LI   S+ +A ASPFV+AI   G K LP ++N VI++ ++S GNS IY  
Sbjct: 339 GLLVPYNDKSLI-GASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYAC 397

Query: 365 SRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITA 424
           SR +  L      P   S    +G P V +  TS FG + ++  S K G VF+WLL+++ 
Sbjct: 398 SRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSG 457

Query: 425 VSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA 484
           +S  FTW  I + HIRF + L  +G   D+L FK+    +G+Y+  F VI++ + Q + A
Sbjct: 458 LSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVA 517

Query: 485 FTPF----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
             P     SA  F   Y+S F  V++  +   ++K  W
Sbjct: 518 VFPVGDSPSAEGFFEAYLS-FPLVMVMYIGHKIYKRNW 554

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  295 bits (756), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 176/494 (35%), Positives = 269/494 (54%), Gaps = 10/494 (2%)

Query: 30  LNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLL 89
           ++ N SE++ +  +   S ++  LK RH+ M                + +R AGP G L+
Sbjct: 62  VDPNMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILI 121

Query: 90  AYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
            +    TM Y +  +LGE+A   PV+  FT +A+RF+  + G AN   Y L W +   LE
Sbjct: 122 GWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLE 181

Query: 150 ISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLF 208
           I      + YW ++      ++A+FW+ +  INL  VK YGE EF  + +KVI ++ F+ 
Sbjct: 182 IVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFII 241

Query: 209 YGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTEL 267
            G+++ CGG  + G IG RYW  P     G    +   A+F G  S  + AAF+F G+EL
Sbjct: 242 LGIILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSEL 297

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS 327
           VG+ + ET NPR++VPKA   VF+RI LFY+ +L ++GLLV Y + +LI   S+ +A AS
Sbjct: 298 VGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLI-GASSVDAAAS 356

Query: 328 PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSR 387
           PFV+AI   G + LP ++N VI++ ++S GNS IY  SR L  L      P F       
Sbjct: 357 PFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRS 416

Query: 388 GVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKK 447
           G P  ++L TS FG + ++  S K G VF+WLL+++ +S  FTW  I + HIRF + L  
Sbjct: 417 GRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSA 476

Query: 448 RGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFI---FV 504
           +G   D+L F +    YG+Y+  F +I++ + Q + A  P  A      +  A++    V
Sbjct: 477 QGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIV 536

Query: 505 VIWLLFQFLFKGRW 518
           +   L   ++K  W
Sbjct: 537 IACYLGHKIYKKNW 550

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  295 bits (754), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 175/511 (34%), Positives = 269/511 (52%), Gaps = 8/511 (1%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           +P   GS           ++   L+ N ++ E +     +S ++R LK RH+ M      
Sbjct: 38  KPTSSGSRWQDFVDGFKRVELGDLDPNLTQAEKVAIATARSPLQRHLKNRHLQMIAIGGA 97

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                     S +R  GP   L+ +  +  M Y V  ++GE+A   PV   FT +  RFV
Sbjct: 98  IGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFV 157

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPV 185
             + G A  Y+Y L W +   LEI      + YW + A     ++A+F+V++  IN+  V
Sbjct: 158 DDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRDGFVALFYVVIVIINMFGV 217

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIH 244
           K YGE EF  + +KV  ++ F+  G+V++CGG  +G     +YW +PG +      Q   
Sbjct: 218 KGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGKYWHNPGAFNGDNAGQ--- 274

Query: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304
             +F    S  + AAF+F GTELVG+ A ET+NPR+ +P+A   VF+RI LFYI SL +I
Sbjct: 275 --RFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAKQVFWRITLFYIISLCLI 332

Query: 305 GLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVG 364
           GLLV Y    LI   S+ +A ASPFV+AI   G   LP ++N VI+++++S GNS++Y  
Sbjct: 333 GLLVPYTSENLIGS-SSVDAAASPFVLAIKTHGISGLPSVINVVILISVLSVGNSSVYAC 391

Query: 365 SRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITA 424
           SR L  L   G  P   S    +G P V +LAT  FG L ++  S K G VF+WL++++ 
Sbjct: 392 SRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSG 451

Query: 425 VSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA 484
           +S  FTW  I + H+RF + L  +G S D+L F +    +G+Y+    + ++ + Q + A
Sbjct: 452 LSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSYFGVILICLVFIAQFWIA 511

Query: 485 FTPFSAVDFVAYYISAFIFVVIWLLFQFLFK 515
             P       + +  A++ VV+ L F    K
Sbjct: 512 VWPMGGTPNASDFFQAYLSVVVVLFFYLAHK 542

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  293 bits (749), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 172/473 (36%), Positives = 267/473 (56%), Gaps = 12/473 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           +   ++R  K RHV M                + ++  GP   L+A+IF  ++   V  S
Sbjct: 42  SSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMS 101

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           L EMA+F P+  SF+ +A+R+V PALG A G+ Y+L + I  A E+S IG L+ YW + +
Sbjct: 102 LAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDL 161

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK-VIAILCFLFYGLVVVCGGSKLGR- 222
            I  ++ +F V+L ++N + +KFYGE EFW A LK ++ I+CF+  GLV+ CGG      
Sbjct: 162 SIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFV-TGLVLTCGGGPSKET 220

Query: 223 IGFRYWKDPG--PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRR 280
           IGFRYW++    P+ V     +  T +FLGW + +I++ + + G+E +GV  GE  NP++
Sbjct: 221 IGFRYWREYAFVPYLV-----KGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKK 275

Query: 281 TVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKV 340
           T+P A   V FRI  FYI  +L++GL++   D  L  +  T++A+ SPFV+A   AG K 
Sbjct: 276 TIPAATRNVIFRITGFYIVGVLILGLIISPHDKTL-ANAKTSDASGSPFVIAFTNAGIKG 334

Query: 341 LPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMF 400
           LP  +N ++++ I SA N+ +YV SR  YGL + G+AP         GVP+   L   + 
Sbjct: 335 LPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLI 394

Query: 401 GALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAK 460
             L ++N+S+ S  +F +L S   V G   WL + +S+I + +      + RD +PF+  
Sbjct: 395 SLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMW 454

Query: 461 FMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQF 512
           F PY AY   FFV +II   G++AF   F    F+  YI   +F+   L ++F
Sbjct: 455 FQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWKF 507

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  294 bits (752), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 269/477 (56%), Gaps = 12/477 (2%)

Query: 48  DVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGE 107
           ++ R+L  RH+                  S +   GP   ++A+  ++T  + +  +LGE
Sbjct: 70  NLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGE 129

Query: 108 MATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPIT 167
           +A   PV   F V+ +R V P+LG A    Y   W +   LE+      I YW+++V   
Sbjct: 130 LAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSD 189

Query: 168 AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFR 226
           AW+A+F+V +   +L+ VK +GE EF ++ +K++AI  F   G+V++CGG  K G IG +
Sbjct: 190 AWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAK 249

Query: 227 YWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAI 286
           YW DPG + VG        +QF G  S  + AAF++ GTELVGV+A E+ NPR T+PKA 
Sbjct: 250 YWNDPGSF-VGASPG----SQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKAS 304

Query: 287 NTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMN 346
              F+ I L Y+  L +IG LVR+DDP+L+   S+ +  ASP V+AI   G + LP +MN
Sbjct: 305 KRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMN 364

Query: 347 GVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYL 406
            +I++ IIS  NS++Y  SR +  +   G  P   +   +RG P VA++ T +FG L ++
Sbjct: 365 AIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFI 424

Query: 407 NVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGA 466
             S+K   +F WL +++ +S  F WL I++SHIRF + L  +G S D+LP+ +     G+
Sbjct: 425 AASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGS 484

Query: 467 YYAAFFVIVIILVQGFTAFTPF--SAVDFVAY---YISAFIFVVIWLLFQFLFKGRW 518
           +Y    +I++++   +T+  P   S  D+ ++   Y+S  IF+  ++  + L+K  W
Sbjct: 485 WYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHK-LYKRNW 540

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  292 bits (747), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 269/499 (53%), Gaps = 12/499 (2%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           E  G GS           ++   ++ N +E E +     Q+ +K  LK RH+ M      
Sbjct: 44  EEAGSGSKWQDFKDSFKRVEPIAVDPNLTEAEKVAIVTAQTPLKHHLKNRHLQMIAIGGA 103

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                     + +R  GP   L+ +    TM Y +  +LGE+A   P++  FT +A+RF+
Sbjct: 104 IGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFI 163

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPV 185
             + G AN + Y L W +   LEI      + +W +D      ++A+FWV++  IN+  V
Sbjct: 164 DESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIVIINMFGV 223

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIH 244
           K YGE EF  + +KVI ++ F+  G+++ CGG   G     +YW DPG +     + +  
Sbjct: 224 KGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTP 278

Query: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304
            A+F G  S  + +AF+F G+ELVG+ A E+  PR++VPKA   VF+RI LFYI SLL+I
Sbjct: 279 GAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMI 338

Query: 305 GLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVG 364
           GLLV Y+D  LI   S+ +A ASPFV+AI   G K LP ++N VI++ ++S GNS IY  
Sbjct: 339 GLLVPYNDKNLI-GASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYAC 397

Query: 365 SRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITA 424
           SR +  L      P   +    +G P V +  TS FG + ++  S K G VF+WLL+++ 
Sbjct: 398 SRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSG 457

Query: 425 VSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA 484
           +S  FTW  I + HIRF + L  +G   D+L FK+    +G+Y+  F V+++ + Q + A
Sbjct: 458 LSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVA 517

Query: 485 FTPF----SAVDFVAYYIS 499
             P     SA  F   Y+S
Sbjct: 518 LFPVGGSPSAEGFFEAYLS 536

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  293 bits (750), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 168/463 (36%), Positives = 261/463 (56%), Gaps = 8/463 (1%)

Query: 29  VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSL 88
           V++ N SE E L  +   + + R LK RH+ M                  +  AGP G L
Sbjct: 63  VIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVL 122

Query: 89  LAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFAL 148
           + +   ATM   +  SLGE+A   PV+  +  +A+RF+  + G AN + Y +   +   L
Sbjct: 123 IGWGLTATMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPL 182

Query: 149 EISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFL 207
           EI      + YW +D     A++A+FWV++ +INL  V+ +GE E   + +KVI I+ F+
Sbjct: 183 EIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFI 242

Query: 208 FYGLVVVCGGSKLGR-IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTE 266
             G+V++ GG      IG +YW DPGP+ VG    +    +F G  S  + AAF+F G+E
Sbjct: 243 IMGVVLISGGGPDHEVIGGKYWNDPGPF-VGNAPSD----KFKGVCSVFVTAAFSFAGSE 297

Query: 267 LVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANA 326
           L+G+ A ET+ PR+++PKA   VF+RI LFYI SLL++GLLV  ++  L+      +A  
Sbjct: 298 LIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAP-QQIDAAH 356

Query: 327 SPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTS 386
           SPFV+A++    +VLP I+N VI+  +IS GNS++Y  SR +  L   G  P        
Sbjct: 357 SPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDR 416

Query: 387 RGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLK 446
           +G P  A+  TS+FG L ++  + + G +FDWLL+I+ +S FFTWL I+++H+RF   LK
Sbjct: 417 KGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALK 476

Query: 447 KRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFS 489
            +G + ++L F +     G+ YA   + V+++ Q + A  P S
Sbjct: 477 AQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPS 519

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  293 bits (750), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 170/517 (32%), Positives = 275/517 (53%), Gaps = 21/517 (4%)

Query: 11  DGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQS--DVKRELKPRHVTMXXXXXXXX 68
           DGSS +    K G    EV +    E + L EK NQ   ++K+ +KPRHV +        
Sbjct: 71  DGSSENL--DKDGK---EVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIG 125

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVS 127
                  A  + NAGP G L+ Y  + T  YC+ Q+ GE+A ++  ++  F V+ S  V 
Sbjct: 126 TGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVD 185

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
           PA G +  ++Y + W     LE+      I YW+  V    ++ IF+VL+  IN    + 
Sbjct: 186 PAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARG 245

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTA 246
           Y E EF+    K++ ++ F   G+V+  GG+   G IG RYW  PG +     + +    
Sbjct: 246 YAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPID 300

Query: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306
            F G +++++ AAF F  TE + +TA E  NPR+ +P A   V +RIL  ++GS+ ++G 
Sbjct: 301 HFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGF 360

Query: 307 LVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSR 366
           LV YD  QL+  G +    ASP+V+A++  G KV+P  +N VI+++++S GNS  Y  SR
Sbjct: 361 LVPYDSDQLMGSGGSAT-KASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSR 419

Query: 367 VLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVS 426
           +LY L + G AP F       G P+ A++   +F  + +   S K   VF WLL+I+ +S
Sbjct: 420 LLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLS 479

Query: 427 GFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFT 486
             FTW  I +SHIRF + +  +  S  ++ FKA+   +G+YY  F +++I++ Q + A  
Sbjct: 480 QVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIA 539

Query: 487 P-----FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           P       A  F   Y++  I ++ ++ ++ ++K  W
Sbjct: 540 PIGEGKLDAQGFFENYLAMPILILFYVGYK-IWKKDW 575

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  292 bits (748), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 187/538 (34%), Positives = 294/538 (54%), Gaps = 27/538 (5%)

Query: 1   MTNIIYEPKGDGSSSSTITAKPGAIKA--------------EVLNHNTSEVESLCEKPNQ 46
           M +I++EP    SS++      G+I+               E L+ N ++ E +     +
Sbjct: 25  MDDIVHEPCSTLSSNNNDNESRGSIRCKWTRFVDSFKRIELEELDPNLTDAEKIAIATAR 84

Query: 47  SDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLG 106
           S +K  LK RH+ M                  +R AGP G L+ +    TM Y +  ++G
Sbjct: 85  SPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVG 144

Query: 107 EMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS-DAVP 165
           E+A   PV+  FT +A+RF+  + G A  + Y L W IT  LEI      + YW  DA  
Sbjct: 145 ELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKY 204

Query: 166 ITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF 225
              ++A+FWV    INL  VK YGE EF  A +KV+ I+ F+   ++++CGG  +G    
Sbjct: 205 RDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIG 264

Query: 226 -RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
            +YW  PG + VG  + +    +F G+ +  I A+F+F G+E+VGV   E++NPR++VP 
Sbjct: 265 AKYWHHPGAF-VGDTAGQ----KFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPG 319

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           A   VF+RI LFY+  LL+IG+LV Y+D +LI   S+ +A ASPFV+A+   G + LP +
Sbjct: 320 AAKQVFWRITLFYVLCLLLIGMLVPYNDKRLI-GASSVDAAASPFVIAVVNQGIRGLPSV 378

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
           +N VI+++++S GNS+IY+ SR L  L   G  P  ++     G P VA+   S FG + 
Sbjct: 379 INVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIA 438

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           ++  SS  G VF+WLL+++ +S  F+W  I + HIRF + L  +G S D+LPF +     
Sbjct: 439 FVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIA 498

Query: 465 GAYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           G+Y+  F  +++++ Q +    P     +A DF   Y+S F  V+ + +F  ++K  W
Sbjct: 499 GSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLS-FPIVLAFYIFHKIWKKNW 555

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  291 bits (745), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/489 (35%), Positives = 270/489 (55%), Gaps = 14/489 (2%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           ++ E ++ N +  E        S +KR LK RH+ M                  +R  GP
Sbjct: 65  LRMEDVDPNLTAAERAAIATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGP 124

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
              ++A+I   +M Y V Q+LGE+A  +PV+ S+  + SRF+ P+ G A  Y Y +   I
Sbjct: 125 AAVVIAWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLI 184

Query: 145 TFALEISVIGRLILYWS-DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
           T  LE+      + YW  D+    A++A+F++++  INL  VK YGE EF  + +KV AI
Sbjct: 185 TMPLELIAASITVNYWDVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAI 244

Query: 204 LCFLFYGLVVVCGG--SKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFT 261
           + F+  G+V+VCGG  S  G IG RYW +PG +  G          F G+ +  + +AF+
Sbjct: 245 VGFIILGIVLVCGGGPSDEGYIGARYWYNPGGFAHG----------FKGFAAIFVTSAFS 294

Query: 262 FQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGST 321
           F G+E+  + A ET+NPR+ +P+A   VF+RI LFY+ SL +IG LV Y D  L    S+
Sbjct: 295 FAGSEMFALAAAETENPRKDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAA-SS 353

Query: 322 TNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFI 381
            +A+ASPFV+AI  AG K LP ++N VI++ ++S GN  +Y  SR +  L   G  P   
Sbjct: 354 VDASASPFVIAIARAGIKGLPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRF 413

Query: 382 SRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRF 441
                +G P V +L  ++FG L +L+ SS  G VFDW+L+I+ ++ FF W  I V H+RF
Sbjct: 414 GYVDRKGRPLVGILLCAIFGLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRF 473

Query: 442 MQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAF 501
            + L  +G S D+L +KA+   +G+ Y    + +++  Q + A  P        ++ SA+
Sbjct: 474 RRALSVQGRSTDELSYKAQTGIWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAY 533

Query: 502 IFVVIWLLF 510
           + + + + F
Sbjct: 534 LSLPVVIFF 542

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  291 bits (744), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/465 (36%), Positives = 259/465 (55%), Gaps = 8/465 (1%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           +   V+  + S++E +  +   + +K  LK RH+ M                + +R AGP
Sbjct: 57  LDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGP 116

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
            G L+ +    TM YC+  ++GE++   P++  FT +A+RF+  + G AN + Y L W  
Sbjct: 117 AGILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLC 176

Query: 145 TFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
              LEI      + YW +D      ++A+FWV++  INL  VK YGE EF  + +KV+ +
Sbjct: 177 VLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTV 236

Query: 204 LCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
           + F+  G+V+ CGG   G     +Y+ DPG + VG    +   A+F G  S  + AAF+F
Sbjct: 237 IGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAF-VG----DTAGARFQGVCSVFVTAAFSF 291

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            G+EL+G+ A E+  PR++VPKA   VF+RI LFY+ SLL++GLLV Y D +LI   S+ 
Sbjct: 292 AGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLI-GASSV 350

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
           +A ASPFV+AI + G + LP ++N VI++ ++S GNS +Y  SR L  L +    P    
Sbjct: 351 DAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFG 410

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
                G P   +  TS FG + ++  S K G VF WLL+++ +S  FTW  I   HIRF 
Sbjct: 411 YIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFR 470

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
             L  +G S D+LPFKA    YG+ +  F ++++ + Q + A  P
Sbjct: 471 AALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFP 515

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  288 bits (736), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/523 (33%), Positives = 278/523 (53%), Gaps = 28/523 (5%)

Query: 1   MTNIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTM 60
           + N++ +PK     S+ +         + ++   +++E   +K  +S + R L PRH+ M
Sbjct: 16  LKNVVKDPK-----SAPVVQNYEVTPLDSISDAVTDLED-HDKIRES-LNRSLSPRHINM 68

Query: 61  XXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV 120
                          A  +   GP    + Y  +  + Y     LGEM+TF+P++ SF  
Sbjct: 69  ISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMPISGSFCS 128

Query: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA---VPITAWMAIFWVLL 177
           +A +F   +   A    YW +  ++ A +++ +  ++ YW  +    P  A   +FWV L
Sbjct: 129 YAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFPYWAASLLFWVFL 188

Query: 178 TAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-IGFRYWK-DPGPWG 235
             +N+I V+ YGE E+W+A LKVIAI+ F    +VV  G +     IGF+YW     P+ 
Sbjct: 189 LGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYWSYKEAPFV 248

Query: 236 VGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILL 295
            G          F G+V+  + +AF++ GTE + +TAGE +NP R  P+ + TVF+RIL+
Sbjct: 249 NG----------FKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIVKTVFWRILI 298

Query: 296 FYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIIS 355
           FY+ ++  I + + YD P L    ST +   SPF +    AGTK     MN VI+ +I+S
Sbjct: 299 FYVATMFFISMNIPYDYPNL----STKSVMTSPFTIIFQMAGTKAAGSFMNAVILTSIVS 354

Query: 356 AGNSNIYVGSRVLYGLGRSGLA-PAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGS 414
           AGN  ++ GSRVLY +G  G   P  I++T     PYVAV+ T   G L +      +G+
Sbjct: 355 AGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFGASFIGAGT 414

Query: 415 VFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVI 474
           ++ WL +I  VS    WL I+V+ IRF + L ++G ++ +L FK    PYG Y+   FV 
Sbjct: 415 LWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWTYPYGPYFLVIFVT 473

Query: 475 VIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           +IILVQG++AF P+S  DF +YY+  F+F   WL++    + R
Sbjct: 474 LIILVQGWSAFDPWSTSDFFSYYLELFVFPTCWLIWWIFKRDR 516

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  288 bits (736), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 182/516 (35%), Positives = 284/516 (55%), Gaps = 13/516 (2%)

Query: 9   KGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXX 68
           KG GS           ++   ++ N +E E +     Q+ +K +LK RH+ M        
Sbjct: 45  KGSGSKWKDFRDSFKRVEPVEVDPNLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIG 104

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                     +R  GP   L+ +  + TM Y +  +LGE+A   P++  FT +A+RF+  
Sbjct: 105 TGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDE 164

Query: 129 ALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPVKF 187
           + G A  + Y L W +T  LEI      + YW +D      ++A+FW+++  IN+  VK 
Sbjct: 165 SFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRDGFVALFWLVIVCINMFGVKG 224

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTA 246
           YGE EF  + +KVI I+ F+  G+++ CGG  + G IG +Y+ DPG +     + +   A
Sbjct: 225 YGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGA 279

Query: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306
           +F G  S  + AAF+F G+ELVG+ A E+ +PR++VPKA   VF+RI LFYI SLL+IGL
Sbjct: 280 KFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGL 339

Query: 307 LVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSR 366
           LV Y+D +LI   S+ +A ASPFV+AI   G K LP ++N VI++ ++S GNS I+  SR
Sbjct: 340 LVPYNDSRLI-GASSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSR 398

Query: 367 VLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVS 426
               L   G  P   +    +G P V ++ TS  G + ++  S+K   VF+WLL+++ +S
Sbjct: 399 TFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLS 458

Query: 427 GFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFT 486
             FTW  I + HIRF + L  +G S D+L FK+    +G+Y+  F ++++ + Q + A  
Sbjct: 459 SLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALF 518

Query: 487 PF----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           P     SA  F   Y+S F  V+   +   ++K  W
Sbjct: 519 PVNGSPSAEGFFEAYLS-FPLVLAMYIGHKIYKRNW 553

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  288 bits (736), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 165/495 (33%), Positives = 274/495 (55%), Gaps = 14/495 (2%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           N+   E  S       + +K+ +K RHV M                  +RN GP G ++ 
Sbjct: 78  NNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIG 137

Query: 91  YIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           Y  + +  YC+ Q+ GE+A  +  ++  F  + S  + PALG +  ++Y L W     LE
Sbjct: 138 YAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLE 197

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209
           +      I YW+ +V    ++AIF+VL  AIN+   + Y E EF+  + KV+ I  F   
Sbjct: 198 LVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFIL 257

Query: 210 GLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELV 268
           G++V CGG+   G IG +YW DPG +     S +     F G VS+L+ AAF F  TE +
Sbjct: 258 GIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFI 312

Query: 269 GVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASP 328
            +TA E  NPR+++P A   V +RI++ ++GS+ ++G LV ++  +L+  G +   +ASP
Sbjct: 313 ALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSAT-HASP 371

Query: 329 FVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRG 388
           +V+AI + G KV+P  +N VI+++++S GNS  Y  SR+L  L   G AP+F+      G
Sbjct: 372 YVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREG 431

Query: 389 VPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKR 448
            P +A++ +++FG + ++  S K  +VF WLL+I+ +S  FTW  I +SHIRF + +K +
Sbjct: 432 RPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQ 491

Query: 449 GISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIF 503
           G S  +L FK++   +G+YYA   +++I++ Q +TA  P       A  F   Y++  I 
Sbjct: 492 GRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPIL 551

Query: 504 VVIWLLFQFLFKGRW 518
           + ++  ++ ++K  W
Sbjct: 552 IALYFGYK-VWKRDW 565

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  286 bits (733), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 172/515 (33%), Positives = 269/515 (52%), Gaps = 17/515 (3%)

Query: 6   YEPKGDGSSSSTITAKPGAIKAEVLNHNTS----EVESLCEKPNQSDVK--RELKPRHVT 59
           Y+       S   +  P   KA+  + N S     VES     +  D +  ++L  RH+ 
Sbjct: 21  YKQSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSDAEDSRYNKDLSVRHLL 80

Query: 60  MXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFT 119
                            S +   GP   ++ ++ ++T  + +  +LGE+++  PV   F 
Sbjct: 81  TLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFN 140

Query: 120 VFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTA 179
           V+ SRFV P+ G A    Y   W +   LE+      I YW+  +   AW+AIF+ ++  
Sbjct: 141 VYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYTIIFL 200

Query: 180 INLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGI 238
            NL+ VK +GE EF ++ +K++AI+ F   G+V+ CGG   G     +YW +PG +    
Sbjct: 201 ANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAFVGNT 260

Query: 239 VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI 298
            SQ  H     G  S  + AAF++ GTEL+ V+A E+ NPR T+PKA    F+ I + YI
Sbjct: 261 SSQRFH-----GLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYI 315

Query: 299 GSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN 358
             L ++G LV  DDP+L+   S+ +  ASP V+AI   G K LP +MN +I++ ++S  N
Sbjct: 316 VVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVAN 375

Query: 359 SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW 418
           S +Y  SR +  + R G  P   S    +G P  A+LAT +FG L ++  S+K  +VF W
Sbjct: 376 SAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTW 435

Query: 419 LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL 478
           L +++ +S  F W  I+VSHIRF   +K+RG S D+LPF +    +G+YY    + V+++
Sbjct: 436 LSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYGCVIIFVVLV 495

Query: 479 VQGFTAFTP-----FSAVDFVAYYISAFIFVVIWL 508
           V  +TA  P      SA  F   Y+S  I +V ++
Sbjct: 496 VCFWTALFPSTEGVASAESFFETYLSFPILLVCYI 530

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  286 bits (733), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 180/495 (36%), Positives = 278/495 (56%), Gaps = 13/495 (2%)

Query: 30  LNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLL 89
           L+ N +E E +      S +KR LK RH+ M                  +R AGP G L+
Sbjct: 58  LDPNLTEAEKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILI 117

Query: 90  AYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
            +    TM YC+  ++GE+A   PV+  FT +A+RF+  + G AN + Y L W +   LE
Sbjct: 118 GWALTGTMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLE 177

Query: 150 ISVIGRLILYW-SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLF 208
           I      + YW +D      ++A+F+V++ +IN+  VK YGE EF  + +KVI ++ F+ 
Sbjct: 178 IVAASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFII 237

Query: 209 YGLVVVCGGSKLGRIGFR-YWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTEL 267
            G+++VCGG  +G       W +PG + VG  + +    +F G  S  + AAF+F G+EL
Sbjct: 238 LGIILVCGGGPVGGYIGGANWHNPGAF-VGNTAGK----RFKGVCSVFVTAAFSFAGSEL 292

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS 327
           VG+ + ET NPR+++P+A   VF+RI LFYI SL +IGLLV Y+D +LI   S+ +A AS
Sbjct: 293 VGLASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLI-GASSVDAAAS 351

Query: 328 PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSR 387
           PFV+AI   G K LP ++N VI++ ++S GNS ++  SR L  L   G  P        +
Sbjct: 352 PFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRK 411

Query: 388 GVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKK 447
           G P V +  TS FG L ++  S K G VFDWLL+++ +S  FTW+ I + H+RF + L  
Sbjct: 412 GRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSA 471

Query: 448 RGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF----TPFSAVDFVAYYISAFIF 503
           +G S D+L F +    +G+ Y    +++I+  Q + A     +P  A DF   Y+S  + 
Sbjct: 472 QGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVV 531

Query: 504 VVIWLLFQFLFKGRW 518
           +V+++  +  +K  W
Sbjct: 532 LVMYIGHK-CYKRNW 545

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  286 bits (731), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 174/519 (33%), Positives = 290/519 (55%), Gaps = 17/519 (3%)

Query: 13  SSSSTITAKPGAIKAEVLNHNTSEV------ESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           + S  I  K    + ++   +T  V      E    K +   +K++LK RHV+M      
Sbjct: 20  NHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGS 79

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                     + +  AGPV  L++Y FV  + + V   +GEMA +IP+   FT +ASR+ 
Sbjct: 80  LGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYC 138

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPITAWMAIFWVLLTAINLIP 184
            PALG A GY Y + + I    +++    +I YW   + V    W+ I  V++  IN   
Sbjct: 139 DPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFG 198

Query: 185 VKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEI 243
           VKF+GEFEFW++S KVI +L  +    +++ GG+    R+GFRYWK PG +     S+ I
Sbjct: 199 VKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKE--YSKSI 256

Query: 244 H--TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSL 301
           H    +F+ +VS  +   F + G EL G+ A E +NPR+ +PKAI    +RI++FYI ++
Sbjct: 257 HGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITI 316

Query: 302 LVIGLLVRYDDPQLIQDGS-TTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
            ++G+ V  +DP L++  + +T+A ASPFVVAI  +G + LP I N  +++ + SA NS+
Sbjct: 317 FLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSD 376

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           +YV SR LY L     AP   ++T   G+PY ++    +F  L Y++VSS S  +F++ +
Sbjct: 377 LYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFV 436

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           ++ +++G  TW+ I +++I F + ++ +GI +    + A   PYGAY++ FF  ++ L++
Sbjct: 437 NVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIK 496

Query: 481 GFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
            FT F    F   +F+  YI   +F + +  ++F+ K +
Sbjct: 497 NFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTK 535

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  285 bits (730), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 172/490 (35%), Positives = 268/490 (54%), Gaps = 18/490 (3%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPV 85
           K + ++ N S  E       +S +KR LK RH+ M                  +R  GP 
Sbjct: 61  KLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPA 120

Query: 86  GSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCIT 145
             +LA+I   +M Y V Q++GE+   +PV+ S+  + SRF+ P+ G A  Y Y +   +T
Sbjct: 121 AVILAWILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVT 180

Query: 146 FALEISVIGRLILYWS-DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
             LEI      + YW+ D      ++A+F+V +  IN + VK YGE EF  + +KV+AI+
Sbjct: 181 MPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIV 240

Query: 205 CFLFYGLVVVCGG--SKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
            F+  G+V+VCGG  +  G IG +YW +PG +  G          F G+ +  + +AF+F
Sbjct: 241 GFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG----------FKGFAAIFVTSAFSF 290

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            G+E+  + A E+KNPRR +PKA   VF+RI LFY+ SL +IG LV Y +  L    S+ 
Sbjct: 291 SGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFAS-SSV 349

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
           +A+ASPFV+AI  AG   LP ++N VI+V ++S GN+ ++  SR    L   G  P   +
Sbjct: 350 DASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFA 409

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
               +G P   ++ + +FG L +L+ S   G VF+W+L+++ +  FFTW  I V H+RF 
Sbjct: 410 YVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFR 469

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYI 498
           Q L+ +G S D+L FKA+   +G+ Y    + V++  Q + A  P     SA  F   Y+
Sbjct: 470 QGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYL 529

Query: 499 SAFIFVVIWL 508
           S  + +V ++
Sbjct: 530 SLPVVIVFYM 539

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  284 bits (726), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 178/514 (34%), Positives = 269/514 (52%), Gaps = 22/514 (4%)

Query: 6   YEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXX 65
           Y P+ D         K   +  E+    T+E +   E   + D++R LKPRH+ M     
Sbjct: 11  YIPEEDYYKGLNTPPKKNEVVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAG 70

Query: 66  XXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRF 125
                     A  +   GP    + Y  +  + Y     LGEM+T++P++ SF  +A +F
Sbjct: 71  VIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKF 130

Query: 126 VSPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMA--IFWVLLTAINL 182
            S +   A  + YW +  ++ A +++ +  ++ YW ++A     W A  +FW L+  +N+
Sbjct: 131 GSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNV 190

Query: 183 IPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-IGFRYWKDPGPWGVGIVSQ 241
           I V+FYGE E+W+A LKVIAI+ F    +VV  G +     IGF+ W            +
Sbjct: 191 IHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWNH---------GE 241

Query: 242 EIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSL 301
                 F G+ S  + A+F + GTE + +T GE  NP R  PK + TVF+RIL+FY+GS 
Sbjct: 242 APFVDGFKGFASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGST 301

Query: 302 LVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNI 361
             I + + YD P L     T +   SPF +    AGTK     MN VIM ++ISA N  +
Sbjct: 302 FFIAMNIPYDYPGL----DTKSVVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHAL 357

Query: 362 YVGSRVLYGLGRSGLAP-AFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           + GSRV+Y +G  G  P   +SRT    VPYV+VL TS  G L +      +G+V+ WL 
Sbjct: 358 FAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQ 417

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           +I  VS    WL I ++ IRF + L+K+G +  +L +K    PYG Y+   FV  IILVQ
Sbjct: 418 NIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTYPYGPYFLVIFVTFIILVQ 476

Query: 481 GFTAFTPFSAVDFVAYYISAFIF---VVIWLLFQ 511
           G++AF P+   +F +YY+  F+F    +IW L++
Sbjct: 477 GWSAFDPWDVTNFFSYYLDLFVFPFCFIIWWLYK 510

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  285 bits (728), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 164/493 (33%), Positives = 265/493 (53%), Gaps = 16/493 (3%)

Query: 34  TSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIF 93
           T E  S  E  N +++ ++L  RH+                  + +   GP   ++ ++ 
Sbjct: 73  TPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVI 132

Query: 94  VATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVI 153
           V+T  + V  SLGE+A   PV   F V+ +RF+ P+   A    Y   W +   LE+   
Sbjct: 133 VSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAA 192

Query: 154 GRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVV 213
              I YW+D +   AW+AIF+  +   N++ VK +GE EF ++ +K++AI+ F   G+V+
Sbjct: 193 SITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVL 252

Query: 214 VCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTA--QFLGWVSSLIKAAFTFQGTELVGV 270
            CGG   G     +YW +PG + VG      H+A  QF G  S  + AAF++ G E+  V
Sbjct: 253 TCGGGPHGGYIGGKYWHNPGAF-VG------HSAGSQFKGLCSVFVTAAFSYSGIEMTAV 305

Query: 271 TAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFV 330
           +A E++NP+ T+PKA    F+ I + Y+G L +IG LV Y+DP+L+   S+ +A ASP V
Sbjct: 306 SAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLV 365

Query: 331 VAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVP 390
           +AI   G K LP +MN +I++ I+S  NS +Y  SR +  +   G  P F+S+   RG P
Sbjct: 366 IAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRP 425

Query: 391 YVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGI 450
             A+L T  FG L ++  S K   VF WL +++ +S  F W+ I++S IRF   +K +G 
Sbjct: 426 LNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGR 485

Query: 451 SRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFVV 505
           S D++PF ++   +GA+Y    + ++++   +T+  P      SA  F   Y+S  I + 
Sbjct: 486 SLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIA 545

Query: 506 IWLLFQFLFKGRW 518
            ++  + L+K  W
Sbjct: 546 CYVGHK-LWKRDW 557

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  285 bits (728), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 173/520 (33%), Positives = 274/520 (52%), Gaps = 22/520 (4%)

Query: 4   IIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXX 63
           IIY  K   S     T  P  I +  ++    + +      +  ++K+ LK RH+ +   
Sbjct: 54  IIYNEK-SYSQDELQTTSPTIIDS--IDDEAEKEQGKERSSSNGELKQGLKSRHIQLIAL 110

Query: 64  XXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV--- 120
                       +S + N GP G  ++Y+ ++T  Y +  +LGEM  F+P   S +    
Sbjct: 111 GGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSA 170

Query: 121 --FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS--DAVPITAWMAIFWVL 176
                ++V P+LG A  + Y+  + I  A E+S    +I YW+  + VP  AW+ IF  L
Sbjct: 171 AHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSL 230

Query: 177 LTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGG--SKLGRIGFRYWKDPGPW 234
           +  +N +PV  YGE EFW AS+K++ I   +    ++  GG     G +GFRYWK+PG +
Sbjct: 231 IVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSF 290

Query: 235 GVGIVSQEIHTAQFLGWVSSLIKAAFT-FQGTELVGVTAGETKNPRRTVPKAINTVFFRI 293
              I         FL   + +IK  F+   G ELV +T+ E  + RR + KA     +R+
Sbjct: 291 AHHITGG--GGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRL 348

Query: 294 LLFYIGSLLVIGLLVRYDDPQLIQDG---STTNANASPFVVAINAAGTKVLPDIMNGVIM 350
           + FYI   L IG++V Y+DP ++Q+    S   A +SPFV+ I  AG + +P I+N  I+
Sbjct: 349 MFFYILGSLSIGVIVAYNDP-VLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCIL 407

Query: 351 VTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSS 410
            +  SAGN+ ++  SR L  + R+G AP    R    GVPY AV A+ +   L YLNVSS
Sbjct: 408 TSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSS 467

Query: 411 KSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAA 470
            +  VF+W  +I+ +SGF  W+   V++IRF + +    ++   +PF+AK   Y  +Y+ 
Sbjct: 468 STADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSL 526

Query: 471 FFVIVIILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWL 508
           F+V +I L  G+  F P  ++  DF+A YI+  IF+V+W+
Sbjct: 527 FWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWI 566

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  282 bits (722), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 167/520 (32%), Positives = 278/520 (53%), Gaps = 20/520 (3%)

Query: 9   KGDGSSSSTI---TAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXX 65
           +G  S+ S++   T K      EV+N  TS V +        ++ + L  RH+       
Sbjct: 29  EGKSSTQSSLLDLTLKKCDNGIEVVNDATSTVSN--ASVTNVNLNKNLSIRHLLTLAVGG 86

Query: 66  XXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRF 125
                      + + + GP   ++ ++ ++T  + V  +LGEMA   PV   F V+ +RF
Sbjct: 87  AIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGGFNVYITRF 146

Query: 126 VSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPV 185
           V P++G A    Y   W +   LE+      I YW+D +   AW+AIF+ ++   N++ V
Sbjct: 147 VDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEV 206

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIH 244
           K +GE EF ++ +K++AI+ F   G+V+ CGG   G     +YW +PG + VG      H
Sbjct: 207 KSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSF-VG------H 259

Query: 245 TA--QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLL 302
           T+  +F G  S  + AAF++ G E+  V+A E+K+PRRT+PKA    F+ I   YI  L 
Sbjct: 260 TSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITASYITILT 319

Query: 303 VIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIY 362
           +IG LV YD+P+L+   S+ +A +SP V+AI   G K LP +MN +I+++IIS  NS +Y
Sbjct: 320 LIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISIISVANSAVY 379

Query: 363 VGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSI 422
             SR +  +   G  P  +     +G P  A+L T  FG L ++  S K   VF WL ++
Sbjct: 380 ACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVFTWLSAL 439

Query: 423 TAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGF 482
           + +S  F W+ I++SHIRF Q +KK+  S D+LP+ ++   +G++Y    + ++++V  +
Sbjct: 440 SGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFW 499

Query: 483 TAFTPF-----SAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           T+  P       A  F   Y+S  I +  ++  + +++ +
Sbjct: 500 TSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKK 539

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  283 bits (723), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 167/492 (33%), Positives = 262/492 (53%), Gaps = 17/492 (3%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           N+  +++ LK RH+ M               +S +   GP G  ++YI ++++ Y +   
Sbjct: 73  NEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCG 132

Query: 105 LGEMATFIP-----VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILY 159
            GEM  ++P      + S     +R+V  +LG A  + Y+  + I  A E +    ++ Y
Sbjct: 133 FGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEY 192

Query: 160 WSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS- 218
           W+ AVP   W+ IF  ++  +N  PVK+YGE EFW AS+K++ I+  +    ++  GG  
Sbjct: 193 WTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGP 252

Query: 219 KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKN 277
              R+GFRYW+ PG +   I+       +FL   S +IK  F F  G ELV +T+ E ++
Sbjct: 253 NHDRLGFRYWQRPGAFTEHIMKGGF--GRFLDIYSGVIKGGFAFILGPELVCLTSAECED 310

Query: 278 PRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD--GSTTNANASPFVVAINA 335
            RR + KA     +R++ FY+   L I ++V Y+DP L+         A +SPFV+ I  
Sbjct: 311 QRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQN 370

Query: 336 AGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVL 395
           AG +VLP I+N  I+ +  SAGN+ ++  +R L  + R+G AP    +    GVPYVA+ 
Sbjct: 371 AGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAIS 430

Query: 396 ATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDL 455
            +     L +LNVSS +  VF+W  +I+ +SGF  W+   V++IRF + +   G+  D L
Sbjct: 431 LSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRL 489

Query: 456 PFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWL---LF 510
           PFK    PY  YY+ F + +I L  G+  F P  +   DFVA YI+  IFVV+W+   L+
Sbjct: 490 PFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLW 549

Query: 511 QFLFKGRWFHTV 522
              F  RW+  V
Sbjct: 550 TRTFTKRWWRRV 561

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  282 bits (722), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 179/500 (35%), Positives = 272/500 (54%), Gaps = 13/500 (2%)

Query: 26  KAE--VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           KAE   L+ N +E E + +   ++ ++  LK R  TM               ++ +R  G
Sbjct: 78  KAEDVELDPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGG 137

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
           P G ++ +   +TM Y +  +LGE+A   PV   FT +A+RFV  + G AN + Y L W 
Sbjct: 138 PAGLIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWL 197

Query: 144 ITFALEISVIGRLILYWSDAVPI-TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIA 202
           +   LEI      + YW         ++A+FW+++  IN+  VK +GE EF  + +KV  
Sbjct: 198 VVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTT 257

Query: 203 ILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFT 261
           ++ F+  G+V+VCGG   G     +YW DPG + VG  S     AQF G  S  + AAF+
Sbjct: 258 VIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAF-VGHGSG----AQFKGVCSVFVTAAFS 312

Query: 262 FQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGST 321
           F G+EL+G+TA E  NPR+++P A   V +RI+LFY+G+L +IGLLV Y+D +LI   S+
Sbjct: 313 FAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLI-GASS 371

Query: 322 TNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFI 381
            +A ASPFV+AI   G K LP ++N VI++ ++S GNS I+  SR +  L   G  P   
Sbjct: 372 VDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVF 431

Query: 382 SRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRF 441
                 G P V +  TS FG L ++  S K G VF+WLL+++ +S  FTW  I + HIRF
Sbjct: 432 GYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRF 491

Query: 442 MQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA-FTPFSAVDFVAYYIS- 499
              LK +G   ++L F +     G+Y+  F ++++ + Q + A F P    D   ++ S 
Sbjct: 492 RMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSY 551

Query: 500 -AFIFVVIWLLFQFLFKGRW 518
            +F  VV       ++K  W
Sbjct: 552 LSFPIVVATYFGHKIYKRNW 571

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  280 bits (717), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 167/515 (32%), Positives = 275/515 (53%), Gaps = 18/515 (3%)

Query: 10  GDGSSSSTITAKPGAIKAEV-LNHNTSEVESLCEK----PNQSDVKRELKPRHVTMXXXX 64
           GD S++S    KP   + +V   H+   VE   ++     +++ +K+ LK RH+ M    
Sbjct: 5   GDESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGLKERHIKMLTLV 64

Query: 65  XXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASR 124
                         ++  GPVG L+AY+FV  +  C   ++ E+A+F+P T +    A +
Sbjct: 65  GVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQ 124

Query: 125 FVSPALGAANGYLYWLS-WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLI 183
           F+  ++G   G   W+S +      E+S    ++ YW+D  P   ++ +F +L    N+ 
Sbjct: 125 FIDESVGFTFG---WISTYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIY 180

Query: 184 PVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVGIVSQE 242
            ++FYGE E+    LK++ I   +  GLV+  GG+K   R+GF YW++PGP+   +V   
Sbjct: 181 TIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYLVGG- 239

Query: 243 IHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLL 302
            H  +F+G+ +++    +++ G + + + AGETKN R  +      VF RI++ Y+ ++ 
Sbjct: 240 -HIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVF 298

Query: 303 VIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIY 362
           ++ L+V Y+D +LI  G+ T A +SPFV+A+N AG KVLP I+N +I+ +  SAGN  I 
Sbjct: 299 ILTLIVPYND-KLIATGTGT-ARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAII 356

Query: 363 VGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSI 422
            GSR L+ L     AP    RT+ RG+PYV V+  S F  L Y++ S  S +VF W   +
Sbjct: 357 EGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQEL 416

Query: 423 TAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGF 482
            + +    W+LIS +HI   + LK +G SR DLP+     P+ A+++     + +L  GF
Sbjct: 417 VSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGF 476

Query: 483 TAFTPFSAVDFVAYYISAFIFVVIWLLFQF--LFK 515
             F      D  +++   FI  +   LF F  LFK
Sbjct: 477 YNFI-HGHFDIESFFTRYFIIPLAIGLFTFWKLFK 510

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  281 bits (718), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 173/536 (32%), Positives = 287/536 (53%), Gaps = 27/536 (5%)

Query: 7   EPKGDGSSSSTITAKPG-----AIKAEVLNHNTSEVESLCE--------KPNQSDVKREL 53
           E     S +ST+    G     A +   L H  S  +   +        K     +K++L
Sbjct: 4   EKFAQASEASTLDELKGPKLAAAGEGRGLRHTHSSTDQEAQSVDWNYDGKHEGIRLKKDL 63

Query: 54  KPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP 113
           + RHV+M                S +  AGP   L+AY  +  + + V   LGEMA +IP
Sbjct: 64  QARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGEMAAYIP 123

Query: 114 VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPIT--AWMA 171
           +   FT +A+R+  PALG A G+ Y   + +    +++    +I +W  A  ++   W+ 
Sbjct: 124 L-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVSPGVWIT 182

Query: 172 IFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKD 230
           +   ++  IN + V+F+GEFEFW++S KV+ +LC +   LV+  GG     R+GFRYW D
Sbjct: 183 VVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLGFRYWSD 242

Query: 231 PGPWGVGIVSQEIHT----AQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAI 286
           PG +      ++ H      +F+ ++S  + A F + GTEL G+ A E K+PRR VP+AI
Sbjct: 243 PGAFK-EYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRNVPRAI 301

Query: 287 NTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVLPDIM 345
               +RI++FY+ ++ ++G+ V Y+DP L+Q  S   + A+ P+VVAI  A   VLP++ 
Sbjct: 302 KLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPVLPNLF 361

Query: 346 NGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGY 405
           N  ++  + SA NS++YVGSR LYGL   G AP   +RT   GVPY A+   ++F  L Y
Sbjct: 362 NACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLFCCLAY 421

Query: 406 LNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYG 465
           ++VS  + + F + +++T++ G  +W+ I +++I F +  + +GI +  L + A   PY 
Sbjct: 422 MSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAPCQPYA 481

Query: 466 AYYAAFFVIVIILVQGFTAFTPFSAVD---FVAYYISAFIFVVIWLLFQFLFKGRW 518
            + A  F I + L++ F AF     VD   F+  YI   I++  ++ ++ + K +W
Sbjct: 482 GWVALIFCIFVALIKNFDAFIG-KEVDVPTFITGYIGLPIYIFCFIGYKIVHKTKW 536

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  280 bits (715), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 260/488 (53%), Gaps = 17/488 (3%)

Query: 46  QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSL 105
           +  +++ L  RH+ +               +S +   GP G  ++Y+ ++T+ Y +  + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 106 GEMATFIP-----VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
           GEM  ++P        S +    R+V P+L  A G+ Y+  + I  A E +    ++ YW
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219
           +DAVP  AW+ IF  ++  +NL  VK+YGE EFW AS+KV+ I+  +    ++  GG   
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNP 278
             R+GFRYWK+PG +   I    +    FL   S +IK AF F  G EL+ + + E K+ 
Sbjct: 233 HDRLGFRYWKNPGGFAHHITGGNL--GNFLDVYSGIIKGAFAFILGPELIALASSECKDQ 290

Query: 279 RRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD--GSTTNANASPFVVAINAA 336
           RR + KA     +R++ FYI   L I ++V  +DP L          A +SPFV+ I  A
Sbjct: 291 RRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNA 350

Query: 337 GTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLA 396
           G K+LP I+N  I+ +  SAGN+ ++  SR L  +  +G AP    +    GVP+VAV  
Sbjct: 351 GIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTF 410

Query: 397 TSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLP 456
           +++   L YLNVSS +  VF W  +I+ +SGF  W    V+++RF + +K  G+  + LP
Sbjct: 411 SALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLP 469

Query: 457 FKAKFMPYGAYYAAFFVIVIILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWL---LFQ 511
           +  +F  Y  +++   V ++I   G+  F P  ++  DF+A YI+  +FVV+W+   ++ 
Sbjct: 470 YAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYT 529

Query: 512 FLFKGRWF 519
             FK  W+
Sbjct: 530 RDFKKWWY 537

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  279 bits (714), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 260/499 (52%), Gaps = 16/499 (3%)

Query: 35  SEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFV 94
           S+  S  E      +K+ L  RHV                 +  ++  GP G +++YI +
Sbjct: 44  SDSSSEVEAEGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIII 103

Query: 95  ATMAYCVTQSLGEMATFIP-----VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           +T+ Y +  +LGEM  ++P        S      R+V  +L  A G+ Y+  + I  A E
Sbjct: 104 STVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAE 163

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209
            +    ++ YW+ +VP   W+ IF  ++T +N   VK++GE EFW AS+K++ IL  +  
Sbjct: 164 CTAASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILV 223

Query: 210 GLVVVCGGSKLG-RIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTEL 267
             ++  GG     R+GF YWKDPG +   I         FL   + +IK AF F  G EL
Sbjct: 224 SFILFWGGGPSHVRLGFHYWKDPGTFAHHITGGS--WGSFLDIYTGIIKGAFAFILGPEL 281

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ--DGSTTNAN 325
           V +T+ E  + RR + KA     +R++ FYI   L I ++V Y+DP L+   +     A 
Sbjct: 282 VALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAA 341

Query: 326 ASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTT 385
           +SPFV+ I  AG KVLP I+N  I+ +  SAGNS ++  SR L  +  +G AP    +  
Sbjct: 342 SSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVN 401

Query: 386 SRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCL 445
             GVPY +V  ++M   L +LNVSS +  VFDW  +I+ +SGF  W+   ++++RF + +
Sbjct: 402 RFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAI 461

Query: 446 KKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP--FSAVDFVAYYISAFIF 503
               +  D LPFK    PY  +Y+   + VI L  G+  F P  +S  DFVA YI+  +F
Sbjct: 462 FYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLF 520

Query: 504 VVIWLLFQFLFKGRWFHTV 522
           +++W+  +F    R+ H V
Sbjct: 521 LILWVGHKFW--ARYKHAV 537

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  280 bits (715), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 166/502 (33%), Positives = 261/502 (51%), Gaps = 12/502 (2%)

Query: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           A K  V      E  S+        ++R ++PRHV M                  +R  G
Sbjct: 54  AQKRSVPQGGDLETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGG 113

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSW 142
           P G ++ Y  V+ +AY + Q+ GEMA   P +  +F  ++S F+S   G A+ +LY L W
Sbjct: 114 PGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQW 173

Query: 143 CITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIA 202
              F LE+      I YW+D+V    ++AIF+V +  I+    + YGE EF     KV+ 
Sbjct: 174 LTVFPLELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLM 233

Query: 203 ILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFT 261
           I  F+   +V+ CGG+   G IG RYW DPG + VG  +     ++F G+   L+   F+
Sbjct: 234 IAGFVILAIVINCGGAGNSGYIGARYWHDPGAFAVGDPA-----SKFKGFCYVLVTGYFS 288

Query: 262 FQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGST 321
           + GTEL  +T  E  +PRR +  A     +RIL+ Y+ ++++IG LV +   +L+  G  
Sbjct: 289 YGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGK 348

Query: 322 TNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFI 381
           +  +ASP+V+A++  G KV+P I+N VI++ ++S GNS +Y G RVL  L   G AP F+
Sbjct: 349 SATHASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFL 408

Query: 382 SRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRF 441
           +     G P +A++A S+ G L ++  S     VF WL +I  +S  FTW  I +SHIRF
Sbjct: 409 AYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRF 468

Query: 442 MQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF---SAVDFVAYYI 498
            Q +K  G S   L +K+    +G+ Y   F I++ + Q + A  P       D ++++ 
Sbjct: 469 RQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQ 528

Query: 499 S--AFIFVVIWLLFQFLFKGRW 518
           S  AF    ++ L   ++ G W
Sbjct: 529 SYLAFPLWFVFFLGYMVYSGEW 550

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  279 bits (714), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 167/511 (32%), Positives = 275/511 (53%), Gaps = 21/511 (4%)

Query: 21  KPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELK----PRHVTMXXXXXXXXXXXXXXXA 76
           +PG++  +VL  ++        +P + D  RELK    PRHV M                
Sbjct: 77  QPGSLDHDVLAGDSDIEGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNG 136

Query: 77  SPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMAT-FIPVTSSFTVFASRFVSPALGAANG 135
           + + N+GP G ++ Y  + +  YC+ Q+ GE+A  +  +T  F  + S  + PA G A  
Sbjct: 137 TSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVA 196

Query: 136 YLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFW 194
           ++Y + W     LE+      I YW+  V    ++ IF+ L+  IN++     Y E EF+
Sbjct: 197 WVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFF 256

Query: 195 IASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVS 253
             S K++ +  F   G+VV+CGG+   G IG R W +PG +       +    +F G VS
Sbjct: 257 FNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVS 311

Query: 254 SLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDP 313
           +L+ AAF F  +E +GVTA E  NPR+ +P A   + +RI+  Y+GS+ ++G LV YD  
Sbjct: 312 TLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSD 371

Query: 314 QLIQDGSTTNA-NASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLG 372
           QL+  GS+  A  ASP+V+AI+  G +V+P  +N VI+++++S GNS  Y  SR L  L 
Sbjct: 372 QLL--GSSGAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLS 429

Query: 373 RSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWL 432
           + G AP+F++     G P  A   +++ G + +   S K   VF WLL+I+ +S  FTW 
Sbjct: 430 QLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWF 489

Query: 433 LISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF---- 488
            I +SH+RF + ++ +G S  ++ FK++   YG+ Y+   +++I++ Q +TA  P     
Sbjct: 490 SICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGK 549

Query: 489 -SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
                F   Y++  IF+V++  F+ ++K  W
Sbjct: 550 PDVQAFFENYLAMPIFIVLYFGFK-IWKKDW 579

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  280 bits (716), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/485 (31%), Positives = 256/485 (52%), Gaps = 17/485 (3%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           K  +  +K+ +KPRHV M               A  + NAGP G ++ Y  + +  YC+ 
Sbjct: 136 KFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCII 195

Query: 103 QSLGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS 161
           Q+ GEMA  +  +   F  + S  V P  G A  ++Y L W     LE+      I YW+
Sbjct: 196 QAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWT 255

Query: 162 DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KL 220
             V   A++ IF+V++  I +   + Y E EF+    K++ I+ F   G+++  GG+   
Sbjct: 256 TTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGND 315

Query: 221 GRIGFRYWKDPGPW-GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
           G +G +YW DPG + G   + +      F G +++ + AAF F  TE + +TA E  NPR
Sbjct: 316 GYLGAKYWHDPGAFRGTNGIQR------FKGIMATFVSAAFAFGATEFIALTAAEQSNPR 369

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTK 339
           + +P A   V +R++  ++G++ ++G LV +D  QL+  G +    ASP+V+AI+  G +
Sbjct: 370 KAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSAT-KASPYVLAISIHGVR 428

Query: 340 VLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSM 399
           V+P  +N VI++++ S  NS  Y  SR+L GL + G AP F      +G P+ A+   ++
Sbjct: 429 VVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAAL 488

Query: 400 FGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKA 459
           FG + +   S K   VF WLL+I+ +S  FTW+ I VSHIRF + +  +G S  ++ FKA
Sbjct: 489 FGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKA 548

Query: 460 KFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAYYISAFIFVVIWLLFQFL 513
           +   YG+YYA   +++ ++ Q + A  P        A  F   Y++  I +  +  ++ L
Sbjct: 549 QLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYK-L 607

Query: 514 FKGRW 518
           +K  W
Sbjct: 608 WKRDW 612

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  278 bits (712), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 161/509 (31%), Positives = 268/509 (52%), Gaps = 15/509 (2%)

Query: 11  DGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXX 70
           D S       K   +   +   + +   SL E+   + +K+ LK RHV +          
Sbjct: 38  DDSLDDRFNKKDSGLNKVLTVSSDTSTNSL-EEDYTNTLKQGLKSRHVQLIALGGCIGTG 96

Query: 71  XXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-----VTSSFTVFASRF 125
                +S +   GP G  +AY  ++++ Y +  ++GEM  ++P        S T    R+
Sbjct: 97  LFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRY 156

Query: 126 VSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPV 185
           V  +L  A G+ Y+  + I  A E +    ++ YW+ AVP  AW+ IF  ++  +N+  V
Sbjct: 157 VDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSV 216

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVV-CGGSKLGRIGFRYWKDPGPWGVGIVSQEIH 244
           K++GE EFW AS+K++ I+  +    ++   GG    R+GFRYWK+PG +   +    + 
Sbjct: 217 KYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVTDGSL- 275

Query: 245 TAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLV 303
              FL   S +IK AF F  G ELV +T+ E  + RR + KA     +R++ FYI   L 
Sbjct: 276 -GNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLA 334

Query: 304 IGLLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNI 361
           IG++V ++DP L      +T  A +SPFV+ I  AG +VLP I+N  I+ +  S+GN+ +
Sbjct: 335 IGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFM 394

Query: 362 YVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLS 421
           +  SR L+ + ++G AP    R    GVPY+AV+ +++   L YLN SS +  VF WL +
Sbjct: 395 FASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSN 454

Query: 422 ITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQG 481
           I+ +SGF  W+   ++++RF + +    +  D +PFK    PY   ++   V +I +  G
Sbjct: 455 ISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITITNG 513

Query: 482 FTAFTP--FSAVDFVAYYISAFIFVVIWL 508
           +  F P  ++  DF+A YI+  IF+ +++
Sbjct: 514 YQTFIPKFWNVSDFIAAYITLPIFLALYV 542

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  279 bits (713), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 161/499 (32%), Positives = 278/499 (55%), Gaps = 18/499 (3%)

Query: 29  VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSL 88
           V +    E+  + ++ N+  +K+ ++PRHV M                + + +AGP G +
Sbjct: 80  VFDDAKVEISQVDDELNEK-LKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLV 138

Query: 89  LAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFA 147
           + Y  +A+  YC+ Q++GEMA  ++ +   F  +    V PAL  +  ++Y + W     
Sbjct: 139 IGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCP 198

Query: 148 LEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKVIAILCF 206
           LE+      I YW+  V    ++ IF++L+ AIN+    + Y E EF   S K++ ++ F
Sbjct: 199 LELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGF 258

Query: 207 LFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGT 265
              G+V++CGG+   G IG +YW+DPG +            +F G VS+L+ AAF+F  T
Sbjct: 259 FILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQT 313

Query: 266 ELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNA- 324
           E + +TA E  NPR+ +P A   V +R LL Y+ S++++GLLV YD  +L+  GS++ A 
Sbjct: 314 EFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL--GSSSAAT 371

Query: 325 NASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRT 384
            ASP+V+A++  G +V+P  +N VI++++ S  +S  Y  SR+L  L R G AP   +  
Sbjct: 372 KASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFV 431

Query: 385 TSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQC 444
              G P +  L  ++   + +   SSK   VF+WLL+I+ +S  FTW LI +SHIRF + 
Sbjct: 432 DRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRA 491

Query: 445 LKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF--SAVDFVAY---YIS 499
           +K +G S D++ +K++   +G+ YA   +I+I++ Q +    P    + D  A+   Y++
Sbjct: 492 MKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLA 551

Query: 500 AFIFVVIWLLFQFLFKGRW 518
             +F+V++L ++ ++K  W
Sbjct: 552 MPVFIVLYLGYK-IWKRDW 569

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  280 bits (716), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 175/546 (32%), Positives = 282/546 (51%), Gaps = 31/546 (5%)

Query: 5   IYEPKGDGSSSSTITA-KPGAIKAEVLNHNTS-------EVESLCEKPNQSD-------V 49
           + E    GS +    A K  AI+ E ++ N S         E   EK   +D       +
Sbjct: 103 VTESPSSGSRTHHYEAEKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRL 162

Query: 50  KRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA 109
           K+ L+ RHV +               +S +   GP G  ++YI ++ + Y +  +LGEM 
Sbjct: 163 KQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMV 222

Query: 110 TFIPVTSSFTVFAS-----RFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
            F+P   S +  +S     R+V  +LG A G+ Y+  + I  A E +    ++ YW+ AV
Sbjct: 223 CFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAV 282

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVV-CGGSKLGRI 223
           P   W+ IF  ++  +N   VK YGE EFW AS+K++ I+  +    ++   GG K  R+
Sbjct: 283 PKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRL 342

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTV 282
           GFRYW+ PG +   +    +    F    + +IK AF F  G ELV +T+ E  + RR +
Sbjct: 343 GFRYWQHPGSFAHHLAGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNI 400

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD--GSTTNANASPFVVAINAAGTKV 340
            KA     +R++ FY+   L I ++V Y+DP L+         A +SP+V+ I  AG KV
Sbjct: 401 AKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKV 460

Query: 341 LPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMF 400
           LP I+NG I+ +  SA N+ ++  +R L  + ++G AP  + +    GVPYVAV  + + 
Sbjct: 461 LPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLC 520

Query: 401 GALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAK 460
             L YLNVSS +  VF+W  +I+ +SGF  W+   ++++RF + +   G+  D LPFK  
Sbjct: 521 SCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTW 579

Query: 461 FMPYGAYYAAFFVIVIILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWLLFQFLFK--G 516
             PY  +++   V +I +  G+  F P  ++  DF+A YI+  IF+V+WL  +   +   
Sbjct: 580 GQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWN 639

Query: 517 RWFHTV 522
            W+H+V
Sbjct: 640 HWWHSV 645

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  278 bits (710), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/485 (33%), Positives = 259/485 (53%), Gaps = 18/485 (3%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           N +T +     E  N +++ ++L  RH+                  + +   GP   ++ 
Sbjct: 73  NEDTEQ-----EDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVID 127

Query: 91  YIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEI 150
           ++ ++T  + V  SLGE++   PV   F V++ RF+ P+   A    Y   W +   LE+
Sbjct: 128 WVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLEL 187

Query: 151 SVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYG 210
                 I YW+D +   AW+AIF+  +   N++ VK +GE EF ++ +K+++I+ F   G
Sbjct: 188 VAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILG 247

Query: 211 LVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
           +V+ CGG   G     +YW DPG + VG  S      QF G  S  + AAF++ G E+  
Sbjct: 248 IVLSCGGGPHGGYIGGKYWHDPGAF-VGHSSG----TQFKGLCSVFVTAAFSYSGIEMTA 302

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPF 329
           V+A E+KNPR T+PKA    F+ I   Y+  L +IG LV  +DP+L+   S+ +A +SP 
Sbjct: 303 VSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPL 362

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           V+AI   G K LP +MN +I++ ++S  NS +Y  SR +  +   G  P F++R   RG 
Sbjct: 363 VIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGR 422

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           P  A+L T  FG L ++  S K   VF WL +++ +S  F W+ I++SHIRF Q +K + 
Sbjct: 423 PMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQE 482

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGF-TAFTPF-----SAVDFVAYYISAFIF 503
            S D+LPF ++    G++Y  F V+ ++L+  F T+  P      SA  F   Y+S  I 
Sbjct: 483 RSLDELPFISQTGVKGSWY-GFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPIL 541

Query: 504 VVIWL 508
           +V ++
Sbjct: 542 IVCYV 546

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  277 bits (709), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/499 (32%), Positives = 266/499 (53%), Gaps = 16/499 (3%)

Query: 22  PGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRN 81
           PG +    L+ +T +           ++K+ LK RHV +               +S +  
Sbjct: 48  PGDVDVFSLSSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHT 107

Query: 82  AGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSS----FTVF-ASRFVSPALGAANGY 136
            GP G  ++Y  ++++ Y + Q +GEM  ++P + S    F  +   ++V  +LG A+ +
Sbjct: 108 CGPAGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAW 167

Query: 137 LYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIA 196
            Y+  + I  A E +    ++ YW+ +VP  AW+ IF   +  +N   VKFYGE EFW A
Sbjct: 168 NYYYCYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFA 227

Query: 197 SLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSL 255
           S+K++ I+  +    ++  GG     R+GFRYW++PG +   I         FL   + +
Sbjct: 228 SIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSF--GSFLDIYTGI 285

Query: 256 IKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQ 314
           IK  F F  G E++ +T+ E ++ RR + KA     +R++ FYI   L I ++V Y+DP 
Sbjct: 286 IKGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPA 345

Query: 315 LIQDGSTTN---ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGL 371
           L ++    N   A +SPFV+ I  AG KVLP I+N  I+ +  SAGN+ ++  SR L  +
Sbjct: 346 L-ENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTM 404

Query: 372 GRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTW 431
            ++G AP   ++    GVPY AV  +S    L YLN SS +  VF+W  +I+ +SGF  W
Sbjct: 405 AQNGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGW 464

Query: 432 LLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP--FS 489
           + + +++IRF + +   G+ +  LP+ A+ MPY  Y+    + +I L  G+  F P  + 
Sbjct: 465 ICVCIAYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWD 523

Query: 490 AVDFVAYYISAFIFVVIWL 508
           A +FVA YI+  +F V+W+
Sbjct: 524 AKNFVAAYITLPVFWVLWI 542

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  278 bits (710), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 159/473 (33%), Positives = 254/473 (53%), Gaps = 13/473 (2%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           E  N +++ ++L  RH+                  + +   GP   ++ ++ ++T  + V
Sbjct: 79  EDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTV 138

Query: 102 TQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS 161
             SLGE++   PV   F V++ RFV P+   A    Y   W +   LE+      I YW+
Sbjct: 139 INSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWN 198

Query: 162 DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLG 221
           D +   AW+AIF+  +   N++ VK +GE EF ++ +K+++I+ F   G+V+ CGG   G
Sbjct: 199 DKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHG 258

Query: 222 RIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRR 280
                +YW DPG + VG  S      QF G  S  + AAF++ G E+  V+A E+KNPR 
Sbjct: 259 GYIGGKYWHDPGAF-VGHSSG----TQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRE 313

Query: 281 TVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKV 340
           T+PKA    F+ I   Y+  L +IG LV  +DP+L+   S+ +A +SP V+AI   G K 
Sbjct: 314 TIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKG 373

Query: 341 LPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMF 400
           LP +MN +I++ ++S  NS +Y  SR +  +   G  P F++R   RG P  A+L T  F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 401 GALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAK 460
           G L ++  S K   VF WL +++ +S  F W+ I++SHIRF Q +K +  S D+LPF ++
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 461 FMPYGAYYAAFFVIVIILVQGF-TAFTPF-----SAVDFVAYYISAFIFVVIW 507
               G++Y  F V+ ++L+  F T+  P      +A  F   Y+S  I +V +
Sbjct: 494 TGVKGSWY-GFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCY 545

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  276 bits (705), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 170/510 (33%), Positives = 275/510 (53%), Gaps = 17/510 (3%)

Query: 14  SSSTITAKPGAI-KAEV-LNHNTSEVESLCE---KPNQSDVKRELKPRHVTMXXXXXXXX 68
            SS++T +  AI +AEV L    +  E++ +     +++ +K+ LK RH+ M        
Sbjct: 6   KSSSLTKEKVAIDEAEVQLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFG 65

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                     ++  GPVG L+AY+ V  +  C   ++ E+A+F+P T +    + +F+  
Sbjct: 66  TGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDE 125

Query: 129 ALGAANGYLYWLS-WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
           A+G   G   W+S +      E+S    ++ YW+D  P   ++ IF VL    N+  ++F
Sbjct: 126 AVGFTFG---WISTYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRF 181

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQ 247
           YGE E++   LK+  I   +  GLV+  GG+K  R+GF YW++PGP+   +V  +  T +
Sbjct: 182 YGEIEYFFGWLKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGD--TGK 239

Query: 248 FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLL 307
           F+G+ ++L    +++ G + + + AGETKN R  +      VF RI+L Y+ ++ V+ L+
Sbjct: 240 FVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLI 299

Query: 308 VRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRV 367
           V Y+D +LI  GS  NA +SPFV+A+  AG KVLP I+N +I+ +  SAGN  I  GSR 
Sbjct: 300 VPYND-KLIATGSG-NARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRN 357

Query: 368 LYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSG 427
           L+ L     AP    +T+ RG+P+V VL  S F  L Y++ S  S +VF W   + + + 
Sbjct: 358 LFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNT 417

Query: 428 FFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
              W+LIS +HI   + L+ +G SR DLP+     PY A+++     + +L  GF  F  
Sbjct: 418 LLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFI- 476

Query: 488 FSAVDFVAYYISAFIFVVIWLLFQF--LFK 515
               D  +++   FI  +   LF F  LFK
Sbjct: 477 HGNFDIESFFSRYFIIPLAIALFTFWKLFK 506

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  278 bits (711), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 169/510 (33%), Positives = 276/510 (54%), Gaps = 15/510 (2%)

Query: 11  DGSSSSTITAKPGAIKAEVLNHNTSEVES-LCEKPNQ-SDVKRELKPRHVTMXXXXXXXX 68
           DGSS S       + K       TS++ES L E P + SD+K+ +K RHV +        
Sbjct: 77  DGSSRSPFGKFVDSFKRVDEKQTTSDLESGLGEVPGENSDLKQTIKKRHVLLISLGTGIG 136

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVS 127
                  A  +R+AGP G ++ Y  + +  YC+ Q+ GE+A  +  + S+F ++ +  V 
Sbjct: 137 TGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVD 196

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
            A G A  ++Y L W     LE+      I YW+ +V    +++IF+VL+  IN    + 
Sbjct: 197 KAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARG 256

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTA 246
           Y E EF+  S KV+ +  F   G+++ CGG+   G IG +YW  PG +     +      
Sbjct: 257 YAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYWHSPGAF-----NGNRPID 311

Query: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306
            F G +++   AAF F  +E + +TA E  NPR+ +PKA   + +RIL  ++ S+ +IG 
Sbjct: 312 HFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGF 371

Query: 307 LVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSR 366
           LV Y+ P L+  GS     ASP+VVA+ + G +V+P  +N VI+++++S GNS  Y  SR
Sbjct: 372 LVPYNSPYLLGSGSDAT-KASPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSR 430

Query: 367 VLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVS 426
           +L  L + G AP   +    RG P VA++ +++F  + +   S K   VF WLL+I+ +S
Sbjct: 431 LLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLS 490

Query: 427 GFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFT 486
             FTW+ I +SH+RF + LK +G S  ++ FK++   YG+ YAA  +I+ ++ Q + A  
Sbjct: 491 QLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALA 550

Query: 487 P-----FSAVDFVAYYISAFIFVVIWLLFQ 511
           P       A +F   Y++  I +V++  ++
Sbjct: 551 PIGGNGLDARNFFQNYLAMPILLVLYFGYK 580

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  277 bits (708), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 158/489 (32%), Positives = 267/489 (54%), Gaps = 15/489 (3%)

Query: 33  NTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYI 92
           N  + +   +K N + +++ ++PRHV M                + + NAGP G L+ YI
Sbjct: 65  NNIKSDQFNDKLN-NQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYI 123

Query: 93  FVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEIS 151
            +A+  YC+ Q+ GEMA  ++ +   F  + S  V  A   A  ++Y + W     LE+ 
Sbjct: 124 IMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELV 183

Query: 152 VIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKVIAILCFLFYG 210
                I YW++ V    ++ IF++L+ AINL    + Y E EF+    K++ I  F   G
Sbjct: 184 TASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILG 243

Query: 211 LVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHT--AQFLGWVSSLIKAAFTFQGTEL 267
           ++++CGG+   G IG  YW +PG +         HT   +F G VS+L+ AAF+F  TE 
Sbjct: 244 IILICGGAGTSGYIGVSYWNNPGAF-------RGHTPGTRFKGIVSTLVTAAFSFGQTEF 296

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS 327
           + +TA E  NPR+ +P A   V +R L  Y+GS++++G LV Y+ P+L+   S+    AS
Sbjct: 297 LAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSS-QTKAS 355

Query: 328 PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSR 387
           P+V+A+ + G ++ P  +N VI+++++S  NS+ Y  SR+L  L + G AP   +    +
Sbjct: 356 PYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRK 415

Query: 388 GVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKK 447
           G P   ++A S+   + +   S K   VF WLL+I+ +S  FTW  I +SHIRF + +K 
Sbjct: 416 GRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKI 475

Query: 448 RGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDF-VAYYISAFIFVVI 506
           +G S ++L +K++   +G+ YAA  + +I++ Q + A  P ++    +  +   ++ + I
Sbjct: 476 QGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPI 535

Query: 507 WLLFQFLFK 515
            LLF F +K
Sbjct: 536 LLLFYFGYK 544

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  277 bits (709), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 159/497 (31%), Positives = 272/497 (54%), Gaps = 21/497 (4%)

Query: 29  VLNH----NTSEVE-SLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           +L+H    +T+ VE S  +      +K+ ++PRHV M                + + +AG
Sbjct: 74  ILSHESVFDTAVVEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAG 133

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSW 142
           P G ++ Y  ++T  YCV Q++GEMA  ++ +   F+ +    + P L  A  ++Y + W
Sbjct: 134 PAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQW 193

Query: 143 CITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKVI 201
                LE+      I YW+  V    ++ IF++L+  IN+    + Y E EF+    K++
Sbjct: 194 FCVCPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKIL 253

Query: 202 AILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAF 260
            +  F   G++++CGG+   G IG RYW  PG +       +    +F G VS+L+ AAF
Sbjct: 254 MMTGFFILGIILICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAF 308

Query: 261 TFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGS 320
            F GTE + +TA E  NPR+ +P A   V +R L+ Y+GS++++G LV Y+  +L+  GS
Sbjct: 309 AFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELL--GS 366

Query: 321 TTNA-NASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379
           +  A  ASP+V+A+ + G +V+P  +N VI++++ S  +S  Y  SR+L  L R G AP 
Sbjct: 367 SGPATKASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPK 426

Query: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439
             +    RG P +  +  ++   + +   SSK   VF+WLLSI+ +S  FTW +IS+SHI
Sbjct: 427 IFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHI 486

Query: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFV 494
           RF + +K +G S D++ FK++   +G+ YA   +I++++ Q +    P       AV F 
Sbjct: 487 RFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFF 546

Query: 495 AYYISAFIFVVIWLLFQ 511
             Y++  +F+V++  ++
Sbjct: 547 QAYLAMPVFIVLYFGYK 563

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  278 bits (712), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 155/487 (31%), Positives = 263/487 (54%), Gaps = 19/487 (3%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           +  NQ ++K+ +KPRH+ M               +  + NAGP G ++ Y  + +  YC+
Sbjct: 136 QDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCI 195

Query: 102 TQSLGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
            Q+ GE+A  +  +   F  + S  V PALG +  ++Y L W     LE+      I YW
Sbjct: 196 IQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYW 255

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL 220
           +  V    ++ IF+VL+  IN+   K Y E +F+    K++ I+ F    +++ CGG+  
Sbjct: 256 TVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGT 315

Query: 221 -GRIGFRYWKDPGPW--GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKN 277
            G IG RYW +PG +    GI        +F G V++ + AAF F  +E + +TA E  N
Sbjct: 316 DGYIGSRYWHNPGAFRGNTGI-------QRFKGVVATFVTAAFAFGMSEQLAMTASEQSN 368

Query: 278 PRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAG 337
           PR+ +P A   + +RIL  ++GSL+++G LV Y   QL+   S +   ASP+V+A+ + G
Sbjct: 369 PRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLL-GASGSATKASPYVIAVASHG 427

Query: 338 TKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLAT 397
            +V+P  +N VI+++++S  N   Y  SR+L  L + G AP         G P VA+L +
Sbjct: 428 VRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVS 487

Query: 398 SMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPF 457
           S+FG + +   S K   VF WLL+I+ +S  FTW+ I +SHIRF + +K +G S  ++ +
Sbjct: 488 SIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGY 547

Query: 458 KAKFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAYYISAFIFVVIWLLFQ 511
           K++   +G+ YA   +++ ++ Q + A +P       SA  F   Y++  I + +++ ++
Sbjct: 548 KSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYK 607

Query: 512 FLFKGRW 518
            ++K  W
Sbjct: 608 -VWKKDW 613

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  276 bits (706), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 162/487 (33%), Positives = 262/487 (53%), Gaps = 17/487 (3%)

Query: 6   YEPKGDGSSSSTITAKPGA-IKA-EVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXX 63
           Y+   D + S       G+  KA E L+  + EVE    + N     ++L  RH+     
Sbjct: 32  YDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQDARYN-----KDLSVRHLLTLAV 86

Query: 64  XXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFAS 123
                        + +   GP   ++ ++ ++T  + +  +LGE+++  PV   F V+ S
Sbjct: 87  GGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYIS 146

Query: 124 RFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLI 183
           RFV P+ G A    Y   W +   LE+      I YW+  +   AW+AIF+ ++   NL+
Sbjct: 147 RFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLL 206

Query: 184 PVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQE 242
            VK +GE EF ++ +K++AI+ F   G+V+ CGG   G     +YW +PG + VG     
Sbjct: 207 DVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAF-VG----- 260

Query: 243 IHTA--QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
            HTA  +F G  S  + AAF++ GTEL+ V+A E+ NPR T+PKA    F+ I + YI  
Sbjct: 261 -HTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVV 319

Query: 301 LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
           L ++G LV  DDP+L+   S+ +  ASP V+AI   G K LP +MN +I++ ++S  NS 
Sbjct: 320 LTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSA 379

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           +Y  SR +  + + G  P   +    +G P  A++AT +FG L ++  S K   VF WL 
Sbjct: 380 VYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLS 439

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           +++ +S  F W  I+VSHIRF + +K+RG + D+LPF +    +G+YY    + ++++V 
Sbjct: 440 ALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVC 499

Query: 481 GFTAFTP 487
            +T+  P
Sbjct: 500 FWTSLFP 506

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  276 bits (705), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/477 (33%), Positives = 261/477 (54%), Gaps = 14/477 (2%)

Query: 43  KP--NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYC 100
           KP  + S +K+ +K RHV M               AS +   GP   ++ Y+ V+ + Y 
Sbjct: 67  KPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYF 126

Query: 101 VTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILY 159
           + Q+ GEMA   P +  +F  + S F+S   G A  +L+++ W   F LE+      I Y
Sbjct: 127 MIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKY 186

Query: 160 WSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS- 218
           W+D +    ++ IF+V L  I+   VK YGE EF   S KV+ I  F+   +V+ CGG+ 
Sbjct: 187 WNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAG 246

Query: 219 KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNP 278
           K G IG +YW+DPG +  G   +     +F G    L+ A F++ G EL  ++  E +NP
Sbjct: 247 KDGYIGAKYWRDPGSFAEGDSVE-----KFKGICYILVTAYFSYGGAELFSLSVNEQENP 301

Query: 279 RRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGT 338
           R++ P+A     +RIL+ Y+ ++++IG  V +++ QL+  G +   +ASP+V+A +  G 
Sbjct: 302 RKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSAT-HASPYVLAASIHGV 360

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           KV+P  +N VI++++IS  NS +Y   R++  L   G AP F+      G P  A++  +
Sbjct: 361 KVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCA 420

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
           +FG +G+++ SSK   VF WL +I  +S  FTW  I +SH+RF QC+K  G S +++ F+
Sbjct: 421 VFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFR 480

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAFTPFS---AVDFVAYYISAFIFVVIWLLFQF 512
           A    +G+ Y   F +++ + Q + A  P S    VD  +++ S ++   IWL F F
Sbjct: 481 AVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQS-YLAAPIWLFFYF 536

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  273 bits (697), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 155/472 (32%), Positives = 255/472 (54%), Gaps = 19/472 (4%)

Query: 25  IKAEVLNHNTSEVESLCEKP---------NQSDVKRELKPRHVTMXXXXXXXXXXXXXXX 75
           +K+++   N  E E  C            +++ +K+ LK RH+ M               
Sbjct: 15  VKSKICETNVDEQELECGSETAKQGVLYNDRTRLKQGLKERHIKMLTLVGVFGTGLFLSS 74

Query: 76  ASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANG 135
              ++  GPVG L+AY+FV  +  C   ++ E+A+F+P T +    A +F+  ++G   G
Sbjct: 75  GGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFG 134

Query: 136 YLYWLS-WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFW 194
              W+S +      E+S    ++ YW+D  P   ++ +F VL  A N+  ++FYGE E+ 
Sbjct: 135 ---WISTYSSLMPGELSATAVIMKYWTDVSP-AVFITVFGVLFVATNIYTIRFYGEIEYV 190

Query: 195 IASLKVIAILCFLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVS 253
              LK++ I   +  GLV+  GG K   R+GF YW+DPGP+   +V+   H  +F+G+ +
Sbjct: 191 FGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANYLVAG--HIGKFVGFWA 248

Query: 254 SLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDP 313
           ++    +++ G + + + AGETKN R  +      VF RI++ Y+ ++ V+ L+V Y+D 
Sbjct: 249 AISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTVFVLTLIVPYND- 307

Query: 314 QLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGR 373
           +LI  G+ T A +SPFV+A+N AG KVLP I+N +I+ +  SAGN  I  GSR L+ L  
Sbjct: 308 KLIATGTGT-AKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLAT 366

Query: 374 SGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLL 433
              AP    +T+ RG+PYV V+  S F  L Y++ S  S +VF W   + + +    W+L
Sbjct: 367 KNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQELVSSNTLLRWIL 426

Query: 434 ISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF 485
           IS +HI   + LK +G SR DLP   +  P+ A+++    ++ +   GF  F
Sbjct: 427 ISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGFYNF 478

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  274 bits (701), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 171/509 (33%), Positives = 273/509 (53%), Gaps = 21/509 (4%)

Query: 15  SSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXX 74
            + ++ K   +  E+    T++     E   + D+ R LKPR V M              
Sbjct: 16  KTDLSPKENHVVCELDPSFTTDENYDPEANIREDLTRALKPRVVNMISIAGIIGTGLYLS 75

Query: 75  XASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAAN 134
            +  +   GP    + Y  +  + Y    +LGEM+T++P++ SF V+A +F S +   A 
Sbjct: 76  TSKSLHTGGPASLFMNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACAL 135

Query: 135 GYLYWLSWCITFALEISVIGRLILYW---SDAVPITAWMAIFWVLLTAINLIPVKFYGEF 191
            + YW +  ++ A +++ +  ++ YW       P  A   IFW ++  +N+I V+FYGE 
Sbjct: 136 MWNYWFNDAVSVASDLTALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEA 195

Query: 192 EFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYW-KDPGPWGVGIVSQEIHTAQFL 249
           E+W+A LK+IAI+ F    +VV  G + +   IGF+ W +   P+  GI           
Sbjct: 196 EYWLAMLKIIAIIIFFILSIVVNVGKNPQHEYIGFKNWTRGEAPFVDGIK---------- 245

Query: 250 GWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVR 309
           G+ S  + A+F + GTE + +T GE +NP R  PK + TVF+RIL+FY+GS   I + + 
Sbjct: 246 GFASLFVSASFAYGGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIP 305

Query: 310 YDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLY 369
           YD P L      T    SPF +    AGTK     MN VIM ++ISA N  ++ GSR++Y
Sbjct: 306 YDYPGLDSKSIVT----SPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIMY 361

Query: 370 GLGRSGLAPA-FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGF 428
            +G  G  PA  +SRT    VPYV+VL T+  GAL +      +G+++ WL +I  VS  
Sbjct: 362 NMGLEGFLPARIVSRTNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQ 421

Query: 429 FTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF 488
             WL I ++ IRF + L+K+G +  +L +K    PYG Y+   FV  IIL+QG++AF P+
Sbjct: 422 IAWLCIGITSIRFRKGLEKQGKTH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAPW 480

Query: 489 SAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
           +  +F +YY+  F+F V ++++  + + R
Sbjct: 481 NVSNFFSYYLELFVFPVCFIIWWLVKRDR 509

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  276 bits (706), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/506 (31%), Positives = 266/506 (52%), Gaps = 15/506 (2%)

Query: 14  SSSTITAKPGAIKAE-VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXX 72
           S +   +  G I+ + +++ +  +  S+        +K+ L+ RHV +            
Sbjct: 70  SKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLL 129

Query: 73  XXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV-----FASRFVS 127
              +S +   GP G  ++YI ++ + Y +  +LGEM  F+P   S +        +R+V 
Sbjct: 130 VGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVD 189

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
           P+LG A G+ Y+  + I  A E +    ++ YW+ AVP   W+ IF  ++  +N   VK 
Sbjct: 190 PSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKV 249

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVV-CGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTA 246
           YGE EFW AS+K++ I+  +    ++   GG    R+GFRYW+ PG +   +    +   
Sbjct: 250 YGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL--G 307

Query: 247 QFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIG 305
            F    + +IK AF F  G ELV +T+ E  + RR + KA     +R++ FY+   L I 
Sbjct: 308 NFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAIS 367

Query: 306 LLVRYDDPQLIQD--GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363
           ++V Y+DP L+         A +SPFV+ I  AG KVLP I+NG I+ +  SA N+ ++ 
Sbjct: 368 VIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFA 427

Query: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423
            +R L  + ++G AP  + R    GVPYVAV  + +   L YLNVSS +  VF+W  +I+
Sbjct: 428 STRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNIS 487

Query: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483
            +SGF  W+   ++++RF + +   G+  D LPFK    PY  +++   + +I +  G+ 
Sbjct: 488 TISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYA 546

Query: 484 AFTP--FSAVDFVAYYISAFIFVVIW 507
            F P  +   DF+A YI+  IF+V+W
Sbjct: 547 IFIPKYWRVADFIAAYITLPIFLVLW 572

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  277 bits (708), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 160/519 (30%), Positives = 274/519 (52%), Gaps = 24/519 (4%)

Query: 11  DGSS--SSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXX 68
           D SS   + +  K   I  + +  ++ E E     P Q ++K+ +KPRH  M        
Sbjct: 110 DSSSRLDNELNPKSSYITVDGIKQSSQEQE-----PKQENLKKSIKPRHTVMMSLGTGIG 164

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMAT-FIPVTSSFTVFASRFVS 127
                  +  + NAGP G ++ Y  + +  YC+ Q+ GE+A  +  +   F  + S  V 
Sbjct: 165 TGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVD 224

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
           PA+G +  +L+ L W     LE+      I YW+  V    ++ IF+VL+  IN+   K 
Sbjct: 225 PAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKG 284

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTA 246
           Y E +F+    K++ I  F    +++ CGG+   G IG RYW+DPG +       +    
Sbjct: 285 YAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF-----RGDTSIQ 339

Query: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306
           +F G V++ + AAF F  +E + +TA E  NPR+ +P A   + +RIL  ++ SL ++G 
Sbjct: 340 RFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGF 399

Query: 307 LVRYDDPQLI-QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGS 365
           LV Y   QL+   GS T A  SP+V+A+++ G +V+P  +N VI+++++S  NS  Y  S
Sbjct: 400 LVPYTSDQLLGAAGSATKA--SPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSS 457

Query: 366 RVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAV 425
           R+L  L + G AP         G P VA++ +++FG + +   S K   VF WLL+I+ +
Sbjct: 458 RILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGL 517

Query: 426 SGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF 485
           S  FTW+ I +SHIRF + +K +G S  ++ +K++   +G+ YA   +++ ++ Q + A 
Sbjct: 518 SQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAI 577

Query: 486 TP------FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           +P       SA  F   Y++  I + +++ ++ ++K  W
Sbjct: 578 SPIGGDKKLSAQSFFENYLAMPILIALYIFYK-VWKRDW 615

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  275 bits (704), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 180/500 (36%), Positives = 285/500 (57%), Gaps = 13/500 (2%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           I+ E ++ N +++E +  K  +S ++ +LK RH+ M                  +R AGP
Sbjct: 64  IEVEEVDPNLTDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGP 123

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
            G L+ +    TM + +  +LGE+A   PV+  F  +A+RF+  + G AN + Y   W +
Sbjct: 124 AGILIGWGITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLV 183

Query: 145 TFALEISVIGRLILYWSDAVPIT-AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
              LEI      + YW   V  T  ++A+FW+++  IN+  V+ YGE EF  + +KVIA+
Sbjct: 184 ALPLEIVAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAV 243

Query: 204 LCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
           + F+  G+++VCGG  +G     RYW DPG +     +      +F G+ S  + AAF+F
Sbjct: 244 IGFIILGIILVCGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSF 298

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            G+ELVG+ + E+KNPR++VP+A   VF+RILLFYI  LL++GLLV Y DP+L+   S  
Sbjct: 299 AGSELVGIASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLL-GSSGV 357

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
           +A+ASPFV+AI   G   LP ++N VI+++++S GNS+IY  SR L  L   G  P  ++
Sbjct: 358 DASASPFVIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVA 417

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
               +G P V +   S FG + ++  S+K   +F+WLL+I+ +S F TW  I   HIRF 
Sbjct: 418 YIDRKGRPLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFR 477

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYI 498
             LK  G S D+LPFK+     G+Y+     +++++ Q + A  P     +A DF + Y+
Sbjct: 478 SALKVNGRSDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYL 537

Query: 499 SAFIFVVIWLLFQFLFKGRW 518
           +A I +  ++  + L+K  W
Sbjct: 538 AAPIVLAFYIAHK-LWKRNW 556

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  276 bits (707), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 153/486 (31%), Positives = 261/486 (53%), Gaps = 17/486 (3%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           ++  Q ++K+ +KPRH  M               +  + NAGP G ++ Y  + +  YC+
Sbjct: 138 QEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCI 197

Query: 102 TQSLGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
            Q+ GE+A  +  +   F  +    V PALG +  +L+ L W     LE+      I YW
Sbjct: 198 IQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYW 257

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL 220
           +  V    ++ IF+VL+  IN+   K Y E +F+    K++ I+ F    +++ CGG+  
Sbjct: 258 TVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGT 317

Query: 221 -GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
            G IG +YW+DPG +       +    +F G V++ + AAF F  +E + +TA E  NPR
Sbjct: 318 DGYIGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPR 372

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI-QDGSTTNANASPFVVAINAAGT 338
           + +P A   + +RIL  ++ SL ++G LV Y   QL+   GS T A  SP+V+A+++ G 
Sbjct: 373 KAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKA--SPYVIAVSSHGV 430

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           +V+P  +N VI+++++S  NS  Y  SR+L  L + G AP         G P VA+L ++
Sbjct: 431 RVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSA 490

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
           +FG + +   S K   VF WLL+I+ +S  FTW+ I +SHIRF + +K +G S  ++ +K
Sbjct: 491 LFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYK 550

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAYYISAFIFVVIWLLFQF 512
           ++   +G+ YA   +++ ++ Q + A  P       SA  F   Y++  I + +++ F+ 
Sbjct: 551 SQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFK- 609

Query: 513 LFKGRW 518
           ++K  W
Sbjct: 610 VWKNDW 615

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  275 bits (704), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 163/520 (31%), Positives = 278/520 (53%), Gaps = 13/520 (2%)

Query: 6   YEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKP-NQSDVKRELKPRHVTMXXXX 64
           ++   +G ++ ++      +  +     T    ++C+   N S + + L  RH+      
Sbjct: 65  FKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVG 124

Query: 65  XXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASR 124
                       + +   GP   L+A+  ++T  + +  SLGE+A+  PV   F V+ +R
Sbjct: 125 GAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITR 184

Query: 125 FVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP 184
           FV P+ G A    Y   W +   LE++     I YW++ +   AW+AIF+V +   N++ 
Sbjct: 185 FVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLD 244

Query: 185 VKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEI 243
           VK +GE EF ++ +K++AI  F   G V++CGG  +G     +YW DPG + VG    + 
Sbjct: 245 VKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF-VG----DT 299

Query: 244 HTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLV 303
             AQF G  S  + AAF++ GTELVGV+A E+ NPR T+P+A    F+ I   Y+  L +
Sbjct: 300 PGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTI 359

Query: 304 IGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363
            G LV  +DP+L+   S+ +  ASP V+AI   G + +P +MN +I++ IIS  NS++Y 
Sbjct: 360 AGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYA 419

Query: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423
            SR +  + + G  P   +    +G P VA+LAT +FG L ++  S K  ++F WL +++
Sbjct: 420 CSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALS 479

Query: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483
            +S  F W  I++SHIRF + +  +  S D+LP+ +     G++Y A  ++ ++++  +T
Sbjct: 480 GLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWT 539

Query: 484 AFTP-----FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           +  P      SA  F   Y+S  IF++ ++  + L+K  W
Sbjct: 540 SLFPPGSSGPSAESFFEGYLSFPIFLICYISHK-LYKRDW 578

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  275 bits (702), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 165/513 (32%), Positives = 266/513 (51%), Gaps = 21/513 (4%)

Query: 8   PKGD------GSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMX 61
           PK D         SS +      I +    H+  +V+   E  N +++ +EL  RH+   
Sbjct: 41  PKTDSGFPLSAKGSSGVNQTTNDITSSGRFHSDDDVQQ--EDINNTNLSKELSVRHLLTL 98

Query: 62  XXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVF 121
                          + +   GP   ++ ++ ++T  + V  SLGE++   PV   F V+
Sbjct: 99  AVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVY 158

Query: 122 ASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAIN 181
           + RFV P+   A    Y   W +   LE+      I YW+D +   AW+AIF+  +   N
Sbjct: 159 SMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMAN 218

Query: 182 LIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVS 240
           ++ VK +GE EF ++ +K++AI+ F   G+V+ CGG   G     +YW DPG +    V 
Sbjct: 219 MLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAF----VG 274

Query: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
            +  T +F G  S  + AAF++ G E+  V+A E+KNPR T+PKA    F+ I + Y+  
Sbjct: 275 HDSGT-KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTI 333

Query: 301 LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
           L +IG LV  +DP+L+   S+ +A +SP V+AI     K LP +MN +I++ ++S  NS 
Sbjct: 334 LTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSA 393

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           +Y  SR +  +   G  P F+ R   RG P  A++ T  FG L ++  S K   VF WL 
Sbjct: 394 VYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLS 453

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           +++ +S  F W+ I++SHIRF Q +K +  S D+LPF ++   +G+ Y  F V+ ++L+ 
Sbjct: 454 ALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIY-GFVVLFLVLIA 512

Query: 481 GF-TAFTPF-----SAVDFVAYYISAFIFVVIW 507
            F T+  P      +A  F   Y+S  I +V +
Sbjct: 513 SFWTSMFPIGSSGANAESFFEGYLSFPILIVCY 545

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  272 bits (696), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 172/521 (33%), Positives = 264/521 (50%), Gaps = 32/521 (6%)

Query: 15  SSTITAKPGAIKAEVLNHNTSEVESLCE--------KPNQS---DVKRELKPRHVTMXXX 63
           SS+I+ +  A+K +       EV S  +         P Q+   D+ R L PRH+ M   
Sbjct: 2   SSSISDRE-AVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISI 60

Query: 64  XXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFAS 123
                       A  + N GP    + Y  +  + Y     LGEM+TF+P++ SF  +A 
Sbjct: 61  AGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYAR 120

Query: 124 RFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA---VPITAWMAIFWVLLTAI 180
           +F S +   A  + YW +  ++ A +++ +  ++ YW  A    P      IFW  +  +
Sbjct: 121 KFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFL 180

Query: 181 NLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIV 239
           N+I V+ YGE E+W+A LKVIAI+ F    ++V  G + +   IGF+ W           
Sbjct: 181 NVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTH--------- 231

Query: 240 SQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIG 299
            +      F G+ S  + A F + GTE + +T GE  NP R  PK + TVF+RIL+FY+ 
Sbjct: 232 GEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVL 291

Query: 300 SLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNS 359
           S   IG+ + YD P L    ST +   SPF +    AGT+     MN VI+ ++ISA N 
Sbjct: 292 STFFIGMNIPYDYPGL----STKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNH 347

Query: 360 NIYVGSRVLYGLGRSGLAP-AFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW 418
            ++ GSR++Y +   G  P   + RT     PYVAVL T   G L        +G+++ W
Sbjct: 348 ALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTW 407

Query: 419 LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL 478
           L +I  VS    WL I ++ IRF + L+ +G   D L FK    P+G Y+   F + IIL
Sbjct: 408 LQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIIL 466

Query: 479 VQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWF 519
           +QG+ AF P+S  DF + Y+  F+F  +++++ +L+K  WF
Sbjct: 467 IQGWQAFDPWSVTDFFSVYLELFVFPFVYIIW-WLWKRDWF 506

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  275 bits (702), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 165/506 (32%), Positives = 264/506 (52%), Gaps = 15/506 (2%)

Query: 14  SSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQ-SDVKRELKPRHVTMXXXXXXXXXXXX 72
           S +   +  G I+ +++     E     E  N+   +K+ L+ RHV +            
Sbjct: 74  SKNHSASSNGTIREDLIMDVDVEKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLL 133

Query: 73  XXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV-----FASRFVS 127
              +S +   GP G  ++YI ++ + Y +  +LGEM  F+P   S +        +R+V 
Sbjct: 134 VGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVD 193

Query: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
            +LG A G+ Y+  + I  A E +    ++ YW+ AVP   W+ IF  ++  +NL  VK 
Sbjct: 194 ASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKV 253

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVV-CGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTA 246
           YGE EFW AS+K++ I+  +    ++   GG    R+GFRYW+ PG +   +    +   
Sbjct: 254 YGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL--G 311

Query: 247 QFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIG 305
            F    + +IK AF F  G ELV +T+ E  + RR + KA     +R++ FY+   L I 
Sbjct: 312 NFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAIS 371

Query: 306 LLVRYDDPQLIQD--GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363
           ++V Y+DP L+         A +SPFV+ I  AG KVLP I+NG I+ +  SA N+ ++ 
Sbjct: 372 VIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFA 431

Query: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423
            +R L  + ++G AP  + R    GVPYVAV  + +   L YLNVSS +  VF+W  +I+
Sbjct: 432 STRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNIS 491

Query: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483
            +SGF  W+   ++++RF + +   G+  D LPFK    PY  + +   V +I L  G+ 
Sbjct: 492 TISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYA 550

Query: 484 AFTP--FSAVDFVAYYISAFIFVVIW 507
            F P  +   DF+A YI+  IF+V+W
Sbjct: 551 IFIPKYWKIADFIAAYITLPIFLVLW 576

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 154/484 (31%), Positives = 258/484 (53%), Gaps = 11/484 (2%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           +  N  ++ + L  RH+                  + + + GP   ++ +I ++T  + V
Sbjct: 68  DDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTV 127

Query: 102 TQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS 161
             +LGEMA   PV   F V+ +RF+ P++G A    Y   W +   LE+      I YW+
Sbjct: 128 INALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWN 187

Query: 162 DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLG 221
           + +   AW+AIF+ ++   N++ VK +GE EF ++ +K++AI+ F   G+V+ CGG   G
Sbjct: 188 ETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHG 247

Query: 222 RIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRR 280
                +YW  PG + VG  S      +F G  S  + AAF++ G E+  V+A E+K+PR 
Sbjct: 248 GFIGGKYWNHPGSF-VGHNSG----TKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRT 302

Query: 281 TVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKV 340
           T+PKA    F+ I   Y+  L +IG LV YDDP+L+   S+ +A +SP V+AI   G K 
Sbjct: 303 TIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKG 362

Query: 341 LPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMF 400
           LP +MN +I+++IIS  NS +Y  SR +  +   G  P  ++R  ++G P  A++ T  F
Sbjct: 363 LPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFF 422

Query: 401 GALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAK 460
           G L ++  S +   VF WL +++ +S  F W+ I++SHIRF Q + K+  S D+LPF ++
Sbjct: 423 GLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQ 482

Query: 461 FMPYGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFVVIWLLFQFLFK 515
              +G++Y    + ++++   +T+  P       A  F   Y+S  I +  +   +   +
Sbjct: 483 TGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVR 542

Query: 516 GRWF 519
            R F
Sbjct: 543 KREF 546

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 151/464 (32%), Positives = 245/464 (52%), Gaps = 6/464 (1%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           I+ E L +    V +      Q  +K+ +K RH+TM                  +   GP
Sbjct: 52  IREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGP 111

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
            G ++ Y+  +TM YCV Q+  E+  ++  +  ++  + S  V      A  ++Y L W 
Sbjct: 112 GGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWA 171

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
           I   LE+      I YW+D++    ++AIF+  +  I+    + Y E EF   S KV+ +
Sbjct: 172 IVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMM 231

Query: 204 LCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
           + F+  G+ V CG SK G IG +YW  PG + VG    E     F G  S  +++AF + 
Sbjct: 232 VGFIIMGISVNCGASKSGYIGGKYWHTPGAF-VG----EKAIDHFKGICSVWVQSAFAYG 286

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           G+E + +TA E  NPR++VPKA     +R+L+ ++  ++++G LV YD P L+       
Sbjct: 287 GSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAA 346

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
           ++ASPFV+A  + G KV+P I+N VI++++IS GNS  Y   R+L  L   G+ P   + 
Sbjct: 347 SHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTY 406

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
              +G P V +L  ++FG + ++  S    +VF WL +I ++S  FTW  IS+SHIRF  
Sbjct: 407 VDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRD 466

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
            +K +G S  +L +KA    +G++YA  F I+++  Q + A  P
Sbjct: 467 AMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAP 510

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 161/498 (32%), Positives = 263/498 (52%), Gaps = 15/498 (3%)

Query: 20  AKPGAIKAEVLNHNTSEVESLCEK-PNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASP 78
           A+      + +N NTS++E       + S +K+ +K RHV M               A  
Sbjct: 61  AEGSTTHTKQINENTSDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKG 120

Query: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYL 137
           +   GP   ++ Y  V+ + Y + Q+ GEMA   P + ++F  ++S F+S   G A  ++
Sbjct: 121 LHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWV 180

Query: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197
           Y   W     LE+      I +W+D +    ++ IF+V L  I+   VK YGE EF    
Sbjct: 181 YCFQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNC 240

Query: 198 LKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256
            K++ I  F+   +V+ CGG+   G IG +YW++PG +     + +    +F      L+
Sbjct: 241 CKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILV 295

Query: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316
            A F+F G EL  ++  E  NPR+T P A     +RIL+ Y+ ++++IG  V Y+D QL+
Sbjct: 296 TAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLM 355

Query: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
             G +   +ASP+V+A +  G KV+P I+N VI++++IS  NS++Y G R++  L + G 
Sbjct: 356 GAGGSA-THASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGY 414

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
            P F+      G P +A++  S+FG +G++  SSK   VF WL +I  +S  FTW  I +
Sbjct: 415 GPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIML 474

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF------SA 490
           SH+RF Q +K +G S D+L +KA    +G+ Y  FF I++ + Q + A  P       SA
Sbjct: 475 SHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSA 534

Query: 491 VDFVAYYISAFIFVVIWL 508
             F   Y++  I++  +L
Sbjct: 535 ESFFQSYLAFPIWIAFYL 552

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 162/534 (30%), Positives = 276/534 (51%), Gaps = 27/534 (5%)

Query: 2   TNI-IYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTM 60
           TNI +Y+     +    ++ +   I +EV      ++ES  ++ +  ++K  L+ RH+ +
Sbjct: 14  TNISVYDKNDKNNIKDGVSFEKPIIYSEV------DIESGAKESSSRNLKHGLQSRHIQL 67

Query: 61  XXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSS--- 117
                          +S + N GP   +++YI ++T+ Y +    GEM  ++P       
Sbjct: 68  IALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDE 127

Query: 118 ----FTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIF 173
                    S++V  +LG A  + Y+  + +  A E +    ++ YW+  +P    + +F
Sbjct: 128 SVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLF 187

Query: 174 WVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR----IGFRYWK 229
             ++  +N +PVKFYGE EFW A +K+  I   +    V+ CGG+        +GF YWK
Sbjct: 188 LGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWK 247

Query: 230 DPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINT 288
           +P  +   + +  +    FL   ++LIK AF F  G ELV +T+ E  + RR + KA   
Sbjct: 248 NPSSFRDYVTNGSL--GNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRR 305

Query: 289 VFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN--ANASPFVVAINAAGTKVLPDIMN 346
             +R++ FYI   L I ++V Y+DP L+   +     A +SPFV+ I  AG  +LP I+N
Sbjct: 306 FVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIIN 365

Query: 347 GVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYL 406
             I+ + +SAGN+ ++  +R L  +G++G AP   SR    GVPYVA+  + M   L +L
Sbjct: 366 FCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFL 425

Query: 407 NVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGA 466
           N S+ S  VF W  +I+ +SGF  W    ++++RF + +   G+  D LPFK K   Y  
Sbjct: 426 NCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLT 484

Query: 467 YYAAFFVIVIILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           +Y+  FV ++IL  G+    P  ++  DF+A YI+  +F+V++     ++ GRW
Sbjct: 485 WYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLY-FGHIIYSGRW 537

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  273 bits (698), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/499 (32%), Positives = 263/499 (52%), Gaps = 13/499 (2%)

Query: 20  AKPGAIKAEVLNHNTSEVESLCEK-PNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASP 78
           A+    + + +N NTS++E   E   + S +K+ +K RHV M               A  
Sbjct: 61  AEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120

Query: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYL 137
           +   GP   ++ YI V+ + Y + Q+ GEMA   P + ++F  ++S F+S + G A  +L
Sbjct: 121 LHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWL 180

Query: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197
           Y   W     LE+      I +W+D +    ++ IF+V L  I+   VK YGE EF    
Sbjct: 181 YCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNC 240

Query: 198 LKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256
            K++ I  F+   +V+ CGG+   G IG  YW +PG +     + +    +F      L+
Sbjct: 241 CKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILV 295

Query: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316
            A F+F G EL  ++  E  NPR++ P A     +RI++ Y+ ++++IG  V Y+D QL+
Sbjct: 296 TAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM 355

Query: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
             G +   +ASP+V+A +  G K++P I+N VI+++++S  NS++Y G R++  L + G 
Sbjct: 356 GAGGSA-THASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGY 414

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
           AP F+      G P  A++   +FG + ++  SSK   VF WL +I  +S  FTW  I +
Sbjct: 415 APKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIML 474

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF---SAVDF 493
           SH+RF Q +K +G S D+L +KA    +G+ Y  FF I++ + Q + A  P       D 
Sbjct: 475 SHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDA 534

Query: 494 VAYYISAFIFVVIWLLFQF 512
            +++ +   F  IWL F F
Sbjct: 535 ESFFQNYLAF-PIWLAFYF 552

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/492 (31%), Positives = 259/492 (52%), Gaps = 19/492 (3%)

Query: 1   MTNIIYEPK-GDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVT 59
           MT  + + K  +G S   I   P            SE  S+ ++    ++ ++L  RH+ 
Sbjct: 55  MTTYVTDSKTKEGGSEKNIETTP------------SEQFSIAKEDINENLNKDLSIRHLI 102

Query: 60  MXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFT 119
                            + + + GP   ++ ++ ++T  + V  +LGE+A   PV   F 
Sbjct: 103 TLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFN 162

Query: 120 VFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTA 179
           V+ +RFV P++  A    Y   W +   LE+      I YW+D +   AW+AIF+ ++  
Sbjct: 163 VYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIAL 222

Query: 180 INLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGI 238
            N++ VK +GE EF ++ +K++AI+ F   G+V+ CGG   G      YW DPG + VG 
Sbjct: 223 ANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF-VG- 280

Query: 239 VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI 298
              +    QF G  S  + AAF++ G EL  V+A E+K+PR+T+PKA    F+ +   Y+
Sbjct: 281 ---DKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYV 337

Query: 299 GSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN 358
             L +IG LV +DDP+L+   S+ +A ASP V++I  AG K L  +MN +I+++I+S  N
Sbjct: 338 TILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVAN 397

Query: 359 SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW 418
           S +Y  SR +  +   G  P  +SR   RG P  A+L+T  FG L ++  S K   VF W
Sbjct: 398 SAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTW 457

Query: 419 LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL 478
           L +++ +S  F W+ I+ SHIRF   +K +  + D+LP+ ++    G++Y    + ++++
Sbjct: 458 LSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLV 517

Query: 479 VQGFTAFTPFSA 490
              +T+  P  +
Sbjct: 518 ASFWTSLFPLGS 529

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  271 bits (693), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 172/484 (35%), Positives = 254/484 (52%), Gaps = 30/484 (6%)

Query: 37  VESLCEKPN-QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVA 95
           +E L    N +  + R L PRHV M                  +   GP   L+ Y  + 
Sbjct: 34  LEGLTTDNNVREHLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASLLINYSIIG 93

Query: 96  TMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGR 155
            + Y    SLGEM+T++P++ SF  FA +F S +   A    YW +  ++ A +++ +  
Sbjct: 94  LIVYATLLSLGEMSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVASDLTALQL 153

Query: 156 LILYWSDAVP-ITAWMA--IFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLV 212
           ++ YW  +      W+A  IFWV L  +N+I VK YGE E+W+A LKVIAI+ F    +V
Sbjct: 154 VLDYWKTSESGFPYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAIIIFFILSIV 213

Query: 213 VVCGGSKLGR-IGFRYW-KDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGV 270
              G ++    IGFR W +   P+  G          F G+ +  + A+F + GTE + +
Sbjct: 214 ANVGHNEQHEYIGFRNWTRGDAPFVNG----------FRGFATLFVSASFAYGGTESITL 263

Query: 271 TAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFV 330
           T+GETKNP R  PK I TVF+RIL+FYI ++  IG+ V YD P L +    T    SPF 
Sbjct: 264 TSGETKNPVRNTPKVIKTVFWRILIFYIFTVFFIGMNVPYDYPNLSEKSVMT----SPFT 319

Query: 331 VAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSG-LAPAFISRTTSRGV 389
           +     G+K     MN VI+ +++SA N  ++ GSR+L+ LG  G   P  ++RT    V
Sbjct: 320 IVFQMVGSKAAGSFMNAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTRTNWYQV 379

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           PYVAVL T   G L + +    +G+++ WL ++  VS    WL I V  IRF     +RG
Sbjct: 380 PYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRF-----RRG 434

Query: 450 ISRDDLPFKAKFM----PYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVV 505
           +SR     + KF+    PYG Y+    V  IILVQG+++ +P     F +YY+  FIF+ 
Sbjct: 435 LSRQGKTHELKFVNWTYPYGPYFVIISVSFIILVQGWSSSSPMDVTSFFSYYVELFIFLA 494

Query: 506 IWLL 509
            WL+
Sbjct: 495 CWLV 498

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  272 bits (696), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 270/508 (53%), Gaps = 22/508 (4%)

Query: 26  KAEVLNHNTSEVESLCEKPNQS-------DVKRELKPRHVTMXXXXXXXXXXXXXXXASP 78
           +A+ +N N      L   P+QS        +KR++KPRHV M                  
Sbjct: 72  RADHINTNIHGNAELELNPSQSLLPEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKA 131

Query: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYL 137
           +   GP G  + Y  + +  Y + Q+ GE+A   P +T +F  + S  V PA+  A   L
Sbjct: 132 LATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAAL 191

Query: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197
           Y + W   F LE+      I YW+ ++    W  IF+V++  IN+     Y E +F+  +
Sbjct: 192 YCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNT 251

Query: 198 LKVIAILCFLFYGLVVVCGGSKLG-RIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256
            K++    F   G+++ CGG+     IG +YW DPG +     + +   ++F   VS+L+
Sbjct: 252 CKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAF-----NGDTGISRFKAIVSTLV 306

Query: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316
            AAF F  +E V +TA E  NPR+ +P A   V +RI+  Y+ S++++G LV Y+ P+L+
Sbjct: 307 TAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELM 366

Query: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
               +++ ++SP+V+A+ + G KV+P  +N VI+++++S GN + Y  SR+L  L   G 
Sbjct: 367 GS-GSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGY 425

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
           AP F      +G P  A++  ++ G + +++ SS   SVF WL++++ +S  FTW  I +
Sbjct: 426 APKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICI 485

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVD---- 492
           SH+RF + ++ +  S  +L F+++   +G+YY  F +I++ + Q + A  P    D    
Sbjct: 486 SHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADA 545

Query: 493 --FVAYYISAFIFVVIWLLFQFLFKGRW 518
             F A Y++  +F+ ++  F+ ++K  W
Sbjct: 546 ENFFANYLAMPVFLALYFGFK-IWKKDW 572

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  273 bits (697), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 162/515 (31%), Positives = 272/515 (52%), Gaps = 14/515 (2%)

Query: 11  DGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXX 70
           D  +  T    P  +     + ++  V+ L  K  +  +K+ +KPRHV M          
Sbjct: 87  DLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTG 146

Query: 71  XXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPA 129
                A  + +AGP G  + Y  + +  YC+ Q+ GEMA T+  +   F  + S  VSP 
Sbjct: 147 LLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPK 206

Query: 130 LGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYG 189
           LG A  ++YWL W     LE+      I YW+  V    ++ IF+ L+  IN+   + Y 
Sbjct: 207 LGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYA 266

Query: 190 EFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQF 248
           E EF+    KV+ I  F   G+++ CGG+   G IG +YW DPG +       +    +F
Sbjct: 267 EAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAF-----RGDKAIDRF 321

Query: 249 LGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLV 308
            G  ++L+ AAF F G+E + +TA E  NPR+ +P A   + +RI++ ++GS++++G LV
Sbjct: 322 KGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLV 381

Query: 309 RYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVL 368
            ++  QL+   S+    ASP+V+AI++ G +V+P  +N VI+++++S GNS  Y  SR+L
Sbjct: 382 PWNSDQLMGSDSS-KTKASPYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRIL 440

Query: 369 YGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGF 428
             L + G AP F +     G P  A++  ++F  + +   SSK   VF WLL+I+ +S  
Sbjct: 441 ISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQI 500

Query: 429 FTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP- 487
           FTW  I +SHIRF + +  +G S  ++ FK++   +G+YYAA  + ++++ Q +    P 
Sbjct: 501 FTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPI 560

Query: 488 ----FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
                 A  F   Y++  + +  ++ + F +K  W
Sbjct: 561 GMNKLDAQSFFESYLAMLMLIAFYVGYMF-WKKDW 594

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  271 bits (694), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 159/498 (31%), Positives = 261/498 (52%), Gaps = 11/498 (2%)

Query: 20  AKPGAIKAEVLNHNTSEVESLCEK-PNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASP 78
           A+    K   +N NTS++E   E   + S +K+ +K RHV M               A  
Sbjct: 61  AEGSITKTRQINENTSDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120

Query: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYL 137
           +   GP   ++ Y+ V+ + Y + Q+ GEMA   P + ++F  ++S F+S   G A  +L
Sbjct: 121 LHYGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWL 180

Query: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197
           Y   W     LE+      I YW+D +    ++ IF++ L  I++  VK YGE EF    
Sbjct: 181 YCFQWLTVLPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNC 240

Query: 198 LKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256
            K++ I  F+   +V+ CGG+   G IG  YW +PG +     + +   A+F      L+
Sbjct: 241 CKILMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILV 295

Query: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316
              F+F G EL  ++  E  NPR++ P A     +RI++ Y+ ++++IG  V Y+D QL+
Sbjct: 296 TGYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLM 355

Query: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
             G +   +ASP+V+A +  G K++P I+N VI+++++S  NS++Y G R++  L + G 
Sbjct: 356 GAGGSAT-HASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGY 414

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
           AP F+      G P  A++   +FG + ++  SSK   VF WL +I  +S  FTW  I +
Sbjct: 415 APKFLDYVDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIML 474

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF--SAVDFV 494
           SH+RF Q +K +G S D+L +KA    +G+ Y  FF I++ + Q + A  P        V
Sbjct: 475 SHLRFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSV 534

Query: 495 AYYISAFIFVVIWLLFQF 512
             +  +++   IWL F F
Sbjct: 535 ESFFESYLAAPIWLTFFF 552

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  273 bits (697), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 150/486 (30%), Positives = 261/486 (53%), Gaps = 17/486 (3%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           ++  Q ++K+ +KPRH  M               +  + NAGP G ++ Y  + +  YC+
Sbjct: 138 QEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCI 197

Query: 102 TQSLGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
            Q+ GE+A  +  +   F  +    V PALG +  +L+ L W     LE+      I YW
Sbjct: 198 IQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYW 257

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL 220
           + +V    ++ IF+VL+  IN+   K Y E +F+    K++ I+ F    +++ CGG+  
Sbjct: 258 TTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGT 317

Query: 221 -GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
            G IG +YW+DPG +       +    +F G V++ + AAF F  +E + +TA E  NPR
Sbjct: 318 DGYIGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPR 372

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI-QDGSTTNANASPFVVAINAAGT 338
           + +P A   + +RIL  ++ SL ++G LV Y   QL+   GS T A  SP+V+A+++ G 
Sbjct: 373 KAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKA--SPYVIAVSSHGV 430

Query: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398
           +V+P  +N VI+++++S  N   Y  SR+L  L + G AP         G P  A+L ++
Sbjct: 431 RVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSA 490

Query: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458
           +FG + +   S K   VF WLL+I+ +S  FTW+ I +SHIRF + +K +G S  ++ +K
Sbjct: 491 LFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYK 550

Query: 459 AKFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAYYISAFIFVVIWLLFQF 512
           ++   +G+ YA   +++ ++ Q + A  P       SA  F   Y++  I++ +++ ++ 
Sbjct: 551 SQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYK- 609

Query: 513 LFKGRW 518
           ++K  W
Sbjct: 610 VWKKDW 615

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  271 bits (692), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/492 (31%), Positives = 256/492 (52%), Gaps = 11/492 (2%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           ++N    + + E  + S++ ++L  RH+                  + +   GP   ++ 
Sbjct: 68  SYNPGSPDDIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIG 127

Query: 91  YIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEI 150
           +  V+T  + V  SLGE+A   PV   F V+ +RFV P+   +    Y + W +   LE+
Sbjct: 128 WTIVSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLEL 187

Query: 151 SVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYG 210
                 I YW D +   AW+AIF+ L+   NL+ VK +GE EF ++ +K++AI+ F   G
Sbjct: 188 VAASLTIRYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILG 247

Query: 211 LVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
           +V+ CGG   G     +YW DPG + VG    +    QF G  S  + AAF++ G E++ 
Sbjct: 248 IVLTCGGGPKGGYIGGKYWHDPGAF-VG----DSAGTQFKGLCSVFVTAAFSYAGIEMIA 302

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPF 329
           V+A E++NPR+T+P A    F+ I   YI  L ++G LV Y+D +L+   S+ +  ASP 
Sbjct: 303 VSAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPL 362

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           V+AI   G K LP +MN +I++ I+S  NS +Y  SR +  +   G  P  +S    RG 
Sbjct: 363 VIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGR 422

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           P  A+  T  FG L ++  S K   VF WL +++ +S  F W+ I+++HIRF Q +  + 
Sbjct: 423 PLRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQN 482

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFV 504
            S D++P+ ++   YG+YY    + ++++   +T+  P       A  F   Y+S  I +
Sbjct: 483 RSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILI 542

Query: 505 VIWLLFQFLFKG 516
             ++  +  FK 
Sbjct: 543 ACYIGHKLYFKN 554

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  270 bits (689), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 148/480 (30%), Positives = 256/480 (53%), Gaps = 11/480 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           N +++ + L  RH+                  + + + GP   ++ ++ ++T  + V  S
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+A   P+   F V+ +RFV P++G A    Y   W +   LE+      I YW+D +
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKI 158

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
              AW+AIF+V +   N++ VK +GE EF ++ +K++AI+ F   G+V+  GG   G   
Sbjct: 159 NSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYL 218

Query: 225 -FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
            F+YW +PG +  G      + ++F G  S  + AAF+F G E++ V+A E+KNPR+ +P
Sbjct: 219 GFKYWNNPGAFVGGT-----NASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIP 273

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
           KA    F+ +   Y+  L ++G LV Y+D +L+   ++ +A ASP V+AI   G K LP 
Sbjct: 274 KAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPS 333

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           +MN +I++ I+S  NS +Y  SR +  +   G  P  +S+   +G P  A++ T +FG L
Sbjct: 334 LMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLL 393

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            ++  S K   VF WL +++ +S  F W+ I+ S IRF + ++ +  S D+LP+ ++   
Sbjct: 394 SFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGI 453

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
           +GA+Y    + ++I+   +T+  P       A  F   ++S  I +V +   +  F   W
Sbjct: 454 WGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARNW 513

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  270 bits (690), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 172/497 (34%), Positives = 263/497 (52%), Gaps = 18/497 (3%)

Query: 28  EVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGS 87
           + L+ N ++ E +      + +KR LK RH+ M                  +  AGP G 
Sbjct: 55  QDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGI 114

Query: 88  LLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFA 147
           L+ +    TM YC+  ++GE+A   P+   FT +ASRFV  + G A   +Y L W +   
Sbjct: 115 LIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLP 174

Query: 148 LEISVIGRLILYWSDAVPI-TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCF 206
           LEI      + YW         ++A+F+V++ AIN   VK YGE EF  + +KVI ++ +
Sbjct: 175 LEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGY 234

Query: 207 LFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGT 265
           +  G+++VCGG   G     R W +PG +  G          F G  S  + AAF+F G+
Sbjct: 235 IILGVILVCGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGS 284

Query: 266 ELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNAN 325
           ELVG+ A ET NPR+++P A   VF+RI LFYI +LL++GLLV Y   +LI   S+ +A 
Sbjct: 285 ELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQ-SSVDAA 343

Query: 326 ASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTT 385
           ASPFV++I  AG K LP ++N VI++ ++S GNS ++  SR +  L   G  P       
Sbjct: 344 ASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYID 403

Query: 386 SRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCL 445
             G P V ++ T +FG L ++  S K G VFDWLL+++ +S  FTW  I + HIR  + L
Sbjct: 404 RTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRAL 463

Query: 446 KKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYISAF 501
             +  +  +L F A    +G+ Y    +I+I++ Q + A  P     SA  F   Y+S  
Sbjct: 464 AAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFP 523

Query: 502 IFVVIWLLFQFLFKGRW 518
           I +  ++  + ++K  W
Sbjct: 524 ILIAFYIGHK-IWKKNW 539

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 157/507 (30%), Positives = 270/507 (53%), Gaps = 16/507 (3%)

Query: 19  TAKPGAIKAEVLNHNTSEVESLC-EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXAS 77
           T   GA K      N ++   L  E  + S++ ++L  RH+                  +
Sbjct: 58  TTSSGATKNINGTSNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGA 117

Query: 78  PIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYL 137
            +   GP   ++ ++ V+T  + V  SLGE+A   PV   F+V+ +RF+ P++  +    
Sbjct: 118 SLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLN 177

Query: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197
           Y + W +   LE+      I YW+D +   AW++IF+ ++  +N++ VK +GE EF ++ 
Sbjct: 178 YLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSF 237

Query: 198 LKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTA--QFLGWVSS 254
           +K++AI+ F   G+V+ CGG  +G     +YW DPG + VG      HTA  QF G  S 
Sbjct: 238 IKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAF-VG------HTAGSQFKGLCSV 290

Query: 255 LIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQ 314
            + AAF++ G E++ V+A E+ +PR+T+P A    F+ I   Y+  L +IG LV YDDP+
Sbjct: 291 FVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPR 350

Query: 315 LIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRS 374
           L+   S+ +  +SP V+AI   G K LP +MN +I++ ++S  NS +Y  SR +  +   
Sbjct: 351 LLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAII 410

Query: 375 GLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLI 434
           G  P  + R   +G P  A L T  FG + ++  S K   VF WL +++ +S  F W+ I
Sbjct: 411 GNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGI 470

Query: 435 SVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF-----S 489
           ++SHIRF + +  +G S +++P+ ++   YG++Y    + ++++   +T+  P      +
Sbjct: 471 NISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQAN 530

Query: 490 AVDFVAYYISAFIFVVIWLLFQFLFKG 516
           A  F   Y+S  I +  ++  +F FK 
Sbjct: 531 ATTFFEGYLSLPILLACYVGHKFYFKN 557

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/493 (32%), Positives = 270/493 (54%), Gaps = 14/493 (2%)

Query: 33  NTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYI 92
           N  E  +   +  ++ +K+ +  RHV M                  + N GP G ++ Y 
Sbjct: 74  NDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYA 133

Query: 93  FVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEIS 151
            + +  YC+ Q+ GE+A ++  ++ +F  + S  +  A G +  ++Y L W     LE+ 
Sbjct: 134 IMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELV 193

Query: 152 VIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGL 211
                I YW+ +V    ++AIF+VL+  +N+   + Y E EF+    KV+ I+ F   G+
Sbjct: 194 TASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGI 253

Query: 212 VVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGV 270
           +V CGG+   G IG RYW +PG +     ++ IH   F G +S+++ AAF F  TE + +
Sbjct: 254 IVNCGGAGNDGYIGGRYWNNPGAF---YGTKPIH--HFKGIISTMVTAAFAFGATEFIAL 308

Query: 271 TAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFV 330
           TA E  NPRR +P A   V +RILL ++  +++IG LV ++ P+L+  GS+   +ASP+V
Sbjct: 309 TAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSAT-HASPYV 367

Query: 331 VAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVP 390
           +A+ + G +V+P  +N VI+++++S GNS  Y  SR+L  L     APA++      G P
Sbjct: 368 IAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRP 427

Query: 391 YVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGI 450
             A+L + +FG + ++  S K  +VF WLL+I+ +S  FTW+ I VSHIRF + L  +G 
Sbjct: 428 MRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGK 487

Query: 451 SRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVV 505
              +L +K++    G+YYA F +  I++ Q + A  P       A  F   Y++  +FVV
Sbjct: 488 PIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVV 547

Query: 506 IWLLFQFLFKGRW 518
           ++  F+ ++K  W
Sbjct: 548 LYFGFK-IWKRDW 559

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  269 bits (687), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 164/493 (33%), Positives = 258/493 (52%), Gaps = 28/493 (5%)

Query: 38  ESLCEKPNQSD------VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAY 91
            S+ + P   D      + R L PRHV M               A  +   GP   L+ Y
Sbjct: 45  NSVSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINY 104

Query: 92  IFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEIS 151
           + +  + Y    SLGEM+TF+P++ S+  ++ +FVS +   A     W S  ++ A +++
Sbjct: 105 VIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLT 164

Query: 152 VIGRLILYW---SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLF 208
            +  ++ YW   +   P  A   +FW L+  +N++ VK YGE E+W+A LKV+A++ F  
Sbjct: 165 ALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFI 224

Query: 209 YGLVVVCGGSKLGR-IGFRYWKD-PGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTE 266
             ++  CG ++    IGF+ W     P+  G          F G+V+  + ++F++ GTE
Sbjct: 225 MAIIANCGHNQQHEYIGFKNWSHGDAPFVQG----------FKGFVTIFVTSSFSYGGTE 274

Query: 267 LVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANA 326
            V +T GE KNP R  PK I TVF+RIL+FY+ ++  +G+ + YD P L     T +   
Sbjct: 275 TVTLTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNL----KTKSVLT 330

Query: 327 SPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAP--AFISRT 384
           SPF +    AGTK     MN VIM + ISA N  ++ GSR+LY +G  G  P   F ++T
Sbjct: 331 SPFTIVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKT 390

Query: 385 TSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQC 444
                PYVAV+ T   G L +      +G +F WL +I  VS   +WL I+V  IRF + 
Sbjct: 391 NRNKAPYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKG 450

Query: 445 LKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFV 504
           L+ +G    +L F+    PYG ++   F+ +IILVQG++AF P+S   F ++Y+   +F 
Sbjct: 451 LEAQG-KVHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDPWSTSSFFSFYLELIVFP 509

Query: 505 VIWLLFQFLFKGR 517
             W+ +  + + R
Sbjct: 510 ACWIFWWVIKRDR 522

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  270 bits (691), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 160/507 (31%), Positives = 265/507 (52%), Gaps = 19/507 (3%)

Query: 17  TITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXA 76
           T +  P A     LN    ++ +  +  +   +K+ ++PRHV M                
Sbjct: 102 TTSVSPSAPNLRKLN----QLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNG 157

Query: 77  SPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANG 135
           + ++NAGP G ++ Y  + ++ YC+ Q+ GEMA  +  +   + V+ S  V    G A  
Sbjct: 158 TALKNAGPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIA 217

Query: 136 YLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWI 195
           ++Y + W     LE+      I YW+ +V    ++AIF+ L+  IN+   K Y E EF+ 
Sbjct: 218 WVYCIQWLTVCPLELVTASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFC 277

Query: 196 ASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSS 254
              KV+ ++ F    + +  GG+   G +G  YW  PG +       +     F G   +
Sbjct: 278 NCCKVLMMIGFFILSITITAGGAGNDGYLGGLYWHTPGAF-----RGDSSIDHFKGICGT 332

Query: 255 LIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQ 314
           L+ AAF + GTE + +TA E  NPR  +P A   V +RI+  Y+ S+L+IG LV +D  +
Sbjct: 333 LVTAAFAYGGTEFLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTR 392

Query: 315 LI-QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGR 373
           L+  DGS T+A  SP+V+A +  G +V+P  +N VI+++++S GNS  Y  SR+L  L R
Sbjct: 393 LLGSDGSATSA--SPYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLAR 450

Query: 374 SGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLL 433
            G AP +       G P  A+L +++FG + +   S K   VF WLL+I+ +S  FTW  
Sbjct: 451 QGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCA 510

Query: 434 ISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----F 488
           I +SHIRF   +K +G S  ++ + A+   +G++YA F + +I + Q + A  P      
Sbjct: 511 ICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGEL 570

Query: 489 SAVDFVAYYISAFIFVVIWLLFQFLFK 515
           SA +F   Y++  I +V++L ++  +K
Sbjct: 571 SAQNFFENYLAMPILIVLYLGYKIYYK 597

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  268 bits (686), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 155/482 (32%), Positives = 254/482 (52%), Gaps = 21/482 (4%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           E    S +K+ +K RH+ M                + +  AGP G ++ Y   + M YC+
Sbjct: 57  ETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCI 116

Query: 102 TQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
            Q+ GE+   +  +T ++T ++S  V PALG +  ++Y + W   F L++      I YW
Sbjct: 117 IQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYW 176

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219
           +D  P   ++AI + L+  INL   K Y E EF   + KV+ ++ F+  G+++ CGG+  
Sbjct: 177 TDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGN 235

Query: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
            G IG RYW  PG +  G          F G       AAF + G E++ +TA E +NPR
Sbjct: 236 DGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVMVLTASEQENPR 285

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTK 339
           +++P A   V +RILL Y+ + L++  LV YD P+L   GS + A  SPFV+AI + G  
Sbjct: 286 KSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRA--SPFVIAIASHGIS 343

Query: 340 VLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSM 399
           V+P I+N VI+V ++S GNS++Y   R+L  L   G AP   +    +G P +  L    
Sbjct: 344 VVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMF 403

Query: 400 FGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKA 459
            G L ++  S     VF WLL+I+ +S  F W+ I +SH+RF   +K +G S  ++ +K+
Sbjct: 404 VGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKS 463

Query: 460 KFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAYYISAFIFVVIWLLFQFL 513
           +   +G+++A    + +++ Q + A  P       SA DF   Y++A + + I+  ++  
Sbjct: 464 QTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIY 523

Query: 514 FK 515
           +K
Sbjct: 524 YK 525

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  269 bits (688), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 150/479 (31%), Positives = 258/479 (53%), Gaps = 11/479 (2%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           +     ++K+ +K RH+ M                + + + GP GS + ++ +    YCV
Sbjct: 83  QNAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCV 142

Query: 102 TQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
            Q+ GE+A  +  +   F  + S  + PALG A  ++Y L W   F LE+      I +W
Sbjct: 143 IQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFW 202

Query: 161 --SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGG- 217
             S +V    ++AIF+VL+  IN    + Y E EF+  S KV+ ++ F   G+++  G  
Sbjct: 203 PGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAV 262

Query: 218 SKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKN 277
              G IG +YW+DPG  G        H   F G V++L+ AAF+   +E V +TA E  N
Sbjct: 263 GTSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQAN 317

Query: 278 PRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAG 337
           PR+++P A   + ++I + ++GS+++IG LV  D  +L+   + ++ + SP+V+A+   G
Sbjct: 318 PRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELM-GSNDSDLHVSPYVIAVRMHG 376

Query: 338 TKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLAT 397
             V+P  +N VI+++++S GNS  Y  SR+L+ L     AP         G P +A++ +
Sbjct: 377 VNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIIS 436

Query: 398 SMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPF 457
            +FG + ++  S K   VF WLL+I+ +S  FTW  I +SHIRF + L  +G S D+L F
Sbjct: 437 ILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGF 496

Query: 458 KAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAY-YISAFIFVVIWLLFQFLFK 515
           KA+    G+Y +A  +++ ++ Q + +  P  A +  A  + + ++ + ++LLF F +K
Sbjct: 497 KAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYK 555

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  270 bits (690), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 152/479 (31%), Positives = 257/479 (53%), Gaps = 14/479 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
              ++K  +KPRHV M                + + N+GP G ++ Y  + +  YC+ Q+
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 105 LGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163
            GEMA  +  +   F  + S  + PALG +  ++Y + W     LE+      I YW+  
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 164 VPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLG 221
           V    ++ IF+VL+  IN++     Y E EF+  S K++ +L F   G++++CGG+   G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 222 RIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRT 281
            IG RYW DPG +       E    +F G VS+L+ AAF F  +E++GVTA E  NPR+ 
Sbjct: 299 YIGGRYWHDPGAF-----RGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKA 353

Query: 282 VPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVL 341
           +P A   + +RI+  Y+GS++++G LV ++  QL+   S     ASP+V+A++  G +V+
Sbjct: 354 IPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLL-GSSGGGVKASPYVLAVSTHGVRVV 412

Query: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401
           P  +N VI+++++S  NS  Y  SR+L GL   G AP         G P + +   ++  
Sbjct: 413 PHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVN 472

Query: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461
            + +   S K   VF WLL+I+ +S  FTW  I +SHIRF + +  +G S  ++ FK++ 
Sbjct: 473 VISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQC 532

Query: 462 MPYGAYYAAFFVIVIILVQGFTAFTPFSA--VDFVAY---YISAFIFVVIWLLFQFLFK 515
             +G++YA   +++I++ Q + A  P     +D  A+   Y++A I + ++  ++   K
Sbjct: 533 GVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTK 591

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  268 bits (685), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 169/524 (32%), Positives = 270/524 (51%), Gaps = 21/524 (4%)

Query: 1   MTNIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVE---SLCEKPNQSD--VKRELKP 55
           M+N+  +   D   +S +  + G +    L   +++ E   SL  KP   D  +K+ LK 
Sbjct: 1   MSNL--QDLKDAGETSVVDKQTGQVYELDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKS 58

Query: 56  RHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-- 113
            H+ +               +S +   GP G  ++Y  ++T+ Y V  +L EM  F+P  
Sbjct: 59  AHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGL 118

Query: 114 -----VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITA 168
                   S +   +R+V  +LG A G+ Y   + I  A E +    ++ YW+ AVP  A
Sbjct: 119 PDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAA 178

Query: 169 WMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRY 227
           W+ IF  ++  +N   V+FYG  E    SLK+  IL  +   +V+  GG     R+GFR+
Sbjct: 179 WITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRF 238

Query: 228 WKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAI 286
           WKDPG W   +   +    +    ++ +I+A F F  G ELV +T+ E ++ RR + KA 
Sbjct: 239 WKDPGAWAYHLA--DGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAA 296

Query: 287 NTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN--ANASPFVVAINAAGTKVLPDI 344
               +R++ FY  S L  G++V  +DP L+   S     A +SPFV+ I  AG KVLP I
Sbjct: 297 RRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHI 356

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
           +N  I+ +  S+GNS +Y  +R L  L + G AP   +R    GVPY  V   + F  L 
Sbjct: 357 INVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLA 416

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           YLNVSS +  VF+W  +I+ +SGF  W+   V+++RF + +    +  D LPFK  F PY
Sbjct: 417 YLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPY 475

Query: 465 GAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWL 508
             ++    + +I L+ G+ +F  ++  DF+A YI+  +F+++WL
Sbjct: 476 FTWFYIILIAIICLINGYESFVHWNYKDFIAAYITLPLFLILWL 519

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  269 bits (688), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 166/510 (32%), Positives = 269/510 (52%), Gaps = 20/510 (3%)

Query: 11  DGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQ-SDVKRELKPRHVTMXXXXXXXXX 69
           D S+SS      G I  E++     E     +  N+   +K+ L+ RHV +         
Sbjct: 71  DQSASSN-----GTIHEELVMDVDLEKSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGT 125

Query: 70  XXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV-----FASR 124
                 +S +   GP G  ++YI ++ + Y +  +LGEM  F+P   S +        +R
Sbjct: 126 GLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTR 185

Query: 125 FVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP 184
           +V  +LG A G+ Y+  + I  A E +    ++ YW+ AVP   W+ +F +++  +N   
Sbjct: 186 YVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSA 245

Query: 185 VKFYGEFEFWIASLKVIAILCFLFYGLVVV-CGGSKLGRIGFRYWKDPGPWGVGIVSQEI 243
           VK YGE EFW AS+K++ I+  +    ++   GG K  R+GFRYW+ PG +   +    +
Sbjct: 246 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSL 305

Query: 244 HTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLL 302
               F    + +IK AF F  G ELV +T+ E  + RR + KA     +R++ FY+   L
Sbjct: 306 --GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTL 363

Query: 303 VIGLLVRYDDPQLIQD--GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
            I ++V Y+DP L+         A +SPFV+ I  AG KVLP I+NG I+ +  SA N+ 
Sbjct: 364 SISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAF 423

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           ++  +R L  + ++G AP  + +    GVPYVAV A+ +   L YLNVSS +  VF+W  
Sbjct: 424 MFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFS 483

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           +I+ +SGF  W+   ++++RF + +   G+  D LPFK    PY  +++   V +I +  
Sbjct: 484 NISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITN 542

Query: 481 GFTAFTP--FSAVDFVAYYISAFIFVVIWL 508
           G+  F P  +   DF+A Y++  IF+V+WL
Sbjct: 543 GYAIFIPKYWKVADFIAAYVTLPIFLVLWL 572

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  268 bits (686), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 158/490 (32%), Positives = 260/490 (53%), Gaps = 15/490 (3%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           I +   + +  +VE +    N +++ ++L  RH+                  + +   GP
Sbjct: 64  ITSSERSRDNDDVEQV--DINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGP 121

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
              ++ ++ + T  + V  SLGE++   PV   F V+  RFV P+   A    Y   W +
Sbjct: 122 ASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLV 181

Query: 145 TFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
              LE+      I YW+D +   AW+AIF+  +   N++ VK +GE EF ++ +K+++I+
Sbjct: 182 LLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSII 241

Query: 205 CFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
            F   G+V+ CGG   G     +YW++PG + VG  S      +F G  S  + AAF++ 
Sbjct: 242 GFSILGIVLSCGGGPHGGYIGGKYWRNPGAF-VGHNSG----TKFKGLCSVFVTAAFSYS 296

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           G E+  V+A E+KNPR T+PKA    F+ I   Y+  L +IG LV  +DP+L+   S+ +
Sbjct: 297 GIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVD 356

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
           A +SP V+AI     K LP +MN +I++ ++S  NS +Y  SR +  +   G  P F++R
Sbjct: 357 AASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNR 416

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
              RG P  A+L T  FG L ++  S+K   VF WL +++ +S  F W+ I++SHIRF +
Sbjct: 417 VDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRK 476

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGF-TAFTPF-----SAVDFVAYY 497
            +K +  S D+LPF ++    G++Y  F V+ ++L+  F T+  P      SA  F   Y
Sbjct: 477 AMKVQERSLDELPFISQTGVLGSWY-GFVVLFLVLIASFWTSLFPIGSSGASAESFFEGY 535

Query: 498 ISAFIFVVIW 507
           +S  I +V +
Sbjct: 536 LSFPILIVCY 545

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  268 bits (685), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 158/512 (30%), Positives = 265/512 (51%), Gaps = 15/512 (2%)

Query: 6   YEPKGDGSSSSTITAKPGAIKAEV--LNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXX 63
           YEP     S+          +AE   L  ++   E        + +K+ +K RHV M   
Sbjct: 30  YEPASRQDSTMIHRFVNSFKRAEQPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSL 89

Query: 64  XXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFA 122
                       A  +  AGP   ++AY  V+ + Y + Q+ GEMA   P +  +F  + 
Sbjct: 90  GTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYI 149

Query: 123 SRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINL 182
           S F+S   G A  +L+++ W     LE+      + YW+D++    ++ IF+V L  I+ 
Sbjct: 150 STFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHF 209

Query: 183 IPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQ 241
             VK YGE EF     K++ +  F+ + +VV  GG+   G IG +YW DPG +     + 
Sbjct: 210 FGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TS 264

Query: 242 EIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSL 301
           + +  +F G    L+ A F++ G EL  ++  E +NPRR+ P A     +RI++ Y+ ++
Sbjct: 265 DTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTM 324

Query: 302 LVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNI 361
           +++G  V  +  +L+  G +   +ASP+V+A +  G KV+P I+N VI++++IS GNS +
Sbjct: 325 ILVGFNVPSNSNELMGSGGSVT-HASPYVLAASIHGVKVVPHIVNAVILISLISVGNSAL 383

Query: 362 YVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLS 421
           Y   R++  L + G AP F+      G P  A++  S+FG +G++  SSK   VF+WL +
Sbjct: 384 YAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAA 443

Query: 422 ITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQG 481
           I  ++  FTW  I +SHIRF Q +K +  S D++ +K+ F  YG+Y+  FF +++ + Q 
Sbjct: 444 IAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQF 503

Query: 482 FTAFTP-----FSAVDFVAYYISAFIFVVIWL 508
           + A  P      SA  F   Y++  IF   + 
Sbjct: 504 WVALAPPMYTEMSADTFFESYLAFPIFFAFYF 535

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  268 bits (685), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/486 (33%), Positives = 250/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           +  ++KR LK RH+ M                  + + GP+  ++ +    T        
Sbjct: 81  HTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHG 140

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  +++RF+ P++      +Y + W     LEI      I YW+ ++
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSI 200

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRI 223
               W+AIF+ ++ +INL   + +GE EF  +S+KVI I+ F+   +V++CGG      +
Sbjct: 201 DPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFV 260

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G RYW DPG    G          F G +S L+ A+++  GTE+V + +GET NPR  +P
Sbjct: 261 GARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LP 308

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI   F+RIL F++ SL +IG LV Y +P L+   S  N   SPFV+AI     K LP 
Sbjct: 309 SAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNN---SPFVIAIKLHHIKALPS 365

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+++I+S GNS I+  SR L  +   GL P F       G P   +L  S+FG L
Sbjct: 366 IVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLL 425

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  SS  G VFDWL++I  ++    WL I++SHIRF   +K +G S D+L F +    
Sbjct: 426 AFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGM 485

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+A    +I++ Q + A  P          A  F   Y+ A I   +++  +  ++
Sbjct: 486 WGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYR 545

Query: 516 ---GRW 518
              G+W
Sbjct: 546 YKTGKW 551

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  268 bits (685), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 156/491 (31%), Positives = 266/491 (54%), Gaps = 16/491 (3%)

Query: 36  EVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVA 95
           + E     P ++ +K+ +  RH+ M                  + N GP G  + Y  + 
Sbjct: 66  DAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMG 125

Query: 96  TMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIG 154
           +  YC+ Q+ GEMA ++  ++ +F  + S  + PALG +  ++Y L W     LE+    
Sbjct: 126 SCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTAT 185

Query: 155 RLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVV 214
             I YW+ AV    ++ IF+VL   +NL   + Y E EF+  + KV+ I  F   G++V 
Sbjct: 186 ITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVN 245

Query: 215 CGGS-KLGRIGFRYWKDPGP-WGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTA 272
           CGG+   G +G +YW DPG  +G    ++ IH   F G +++++ AAF F  TE + +TA
Sbjct: 246 CGGAGNDGYLGGKYWHDPGALYG----TKPIH--HFKGIIATMVTAAFAFGATEFIALTA 299

Query: 273 GETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVA 332
            E  NPRR +P A   + +R+LL ++  ++++G LV Y+  +L+  G +   +ASP+V+A
Sbjct: 300 AEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSAT-HASPYVIA 358

Query: 333 INAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYV 392
           I + G KV+P  +N VI+++++S GNS  Y  SR+L  L     AP++++     G P  
Sbjct: 359 IASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIR 418

Query: 393 AVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISR 452
           A+L + +FG + ++  S K  +VF WLL+I+ +S  FTW+ I VSHIRF + L  +G S 
Sbjct: 419 AMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSL 478

Query: 453 DDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIW 507
            +L +K++    G+YYA   +  ++  Q + A  P       A +F   Y++  I + ++
Sbjct: 479 GELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALY 538

Query: 508 LLFQFLFKGRW 518
             ++ ++K  W
Sbjct: 539 FGYR-VWKRDW 548

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  269 bits (687), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 158/528 (29%), Positives = 275/528 (52%), Gaps = 18/528 (3%)

Query: 2   TNIIYEPKGDGSSSSTITAKPGAIKA----EVLNHNTSEVESLCEKPNQSDVKRELKPRH 57
           +N +++   D ++S + T+   A+      + ++ + SE     +     D+K+ +KPRH
Sbjct: 69  SNPLHDLDNDITTSISRTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPRH 128

Query: 58  VTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMAT-FIPVTS 116
           V M                  +  AGP   ++ Y  + T  YC+ Q+ GE+A  +  +  
Sbjct: 129 VIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNG 188

Query: 117 SFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVL 176
            F  + S  V PALG +  ++Y L W     LE+      I YW+  V    ++ IF+VL
Sbjct: 189 GFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVL 248

Query: 177 LTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWG 235
           + AIN    + Y E EF+    KV+ +  F   G+++  GG+   G +G +YW DPG + 
Sbjct: 249 IIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF- 307

Query: 236 VGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILL 295
               + +    +F G + + + AAF F  TE + +TA E  NPR+ +P A   V +RI+ 
Sbjct: 308 ----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVC 363

Query: 296 FYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIIS 355
            ++ S+ +IG LV Y+  QL+  G +    ASP+V+A+++ G +V+P  +N VI+++++S
Sbjct: 364 IFLASITLIGFLVPYNSDQLLGSGGS-GIKASPYVIAVSSHGVRVVPHFINAVILLSVLS 422

Query: 356 AGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSV 415
            GNS  Y  SR+L  L + G AP +       G P+ A+L +++FG + +   S K   V
Sbjct: 423 VGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEV 482

Query: 416 FDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIV 475
           F WLL+I+ +S  FTW+ I VSHIRF + ++ +G S  ++ + ++   YG+ YAA  + +
Sbjct: 483 FSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFL 542

Query: 476 IILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
            ++ Q + A  P       A +F   Y++  I +  +  ++ ++K  W
Sbjct: 543 ALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYR-VWKRDW 589

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  267 bits (683), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 181/522 (34%), Positives = 277/522 (53%), Gaps = 30/522 (5%)

Query: 15  SSTITAKPGAIKAEVLNHNTSEVESLCEKPN------------QSDVKRELKPRHVTMXX 62
           S + T++ G  + E    +  E E++   P+             + +KR LK RH+ M  
Sbjct: 30  SQSDTSRVGGTRWERFKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIG 89

Query: 63  XXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFA 122
                           +  AGP G L+ +    TM YC+  ++GE+A   PV   +T +A
Sbjct: 90  IGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYA 149

Query: 123 SRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-SDAVPITAWMAIFWVLLTAIN 181
           SRFV  + G A   +Y + W IT  LEI      + YW + A    A++A+F+V++  IN
Sbjct: 150 SRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGIN 209

Query: 182 LIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVS 240
           L  VK YGE EF  + +KVIA++ F+  G+++VCGG   G     R W +PG +  G   
Sbjct: 210 LFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG--- 266

Query: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
                  F G  S  + AAF+F G+ELVG+ A ET NPR+++P A   VF+RI LFYI +
Sbjct: 267 -------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILA 319

Query: 301 LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
           LL++GLLV Y   +LI   S+ +A ASPFV++I  AG K LP ++N VI++ ++S GN  
Sbjct: 320 LLMVGLLVPYTSDRLIGQ-SSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCA 378

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
           ++  SR +  L   G  P         G P V ++ T +FG L ++  S K G VFDWLL
Sbjct: 379 VFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLL 438

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           +++ +S  FTW  I + HIR  + L  +  +  +L F A    +G+ Y+   +I+I++ Q
Sbjct: 439 ALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQ 498

Query: 481 GFTAFTPF----SAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518
            + A  P     SA  F   Y+S  I++V ++  + ++K  W
Sbjct: 499 FWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHK-IWKKNW 539

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  267 bits (683), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 179/519 (34%), Positives = 272/519 (52%), Gaps = 34/519 (6%)

Query: 14  SSSTITAKPGAIK-AEVLNHNTSEVESLCEKPNQS-----DVKRELKPRHVTMXXXXXXX 67
            ++TIT +    K  E +++  SE  SL E+  Q       +K+ LK RHV +       
Sbjct: 31  EANTITEQLTKDKHKETIDY--SETSSLDEEKQQQPEENGKLKQGLKSRHVQLIALGGTI 88

Query: 68  XXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFAS---- 123
                   +  +   GP G   +Y+ + T  Y +  + GEM  ++P   S +  +S    
Sbjct: 89  GTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLV 148

Query: 124 -RFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA--VPITAWMAIFWVLLTAI 180
            ++V  +LG A+ + Y+  + I  A E +    ++ YW+ A  VP  AW+ IF   + A+
Sbjct: 149 EKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVAL 208

Query: 181 NLIPVKFYGEFEFWIASLKVIAILC------FLFYGLVVVCGGSKLGRIGFRYWKDPGPW 234
           N++PV FYGE EFW AS+K++ IL        LF+G     GG    R+GFRYW+ PG +
Sbjct: 209 NMLPVNFYGESEFWFASIKILCILGLIILSFILFWG-----GGPSHDRLGFRYWQRPGAF 263

Query: 235 GVGIVSQEIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRI 293
              I         FL   + +IK  F F  G ELV +T+ E  + RR + KA     +R+
Sbjct: 264 ADHITDGT--GGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRL 321

Query: 294 LLFYIGSLLVIGLLVRYDDPQLIQD--GSTTNANASPFVVAINAAGTKVLPDIMNGVIMV 351
           ++FY+   L I ++V Y+DP L      S   A +SPFV+ I  AG KVLP I+N  IM 
Sbjct: 322 MIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMT 381

Query: 352 TIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSK 411
           +  SAGN+ ++  SR L  +   G AP F S+    GVPYVAV  + +F  L YLNVSS 
Sbjct: 382 SAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSS 441

Query: 412 SGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAF 471
           + +VF+W  +I+ +SGF  W+   V++IRF + +    +  D LP+K     Y  +Y+ F
Sbjct: 442 TANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLF 500

Query: 472 FVIVIILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWL 508
            V +I L  G+  F P  +   DF+A YI+  +F+V+W+
Sbjct: 501 MVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWI 539

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  266 bits (679), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 171/490 (34%), Positives = 260/490 (53%), Gaps = 19/490 (3%)

Query: 23  GAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNA 82
           G   ++ L+ +T +  +L     + ++ R L PRH+ M                  + N 
Sbjct: 13  GIATSQSLSSDTQDAGALNRGHVRENLNRSLTPRHINMISIAGVIGTGLYLGTGKALANG 72

Query: 83  GPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSW 142
           GP   L+ Y  +  + Y +   LGEM+TF+P++ SF  +A +F S +L       YW + 
Sbjct: 73  GPASLLINYGIIGLVVYLIMLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFND 132

Query: 143 CITFALEISVIGRLILYWSD---AVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199
            ++ A +++ +  ++ YW +     P  A   IFW  L  +N++ V+ YGE E+W+A LK
Sbjct: 133 AVSVASDLTALQLILDYWKNPNSHFPYWAASLIFWFALLLLNVVHVRVYGEAEYWLALLK 192

Query: 200 VIAILCFLFYGLVVVCG-GSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKA 258
           VIAI+ F    ++V  G  S    IGF+       WGVG          F G+ S  + +
Sbjct: 193 VIAIIMFFIISIIVNAGHNSDHAYIGFK------NWGVG---DAPFVNGFKGFASLFVSS 243

Query: 259 AFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD 318
           +F F GTE + +TAGE  NP R  PK I TVF+RIL+FY+ +   IG+ V Y+ P L + 
Sbjct: 244 SFAFGGTESITLTAGEAVNPVRNTPKIIKTVFWRILIFYVFTAFFIGMNVPYNYPNLSEK 303

Query: 319 GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSG-LA 377
              T    SPF +     G++     MN VI+ ++ISAGN  ++ GSRVL+ +G  G   
Sbjct: 304 SVMT----SPFTIVFQMVGSRGAGSFMNAVILTSVISAGNHALFAGSRVLFNIGLEGYFF 359

Query: 378 PAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVS 437
           P+FI++T    VPYVAVL T   G L + +    +G+++ WL +I  VS    WL ISV 
Sbjct: 360 PSFITKTNRYQVPYVAVLITWAAGGLCFGSSFIGAGTLWTWLQNIVGVSNQLAWLCISVI 419

Query: 438 HIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYY 497
            IRF + L ++G +  +L F     PYG Y+   FV  II VQG+++F P+S  DF +YY
Sbjct: 420 SIRFRRGLARQGKTH-ELQFVNWTYPYGPYFLVVFVTFIIFVQGWSSFAPWSVSDFFSYY 478

Query: 498 ISAFIFVVIW 507
           I   +FV ++
Sbjct: 479 IELIVFVALY 488

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 154/494 (31%), Positives = 260/494 (52%), Gaps = 13/494 (2%)

Query: 21  KPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIR 80
           KP A + +  + N  +VE        S + ++L  RH+                    + 
Sbjct: 38  KPLAEEKDYADMN--DVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLS 95

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWL 140
             GP   ++A+  ++T  + +  SLGE++   PV   F V+ +RFV P+ G A  + Y  
Sbjct: 96  TGGPASLVIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLA 155

Query: 141 SWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV 200
            W I   LE+      I YW+ ++   AW++IF+V +   N++ VK +GE EF ++ +K+
Sbjct: 156 QWAILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKI 215

Query: 201 IAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAA 259
           +AI+ F   G+V++CGG   G     +YW DPG + VG    +    +F G  +  I AA
Sbjct: 216 LAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAF-VG----DTPAQRFKGLSAVFITAA 270

Query: 260 FTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDG 319
           F++ G ELVGV+A E++NPR T+PKA    F+ I + Y+  L +IG LV  +DP L+   
Sbjct: 271 FSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGT 330

Query: 320 STTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379
           S+ +A ASP V+AI   G K LP +MN +I++ ++S  NS +Y  SR +  +   G  P 
Sbjct: 331 SSVDAAASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPR 390

Query: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439
            ++    +G P  A+  T + G L ++  S+K   VF WL +++ +S  F W  I+++H+
Sbjct: 391 SLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHL 450

Query: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFV 494
           RF   +K +  S ++LP+ +    +G++Y    + ++++   +T+  P       A  F 
Sbjct: 451 RFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFF 510

Query: 495 AYYISAFIFVVIWL 508
             Y+S  IF+  +L
Sbjct: 511 ESYLSLPIFIACYL 524

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  267 bits (683), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/494 (32%), Positives = 265/494 (53%), Gaps = 20/494 (4%)

Query: 35  SEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFV 94
           ++ ESL +      +K+ ++PRHV M                  + N GP G  + +  +
Sbjct: 75  NDQESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVM 134

Query: 95  ATMAYCVTQSLGEMATFIPVTSS-FTVFASRFVSPALGAANGYLYWLSWCITFALEISVI 153
            T  YCV Q+ GEMA   P  S  F  + S  V P  G A  +LY + W   F LE+   
Sbjct: 135 GTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTA 194

Query: 154 GRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVV 213
              I YW+ A+    ++A+F++L+  IN    + Y E EF+  + KV+ I+ F   G++V
Sbjct: 195 SITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILV 254

Query: 214 VCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTA--QFLGWVSSLIKAAFTFQGTELVGV 270
             G +   G IG +YW++PG +G        HTA   F G VS+L+ AAF+   +E V +
Sbjct: 255 NTGAAGNDGYIGAKYWREPGSFGG-------HTAIDHFKGVVSTLVNAAFSLGCSEFVAL 307

Query: 271 TAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNA-NASPF 329
           TA E  NPR++VP A   + +++ + ++GS+ +IG LV  +  +L+  GST ++ + SP+
Sbjct: 308 TAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELM--GSTDSSVHVSPY 365

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           V+A+ + G +V+P  +N VI+++++S GNS  Y  SR+L  L   G AP        +G 
Sbjct: 366 VIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGR 425

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           P +A++ +   G L ++  S K  +VF WLL+I+ +S  FTW  I +SHIRF + L  +G
Sbjct: 426 PLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQG 485

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFV 504
              D L FKA+   +G+YY+A  +I+  + Q +T   P      +A  F   Y++  IFV
Sbjct: 486 RGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFV 545

Query: 505 VIWLLFQFLFKGRW 518
            ++  ++ ++   W
Sbjct: 546 ALYFGYK-IYNKNW 558

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  268 bits (685), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 154/505 (30%), Positives = 268/505 (53%), Gaps = 15/505 (2%)

Query: 22  PGAIKAEVLNHNTSEVESLCEKPNQSD-VKRELKPRHVTMXXXXXXXXXXXXXXXASPIR 80
           P + + + L  N S         N+SD +K+ ++PRHV M                + + 
Sbjct: 88  PSSRQRQELEKNESSDNIGARTGNKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALV 147

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYW 139
           +AGP G L+ Y  + ++ YC+ Q+ GEMA  +  +T  +  + S  V    G A  ++Y 
Sbjct: 148 HAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYC 207

Query: 140 LSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199
           L W     LE+      I YW+ +V    ++ IF+VL+  IN+   + Y E EF+    K
Sbjct: 208 LQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCK 267

Query: 200 VIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKA 258
           ++ +  F   G+++  GG+   G IG +YW DPG +     + +    +F G V++L+ A
Sbjct: 268 ILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHSIDRFKGVVATLVTA 322

Query: 259 AFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD 318
           AF F G+E + +T  E  NPR+ VP A   + +RIL  ++ +++++G LV Y+  QL+  
Sbjct: 323 AFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLL-G 381

Query: 319 GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAP 378
            S     ASP+V+A+ + G +V+P  +N VI+++++S  NS+ Y  +R+L  L   G AP
Sbjct: 382 SSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAP 441

Query: 379 AFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSH 438
              +     G P +A+  +++FG + +   S K   VF WLL+I+ +S  FTW  I +SH
Sbjct: 442 RVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSH 501

Query: 439 IRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDF 493
           IRF + +K +G S  +L F+++   +G+ YA   +I+I++ Q + A  P       A  F
Sbjct: 502 IRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAF 561

Query: 494 VAYYISAFIFVVIWLLFQFLFKGRW 518
              Y++  I + +++ ++ ++K  W
Sbjct: 562 FENYLAMPILIALYVGYK-IWKKDW 585

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  266 bits (680), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 158/491 (32%), Positives = 260/491 (52%), Gaps = 16/491 (3%)

Query: 34  TSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIF 93
           TS+     E  N+S + ++L  RH+                  + + + GP   ++ ++ 
Sbjct: 64  TSQSSVTKEDINKS-LNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVI 122

Query: 94  VATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVI 153
           ++T  + V  SLGE+A   PV   F V+ +RFV P+   A    Y   W +   LE+   
Sbjct: 123 ISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAA 182

Query: 154 GRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVV 213
              I YW+  +   AW+AIF+ ++T  N++ VK +GE EF ++ +K++AI+ F   G+V+
Sbjct: 183 SITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVL 242

Query: 214 VCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTA--QFLGWVSSLIKAAFTFQGTELVGV 270
            CGG   G     +YW +PG + VG      HT+  +F G  S  + AAF++ G E+  V
Sbjct: 243 SCGGGPKGGYLGGKYWHNPGAF-VG------HTSGTKFKGLCSVFVTAAFSYSGIEMTAV 295

Query: 271 TAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFV 330
           +A E+K+PR+T+PKA    F+ I   Y+  L ++G LV YDDP+L+   S+ +A ASP V
Sbjct: 296 SAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLV 355

Query: 331 VAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVP 390
           +AI   G K L  +MN +I+++IIS  NS +Y  SR +  +   G  P  + +   RG P
Sbjct: 356 IAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRP 415

Query: 391 YVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGI 450
             A L T  FG L ++  S K   VF WL +++ +S  F W+ I++SHIRF Q + K+  
Sbjct: 416 INATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNR 475

Query: 451 SRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFVV 505
           S D++P+ ++   +G+ Y    + ++++   +T+  P          F   Y+S  I +V
Sbjct: 476 SLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIV 535

Query: 506 IWLLFQFLFKG 516
            ++  +  FK 
Sbjct: 536 CYIGHKLYFKN 546

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  265 bits (678), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 154/472 (32%), Positives = 253/472 (53%), Gaps = 12/472 (2%)

Query: 46  QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSL 105
           ++ +K+ +K RHV M               A  +  +GP   ++ Y+ V+ + Y + Q+ 
Sbjct: 50  KTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAA 109

Query: 106 GEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           GEMA   P +  SF  + S F+S   G A  +L+++ W   F LE+      + YW+D +
Sbjct: 110 GEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKI 169

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRI 223
               ++ IF+  L  I+   VK YGE EF   S KV+ +  F+   +V+ CGG+   G I
Sbjct: 170 NADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYI 229

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G +YW DPG +  G         +F G    L+ A F++ G EL  ++  E +NPR++ P
Sbjct: 230 GAKYWHDPGSFADGP-----PITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTP 284

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            A     +RIL+ Y+ ++++IG  V ++  +L+  GS    +ASP+V+A +    KV+P 
Sbjct: 285 AAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAAT-HASPYVLAASLHSVKVVPH 343

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
            +N VI++++IS  NS +Y   R++  L   G AP F++     G P   ++  ++FG +
Sbjct: 344 FINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVI 403

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
           G+++ SSK   VF WL +I  +S  FTW  I +SHIRF Q +K  G S D++ FKA    
Sbjct: 404 GFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGI 463

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFSA---VDFVAYYISAFIFVVIWLLFQF 512
           +G+YY   F I++ + Q + A +P  +    D  A++ S ++   IWL+F F
Sbjct: 464 WGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQS-YLAAPIWLVFYF 514

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  264 bits (675), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 170/519 (32%), Positives = 272/519 (52%), Gaps = 13/519 (2%)

Query: 1   MTNIIYE-PKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVT 59
           MTN   E P G+   +  +          V   N +E E      +++ +K+ LK RH+ 
Sbjct: 1   MTNEKEELPSGELKKTEAVQVCETYEADSVEPQNANEPEEGVLYNDRTRLKQGLKERHIK 60

Query: 60  MXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFT 119
           M                  ++ AGP G  LAY+ V  +  C   ++ E+A+F+P T +  
Sbjct: 61  MLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATI 120

Query: 120 VFASRFVSPALGAANGYLYWLS-WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLT 178
             A +F+  ++G   G   W+S +      E+S    ++ YW+D  P   W+ IF +L  
Sbjct: 121 RHAEQFIDESVGFTFG---WISTYSSLMPGELSATAVVMRYWTDINP-AVWITIFGILFV 176

Query: 179 AINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGI 238
             N+  ++FYGE E++   +K+I I+  +  GLV+  GG+K  R+GF YW++PGP+   I
Sbjct: 177 LTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGAKQERLGFHYWREPGPFAEYI 236

Query: 239 VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI 298
           V  EI   +F+G+ ++L    +++ G + + + AGETKN R  +      VF RI++ Y+
Sbjct: 237 VKGEI--GKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYL 294

Query: 299 GSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN 358
            ++LV+ L+V Y+D +LI  G+ T A +SP+V+AI  A  K+LP I+N +I+ +  SAGN
Sbjct: 295 IAVLVLTLIVPYND-KLIATGTGT-AKSSPYVIAIQRANIKILPHIINAIILTSAWSAGN 352

Query: 359 SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW 418
             I  GSR L+ L     AP     T  RG+PYV +   S F  L Y++VSS S +VF W
Sbjct: 353 LAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFSW 412

Query: 419 LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL 478
              + + +    W+LIS +HI   + LK +G SR DLP      P+ A+++    ++ +L
Sbjct: 413 FQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFLL 472

Query: 479 VQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQF--LFK 515
             GF  F      D  +++   FI  +  +LF F  LFK
Sbjct: 473 TGGFYNFI-HGHFDIESFFTRYFIIPLAIILFTFWKLFK 510

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  265 bits (676), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 166/493 (33%), Positives = 265/493 (53%), Gaps = 23/493 (4%)

Query: 28  EVLNHNTSEVESLCEKPN-QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVG 86
           E  ++  +EV ++  + N + D+ R LKPRH+ M               ++ +   GP  
Sbjct: 28  ETTSYGVNEVYTIDPEANIREDLTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPAS 87

Query: 87  SLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITF 146
             + Y  +  + Y     L EM+T++P++ SF  +A +F S +   A  + YW +  ++ 
Sbjct: 88  LFINYSLIGGIVYLTLLCLAEMSTYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSV 147

Query: 147 ALEISVIGRLILYW---SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
           A +++ +  ++ YW   S+  P  A   IFW  + ++N+I V+FYGE E+W+A LKVIAI
Sbjct: 148 ASDLTALQLVMDYWNTDSNHFPYWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAI 207

Query: 204 LCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
           + F    ++V  G + +   IGF+ W          V +      F G+ S  + A+F +
Sbjct: 208 IIFFIMSIIVNVGHNPQHEYIGFKNWT---------VGEAPFVDGFKGFASLFVSASFAY 258

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            GTE + +T+GE+ NP R  PK + TVF+RIL FYIG+   I + V Y+ P L    S+ 
Sbjct: 259 GGTESITLTSGESDNPLRNTPKIVKTVFWRILFFYIGTTFFIAMNVPYNYPGL----SSG 314

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAP-AFI 381
           +   SPF +    AGT      MN VIM ++ISA N  ++ GSR++Y +G  G  P + +
Sbjct: 315 SVVTSPFTIVFKMAGTAGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIV 374

Query: 382 SRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRF 441
           SRT    VPYVAVL T   G L +      +G+++ WL +I  VS    WL I+++ IRF
Sbjct: 375 SRTNRYKVPYVAVLITWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRF 434

Query: 442 MQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAF 501
            Q L+ +  +  +L FK    P+G Y+    V  IILVQG+++F P++  +F + YI  F
Sbjct: 435 RQGLEAQNKTH-ELKFKNWTYPFGPYFLVVAVTFIILVQGWSSFAPWNVSNFFSVYIELF 493

Query: 502 IF---VVIWLLFQ 511
           +F    +IW L++
Sbjct: 494 VFPFCFIIWWLYK 506

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  264 bits (675), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 166/522 (31%), Positives = 264/522 (50%), Gaps = 28/522 (5%)

Query: 3   NIIYEPKGDGSSSSTITAK---PGAIK-AEVLNHNTSEVESLCEKPNQSDVKRELKPRHV 58
           NI+ + KGD +S  + T+    P  I+  E  NHN S  +       ++ VKR LK RH+
Sbjct: 7   NILTKGKGDDASCESYTSSGITPDQIETGEGKNHNASLYDP------KTGVKRALKDRHI 60

Query: 59  TMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSF 118
           ++                + +   GP+  LL +  +  +A+ + +S+GEM T  P    F
Sbjct: 61  SLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGF 120

Query: 119 TVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLT 178
           T  A RF S +L A  GY Y + +    A E + +  +  +W   VP+  ++ IFW    
Sbjct: 121 TTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQ 180

Query: 179 AINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVG 237
           A  +  V  +GE E+W++  K++ ++ F  +  + + GG K     GF YW +PG    G
Sbjct: 181 AFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG 240

Query: 238 IVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFY 297
                     F G     +  +  + GTE V  +A E+KNP R +P AI   F+RIL+ Y
Sbjct: 241 ----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVVY 290

Query: 298 IGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAG 357
           IG     G+ V Y+D  L    + T A  SP  +AI  AG +    ++N  I+VT ISA 
Sbjct: 291 IGIGFFYGVTVPYNDHNL---NAGTKALKSPISIAITRAGWEGGTHLVNAFILVTCISAI 347

Query: 358 NSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFD 417
           N ++++GSR +  L   GLAP F++ T  RGVP  A+   +  G +  +NVS  + + + 
Sbjct: 348 NGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYS 407

Query: 418 WLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVII 477
           ++++++ V  F  W  I ++H+RF +   K+G +  +LP+KA F PY         I + 
Sbjct: 408 YIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLA 467

Query: 478 LVQGFTAFTPFSAVDFVAYYI----SAFIFVVIWLLFQFLFK 515
           L+QG+T+F PF A DFV  Y+    +A +++ I LL    FK
Sbjct: 468 LIQGWTSFVPFKAGDFVDAYVLLPAAAVLYIGISLLKTHSFK 509

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  265 bits (677), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/479 (31%), Positives = 250/479 (52%), Gaps = 13/479 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + S +KR +KPRHV M                  +R  GP G ++ Y  V+ +AY + Q+
Sbjct: 79  SSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQA 138

Query: 105 LGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163
            GEMA   P +  +F  ++S+ +S   G A  +LY + W     LE+      I YW+D+
Sbjct: 139 AGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDS 198

Query: 164 VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR- 222
           +    ++AIF+V +  I+    + YGE EF     KV+ I+ F+   +V+ CGG+   + 
Sbjct: 199 INADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKY 258

Query: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           IG +YW DPG + VG         +F G    L+   F++ GTEL  +T  E  NPRR +
Sbjct: 259 IGAKYWYDPGAFAVGS-----GATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAI 313

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLP 342
                   +RILL Y+ ++++IG LV +   +L+     +  +ASP+V+A++  G K++P
Sbjct: 314 QSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVP 373

Query: 343 DIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGA 402
            I+N VI++ +IS GNS +Y G R+L  L   G AP F++     G P VA++A S+FG 
Sbjct: 374 HIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGL 433

Query: 403 LGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFM 462
           L ++  S     VF WL +I  +S  FTW  I +SH+RF Q ++       +L +KA   
Sbjct: 434 LAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTG 493

Query: 463 PYGAYYAAFFVIVIILVQGFTAFTPF------SAVDFVAYYISAFIFVVIWLLFQFLFK 515
             G+     F I++ + Q + +  PF        + F   Y++  ++VV++  +  +F+
Sbjct: 494 VLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFR 552

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  264 bits (675), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 155/507 (30%), Positives = 263/507 (51%), Gaps = 9/507 (1%)

Query: 10  GDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXX 69
           G+G +S        + K  V +   S++E +  +     +K+ +K RHV M         
Sbjct: 28  GEGRASGVFHRFIDSFKPPVEDEK-SDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGT 86

Query: 70  XXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSP 128
                 A  +   GP   ++ YI V+ + Y + Q+ GEMA   P +  SF  + S F+S 
Sbjct: 87  GLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISK 146

Query: 129 ALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFY 188
            +G A  +L+ + W     LE+      I YW+D++    W+ IF+V L  +++  VK Y
Sbjct: 147 PVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAY 206

Query: 189 GEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQ 247
           GE EF   + K++ I  F+ + +VV  GG+   G IG +YWK+PG +     +      +
Sbjct: 207 GELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGR 261

Query: 248 FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLL 307
           F      L+ A F++ GTEL  ++  E  NPRR+ PKA     +RIL+ Y+ ++++IG  
Sbjct: 262 FKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFN 321

Query: 308 VRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRV 367
           V +D+ QL+  G ++  +ASP+V+A +  G KV+P I+N VI++ + S GNS++Y   R+
Sbjct: 322 VPHDNDQLMGAGGSST-HASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRL 380

Query: 368 LYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSG 427
              L   G AP  ++     G P +A+ A ++ G + +   SS+   VF WL +I A+S 
Sbjct: 381 FASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSE 440

Query: 428 FFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
            FTW  I +SHIRF   +K +G   ++L +KA    +G+ +   F +++ + Q + A +P
Sbjct: 441 LFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSP 500

Query: 488 FSAVDFVAYYISAFIFVVIWLLFQFLF 514
                    +  +++   +WL F F +
Sbjct: 501 PGGTISAEGFFESYLAFPLWLFFYFAY 527

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  263 bits (672), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 156/478 (32%), Positives = 249/478 (52%), Gaps = 17/478 (3%)

Query: 25  IKAEVLNHNTSEVESLCEKPN---QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRN 81
           ++ +  N+  +E +SL  +      S VKR+LK RH+++                + +  
Sbjct: 29  MEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAI 88

Query: 82  AGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLS 141
            GP+  LL +  +  +A+ + +S+GEM T  P    FT    RF S AL A  GY Y + 
Sbjct: 89  GGPLALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVV 148

Query: 142 WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVI 201
           +    A E + +  ++ +W   VP+  ++ IFW       L+ V  +GE E+W+A  K++
Sbjct: 149 FFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKIL 208

Query: 202 AILCFLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAF 260
            +L +  + +V + GG K     GF+YW DPG    G          F G  +  +  + 
Sbjct: 209 GLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALSNG----------FKGIANVFVFCST 258

Query: 261 TFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGS 320
            + GTE V + A E+KNPRR VP AI   F+RIL+ Y+G  +  G+ V Y+D  L     
Sbjct: 259 FYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENL---NF 315

Query: 321 TTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAF 380
            T    SP  +AI+ AG      ++N  I++T ISA N ++Y+GSR L  L   GLAP  
Sbjct: 316 ATKVLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKL 375

Query: 381 ISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIR 440
           ++ T  RGVP  A+   +  G +  +NVS  +   ++++++++ V  F  W +IS++H+R
Sbjct: 376 LAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLR 435

Query: 441 FMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYI 498
           F +  K +G +RD+LP+KAK  P     +    I + LVQG++ F PF A +FV  YI
Sbjct: 436 FRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKPFDAKNFVDAYI 493

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  265 bits (676), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 151/446 (33%), Positives = 246/446 (55%), Gaps = 10/446 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           ++S +K+ +K RHV M               AS +  +GP   +LAY  V+ + Y + Q+
Sbjct: 97  SESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQA 156

Query: 105 LGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163
            GEMA   P +  +F  + S FVS   G A  +L+ L W     LE+      I YW+D 
Sbjct: 157 AGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDK 216

Query: 164 VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGR 222
           +    ++ IF+V L  I+   V+ YGE EF   S K++ I  F+ + +VV CGG+   G 
Sbjct: 217 INSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGY 276

Query: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           IG +YW DPG +     +   +  +F G    L+ A F++ GTEL  ++  E +NPR++ 
Sbjct: 277 IGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKST 331

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI-QDGSTTNANASPFVVAINAAGTKVL 341
           P+A     +RI++ Y+ ++++IG  V +D+ QL+   GS T+A  SP+V+A +  G +++
Sbjct: 332 PQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHA--SPYVLAASIHGVRIV 389

Query: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401
           P  +N VI++++IS  NS++Y   R+L  L + G AP F++    +G P  A+   S+FG
Sbjct: 390 PHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFG 449

Query: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461
            +G+   S++   VF WL +I  +S  FTW  I +SH+RF Q +K +G   ++L +KA  
Sbjct: 450 VIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVS 509

Query: 462 MPYGAYYAAFFVIVIILVQGFTAFTP 487
             +G+ Y  FF I++   Q + A  P
Sbjct: 510 GVWGSVYGVFFNILVFFAQFWVALAP 535

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  265 bits (676), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 152/503 (30%), Positives = 265/503 (52%), Gaps = 16/503 (3%)

Query: 22  PGAIKAEVLNHNTSEVESLCEKPNQSD-VKRELKPRHVTMXXXXXXXXXXXXXXXASPIR 80
           P + +A+ L  N S         ++SD +K+ ++PRHV M                + + 
Sbjct: 88  PSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALV 147

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYW 139
           +AGP G L+ Y  + ++ YC+ Q+ GEMA  +  +T  +  + S  V    G A  ++Y 
Sbjct: 148 HAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYC 207

Query: 140 LSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199
           L W     LE+      I YW+ +V    ++ IF+VL+  IN+   + Y E EF+    K
Sbjct: 208 LQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCK 267

Query: 200 VIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKA 258
           ++ +  F   G+++  GG+   G IG +YW DPG +     + +    +F G  ++L+ A
Sbjct: 268 ILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHAIDRFKGVAATLVTA 322

Query: 259 AFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD 318
           AF F G+E + +T  E  NPR+ +P A   + +RIL  ++ +++++G LV Y+  QL+  
Sbjct: 323 AFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLL-- 380

Query: 319 GSTTNA-NASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLA 377
           GST     ASP+V+A+ + G +V+P  +N VI+++++S  NS+ Y  +R+   L   G A
Sbjct: 381 GSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYA 440

Query: 378 PAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVS 437
           P   S     G P +A+  +++F  + +   S K   VF WLL+I+ +S  FTW  I +S
Sbjct: 441 PKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLS 500

Query: 438 HIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVD 492
           H+RF + +K +G S  +L FK++   +G+ YA   +I+I++ Q + A  P       A  
Sbjct: 501 HLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQA 560

Query: 493 FVAYYISAFIFVVIWLLFQFLFK 515
           F   Y++  I + +++ ++   K
Sbjct: 561 FFENYLAMPILIALYVGYKVWHK 583

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  264 bits (675), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 264/499 (52%), Gaps = 16/499 (3%)

Query: 22  PGAIKAEVLNHNTSEVESLCEKPNQSD-VKRELKPRHVTMXXXXXXXXXXXXXXXASPIR 80
           P + +A  L  + +  +      ++SD +K+ ++PRHV M                + + 
Sbjct: 88  PSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALV 147

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYW 139
           +AGP G L+ Y  + ++ YC+ Q+ GEMA  +  +T  +  + S  V    G A  ++Y 
Sbjct: 148 HAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYC 207

Query: 140 LSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199
           L W     LE+      I YW+ +V    ++ IF+VL+  IN+   + Y E EF+    K
Sbjct: 208 LQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCK 267

Query: 200 VIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPW-GVGIVSQEIHTAQFLGWVSSLIK 257
           ++ +  F   G+++  GG+   G IG +YW +PG + GV  + +      F G V++L+ 
Sbjct: 268 ILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGVHAIDR------FKGVVATLVT 321

Query: 258 AAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ 317
           AAF F G+E + +T  E  NPR+ +P A   + +RIL  ++ +++++G LV Y+  QL+ 
Sbjct: 322 AAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLL- 380

Query: 318 DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLA 377
             S     ASP+V+AI + G +V P  +N VI+++++S  NS+ Y  +R+   L   G A
Sbjct: 381 GSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYA 440

Query: 378 PAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVS 437
           P   S     G P +A+  +++F  + +   S K   VF WLL+I+ +S  FTW  I +S
Sbjct: 441 PKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLS 500

Query: 438 HIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVD 492
           HIRF + +K +G S  +L FK++   +G+ Y+   +I+I++ Q + A  P       A  
Sbjct: 501 HIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQA 560

Query: 493 FVAYYISAFIFVVIWLLFQ 511
           F   Y++  I +V+++ ++
Sbjct: 561 FFENYLAMPILIVLYVGYK 579

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  264 bits (675), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 148/483 (30%), Positives = 255/483 (52%), Gaps = 14/483 (2%)

Query: 43  KPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVT 102
           +     +++ +KPRHV +                S +  AGP G ++ Y  + +  YC+ 
Sbjct: 125 EEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCII 184

Query: 103 QSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWS 161
           Q+ GEMA  +  +  +F  + S  V  A G +  ++Y L W     LE+      I YW+
Sbjct: 185 QACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWT 244

Query: 162 DAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KL 220
             V    ++ IF+VL+  IN+   K Y E EF+  S KV+ +  F    +V+  GG+   
Sbjct: 245 TTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 304

Query: 221 GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRR 280
           G IG +YW +PG +       +    +F   +S+   AAF F  +E + + A E  NPRR
Sbjct: 305 GYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRR 359

Query: 281 TVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKV 340
            +P A  T+ +RIL  ++ S+ ++G LV Y+  +L+  GS     ASP+V+A+ + G +V
Sbjct: 360 AIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAAT-KASPYVIAVASHGVRV 418

Query: 341 LPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMF 400
           +P  +N VI+++++S  NS  Y   R+LY L + G AP++ +     G P  A++ +++F
Sbjct: 419 VPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALF 478

Query: 401 GALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAK 460
             + +   SSK   VF WLL+I+ +S  FTW+ I VSHIRF + +K +G S D++ FK++
Sbjct: 479 SVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQ 538

Query: 461 FMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQFLFK 515
              +G+ YAA  + + ++ + + +  P       A +F   Y++  I +V++  ++ + K
Sbjct: 539 VGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYK-ICK 597

Query: 516 GRW 518
             W
Sbjct: 598 RDW 600

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 158/483 (32%), Positives = 261/483 (54%), Gaps = 17/483 (3%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           +      +K+ +KPRHV M                  + N GP   L+ Y  V+TM YCV
Sbjct: 80  DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCV 139

Query: 102 TQSLGEMAT-FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
            QS  E+A  +  ++  F  + +  V  A   +  ++Y L W     LE+      I YW
Sbjct: 140 IQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW 199

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219
           +D++   A++ IF+V+L  IN I    Y E EF+  + KV+ ++ F   G++V CGG+  
Sbjct: 200 NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGN 259

Query: 220 LGRIGFRYWKDPGPW--GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKN 277
            G +G  YW DPG +    GI        +F G V+ L+ AAF + G E   +TA E +N
Sbjct: 260 DGYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQN 312

Query: 278 PRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAG 337
           P++++  A   + +RI+  Y+ +  ++G LV Y+ P+L+  GS    +ASPFV+AI + G
Sbjct: 313 PQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAAT-HASPFVIAIASHG 371

Query: 338 TKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLAT 397
            KV+P I+N VI+++++S  NS +Y  SR+L  L   G AP   +    RG P   +L +
Sbjct: 372 VKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVS 431

Query: 398 SMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPF 457
            +FG L ++  S K  +VF WLL+I+ +S  FTW  IS+SH+RF + +  +G S D+L +
Sbjct: 432 CVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGY 491

Query: 458 KAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQF 512
           ++    +GAYYA   +++I++ Q + A +P       A +F   Y++  I + ++L ++ 
Sbjct: 492 QSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKL 551

Query: 513 LFK 515
            ++
Sbjct: 552 WYR 554

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 157/500 (31%), Positives = 263/500 (52%), Gaps = 19/500 (3%)

Query: 20  AKPGAIKAEVLNHNTSEVESLCEK-PNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASP 78
           A+    K + +N NTS++E   +   + S +K+ +K RHV M               A  
Sbjct: 61  AEGSTTKIKPINENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKG 120

Query: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYL 137
           +   GP   ++ Y+ V+ + Y + Q+ GEMA   P + ++F  ++S F+S   G A  +L
Sbjct: 121 LHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWL 180

Query: 138 YWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIAS 197
           Y   W     LE+      I +W+D +    ++ IF+V L  ++   VK YGE EF    
Sbjct: 181 YCFQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNC 240

Query: 198 LKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLI 256
            K++ I  F+   +V+ CGG+   G IG  YW  PG +     + +   A+F      L+
Sbjct: 241 CKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILV 295

Query: 257 KAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLI 316
            A F+F G EL  ++  E  NPR++ P A     +RI++ Y+ ++++IG  V Y+D QL+
Sbjct: 296 TAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLL 355

Query: 317 QDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
             G +   +ASP+V+A +  G +++P I+N VI+++++S  NS++Y G R++  L + G 
Sbjct: 356 GAGGSA-THASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGY 414

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
           AP F+      G P  A++   + G + ++  SSK   VF WL +I  +S  FTW  I +
Sbjct: 415 APKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIML 474

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF------SA 490
           SH+RF Q +K +G S ++L +KA    +G+ Y +FF I++ + Q + A  P       +A
Sbjct: 475 SHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNA 534

Query: 491 VDFVAYYISAFIFVVIWLLF 510
             F   Y++A     IWL+F
Sbjct: 535 EAFFESYLAA----PIWLIF 550

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  262 bits (670), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/490 (32%), Positives = 253/490 (51%), Gaps = 34/490 (6%)

Query: 10  GDGSSSSTITAKPGAIKAEVLNHNTSE---VESLCE--KP------NQSDVKRELKPRHV 58
           GDGS     T+ P    + V+NH  ++   ++ + +  KP      +  ++K+ LK RH+
Sbjct: 30  GDGSEK---TSTP----STVVNHRGTKRNIIQRMVDSFKPPLDGSFHSDNLKKSLKARHL 82

Query: 59  TMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSF 118
            M                  +   GP+  ++ +    T        LGE+    PV  +F
Sbjct: 83  IMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHGLGEITVRFPVVGAF 142

Query: 119 TVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLT 178
             + +RF+ P++      +Y L WC    LEI      + YW  +VP  AW+AIF+  + 
Sbjct: 143 ADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSVPPVAWVAIFYAFIA 202

Query: 179 AINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVG 237
            +NL+ V+ +GE EF  + +KV+ I+ F+   +V++CGG  K   +G +YW DPGP   G
Sbjct: 203 LVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPLANG 262

Query: 238 IVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFY 297
                     F G  +  + A+++  GTE+  + +GET +P+  +P AI  VF+RI+ F+
Sbjct: 263 ----------FKGVAAVFVIASYSLGGTEMACLASGET-DPKE-LPSAIKQVFWRIVFFF 310

Query: 298 IGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAG 357
           + SL ++G LV Y +  L+   S  N   SPFV+AI   G K LP ++N VI+V+++S G
Sbjct: 311 LVSLTLVGFLVPYTNENLMGGSSVDN---SPFVIAIRLHGIKALPSVVNAVILVSLLSVG 367

Query: 358 NSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFD 417
           NS I+  SR L  +   GL P         G P V +L    FG L +L  SS S  VF 
Sbjct: 368 NSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFT 427

Query: 418 WLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVII 477
           WL++I  ++    WL I+VSHIRF   +K +G+S D+L F +    YG+ Y+A   ++I+
Sbjct: 428 WLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLIL 487

Query: 478 LVQGFTAFTP 487
           + Q + +  P
Sbjct: 488 VAQFYVSLWP 497

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  261 bits (667), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 269/511 (52%), Gaps = 17/511 (3%)

Query: 13  SSSSTITAKPGAIKAEVLNHNTSEVESLCEK----PNQSDVKRELKPRHVTMXXXXXXXX 68
           SS      K  A +A+V + +    +   ++     +++ +K+ LK RH+ M        
Sbjct: 4   SSQDKEKVKATAYEADVEDCDIRSTDETLKQGVLHNDRTKLKQGLKERHIKMLTLVGVFG 63

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                     ++  GPVG L+AY+FV  +  C   ++ E+A+F+P T +    A +F+  
Sbjct: 64  TGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDE 123

Query: 129 ALGAANGYLYWLS-WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKF 187
           ++G   G   W+S +      E+S    ++ YW+D  P   ++ IF VL    N+  ++F
Sbjct: 124 SVGFTFG---WISTYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVVTNIYTIRF 179

Query: 188 YGEFEFWIASLKVIAILCFLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVGIVSQEIHTA 246
           YGE E+    LK+I I   +  GLV+  GG K   R+GF YW+DPGP+   IV   I   
Sbjct: 180 YGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYIVGGSI--G 237

Query: 247 QFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGL 306
           +F+G+ S+L    +++ G + + + AGETKN R  +      VF RI++ Y+ ++ V+ L
Sbjct: 238 KFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTL 297

Query: 307 LVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSR 366
           +V Y+D  LI  G+ T A +SPFV+A+N AG KVLP I+N +++ +  SAGN  I  GSR
Sbjct: 298 IVPYNDA-LIASGTGT-AKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSR 355

Query: 367 VLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVS 426
            L+ L     AP    +T+ RG+PYV V+  S F  L Y++ S  S +VF W   + + +
Sbjct: 356 NLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSN 415

Query: 427 GFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFT 486
               W+LIS +HI   + LK +G SR DLP+     PY A+++     + +L  GF  F 
Sbjct: 416 TLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFI 475

Query: 487 PFSAVDFVAYYISAFIFVVIWLLFQF--LFK 515
                D  +++   FI  +   LF F  LFK
Sbjct: 476 -HGHFDIESFFTRYFIIPLAIGLFTFWKLFK 505

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  261 bits (666), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/489 (32%), Positives = 257/489 (52%), Gaps = 17/489 (3%)

Query: 36  EVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVA 95
           E +SL E    S VKR LK RH+++                + +   GP+  LL +  + 
Sbjct: 29  ETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIG 88

Query: 96  TMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGR 155
            + + + +S+GE+ T  P    F   A RF S  L A +GY Y + +    A E + I  
Sbjct: 89  LVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISS 148

Query: 156 LILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVC 215
           ++ +W   VPI  +  IFW       LI V  +GE E+W+A  K++ ++ F  + +V + 
Sbjct: 149 ILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMS 208

Query: 216 GGSKLGR--IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAG 273
           GG   G+  IGF+YWK+PG    G          F G     +  +  + GTE V + A 
Sbjct: 209 GGIP-GKPPIGFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVALAAT 257

Query: 274 ETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAI 333
           E++NPR+ VP A+   F+RIL+ Y+G     G+ V Y+DP L   G+ T +  SP  +A+
Sbjct: 258 ESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTL---GAQTKSLKSPISIAL 314

Query: 334 NAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVA 393
           + AG      ++N  I++T ISA NS++Y+GSR L  L   GLAP  ++ T  RGVP  A
Sbjct: 315 SRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPA 374

Query: 394 VLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRD 453
           ++  +  G +  +NVS  + + ++++++++ V  F  W  IS++H+RF +    +G S  
Sbjct: 375 LIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLS 434

Query: 454 DLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIFVVIWLLFQFL 513
           +LP++A F P+   ++    I + L+QG+T+  PF A DFV  YI      ++++   F 
Sbjct: 435 ELPYRALFYPWTTIFSLAANIFLALIQGWTSLVPFVAKDFVDAYILLPAAGLLYVGINF- 493

Query: 514 FKGRWFHTV 522
           +K R F TV
Sbjct: 494 WKNRNFKTV 502

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 155/487 (31%), Positives = 262/487 (53%), Gaps = 15/487 (3%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           +HN  E  +   +    + K+ +K RHV M                  +  AGP   ++A
Sbjct: 79  DHNDLEKTTTAHQ----EQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134

Query: 91  YIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           Y  V+ + Y + Q+ GEMA   P +  SF  + S F+S   G A  +L+ + W     LE
Sbjct: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209
           +      I YW+ ++    ++ IF+V L  I+   V+ YGE EF   + K++ I  F+ +
Sbjct: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254

Query: 210 GLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELV 268
            +VV CGG+ K G IG +YW DPG +     +     ++F G   +L+ A F++ G EL 
Sbjct: 255 AIVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELF 309

Query: 269 GVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASP 328
            ++  + KNPR++ P A  +  +RI++ Y+ ++++IG +V ++  +L+        +ASP
Sbjct: 310 VLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASP 369

Query: 329 FVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRG 388
           +V+A +  G KV+P I+N VI++ +IS  NS++Y G R+L  L + G AP F+S    RG
Sbjct: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRG 429

Query: 389 VPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKR 448
            P  A+L +++ G +G+   S +   VF WL +I+ +S  FTW  I  SHIRF + +K +
Sbjct: 430 RPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ 489

Query: 449 GISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSA---VDFVAYYISAFIFVV 505
             S D L +KA    +G+Y+   F I++   Q + A +P ++    D  +++ S ++ + 
Sbjct: 490 NKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFAS-YLAMP 548

Query: 506 IWLLFQF 512
           IWL+F F
Sbjct: 549 IWLVFYF 555

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  263 bits (672), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/480 (31%), Positives = 255/480 (53%), Gaps = 12/480 (2%)

Query: 47  SDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLG 106
           +D+ ++L  RH+                  S +   GP   ++ ++ V+T  + V  SLG
Sbjct: 139 TDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLG 198

Query: 107 EMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPI 166
           E+A   PV   F+V+  +FV P+   A    Y L W +   LE+      I YW+ ++  
Sbjct: 199 ELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINS 258

Query: 167 TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-IGF 225
            AW++IF+V +   N++ VK +GE EF ++ +K++AI+ F   G+V+ CGG      IG 
Sbjct: 259 DAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGG 318

Query: 226 RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKA 285
           +YW DPG + VG  S     ++F G  S  + AAF+F G E+  V+A E++NPR T+PKA
Sbjct: 319 KYWHDPGAF-VGTTS----GSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKA 373

Query: 286 INTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIM 345
               F+ I   Y+  L ++G LV Y+DP+L+   S+ +A +SP V+AI       LP +M
Sbjct: 374 AKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLM 433

Query: 346 NGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGY 405
           N +I++ I+S  NS++Y  SR +  + +    P   ++   RG P  A+     FG L +
Sbjct: 434 NAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSF 493

Query: 406 LNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYG 465
           +  S K   VF WL +++ +S  F W+ I++ HIRF Q +  + IS D+LPF ++   +G
Sbjct: 494 VAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWG 553

Query: 466 AYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFVVIWLLFQFLFKG-RWF 519
           + Y    + ++++   +T+  P      +A  F   Y+S  I +  ++  +  FK  RW+
Sbjct: 554 SIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWY 613

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  262 bits (670), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 156/513 (30%), Positives = 264/513 (51%), Gaps = 26/513 (5%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           N      E + E   ++ +K+ L  RH+ +                  +   GP G + +
Sbjct: 84  NETIISEELINEDGRKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVAS 143

Query: 91  YIFVATMAYCVTQSLGEMATFIPVTSSFTV-----FASRFVSPALGAANGYLYWLSWCIT 145
           Y+ ++TM Y +   LGEM  ++P   S +         R++  +L  A G+ Y+  + + 
Sbjct: 144 YLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVML 203

Query: 146 FALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILC 205
            A E +    ++ YW+  VP  AW+ +F +++  +N+ PV+ YGE EFW A  K++ I+ 
Sbjct: 204 VAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVG 263

Query: 206 FLFYGLVVV-CGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF-Q 263
            +    ++   GG    R+GFRYW  PG +   I +       FL     +I  AF+F  
Sbjct: 264 LIILSFILFWGGGPNHDRLGFRYWITPGSFANTITNGSF--GNFLDVYKGIILGAFSFIL 321

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDP----QLIQDG 319
           G ELV + + E  +PRR + KA     +R++ FYI   L I ++V Y+DP     LIQD 
Sbjct: 322 GPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQD- 380

Query: 320 STTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379
               A +SPFV+ I  AG  VLP I+N  I+++  S+GN+ ++  SR L  +  +  AP 
Sbjct: 381 -KPGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPK 439

Query: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439
            + +    GVPYVAV+ + +   + YLN S  +  VF W  +++ +SGF  W+++SV+++
Sbjct: 440 CLGKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYL 499

Query: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP--FSAVDFVAYY 497
           RF + ++  G+ +D LP+     PY   Y+    I+I +  GF    P  ++  DF+A Y
Sbjct: 500 RFRKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAY 558

Query: 498 ISAFIFVVIWL---LFQFLFK-----GRWFHTV 522
           ++  IF++IW+    +++ FK      RW++ V
Sbjct: 559 LTLPIFLMIWIGHKFYKYRFKIFTRQCRWWYQV 591

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  261 bits (666), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 165/491 (33%), Positives = 256/491 (52%), Gaps = 26/491 (5%)

Query: 32  HNTSEVESLCEKPN---QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSL 88
           H+   +ES    P    + D+KR+L PRH+ M               +  +   GP    
Sbjct: 48  HSLESIESASFDPESNIREDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLF 107

Query: 89  LAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFAL 148
           + Y     + Y     LGEM+T++P++ SF  +A +F S +   A  + YW +  ++ A 
Sbjct: 108 MNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVAS 167

Query: 149 EISVIGRLILYW---SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILC 205
           +++ +  ++ YW       P  A   +FWV +  +N+I V+ YGE E+W+A LKVIAI+ 
Sbjct: 168 DLTALQLVLDYWKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIII 227

Query: 206 FLFYGLVVVCGGSKLGR-IGFRYWKD-PGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
           F    +VV  G +   + IGF  W     P+  G          F G+ S  + A+F + 
Sbjct: 228 FFILSIVVNVGHNPEHKYIGFHNWNHGDAPFVNG----------FKGFASLFVSASFAYG 277

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           GTE + +T GE  NP R  PK I TVF+RIL+FY+ S   I + V YD P L    +T +
Sbjct: 278 GTESITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGL----ATKS 333

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
              SPF +    AG+K     MN VIM ++ISA N  ++ GSRV+Y +   G  P ++++
Sbjct: 334 VMTSPFTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTK 393

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
           T     PYVAV  T   G L +      +G+V+ WL +I  VS    WL I+++ IRF +
Sbjct: 394 TNRYKAPYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRR 453

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFIF 503
            L+ +G +  +L FK    P+G Y+   FV  +IL+QG++AF P+S  +F + Y+  F+F
Sbjct: 454 GLELQGKTH-ELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDPWSTSNFFSVYLELFVF 512

Query: 504 ---VVIWLLFQ 511
               +IW L++
Sbjct: 513 PACYLIWWLYK 523

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  261 bits (668), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 148/464 (31%), Positives = 250/464 (53%), Gaps = 8/464 (1%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPV 85
           +++ L  +    +      + + +K+ +K RHV M               A  ++ AGP 
Sbjct: 63  ESQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPG 122

Query: 86  GSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
             ++ Y+ V+ + Y + Q+ GEM    P +  +F  + S FVS + G A  +L+ + W  
Sbjct: 123 SLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLT 182

Query: 145 TFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
              LE+      I YW+D +    ++AIF+V L  I+   VK YGE EF   S K++ I 
Sbjct: 183 VLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIA 242

Query: 205 CFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
            F+   +++ CGG+ + G IG  YW++PG +  G  +      +F G    L+ A F+F 
Sbjct: 243 GFIILSVIINCGGAGVDGYIGGEYWRNPGSFADGSSA-----TRFKGICFILVTAYFSFG 297

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           G EL  ++  E  NPR++ P A     +RIL+ Y+ ++++IG  V +D+ QL+  GS+  
Sbjct: 298 GIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSA- 356

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
            +ASP+V+A +  G KV+P I+N VI++++IS  NS +Y   R++  L + G AP F++ 
Sbjct: 357 THASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNY 416

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
               G P  A++  S  G +G++  SS+    F WL +I  +S  FTW  I +SHIRF +
Sbjct: 417 IDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRK 476

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
            +K +G S D++ +K+    +G+YY   F I++ + Q + A +P
Sbjct: 477 AMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSP 520

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  261 bits (666), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 153/454 (33%), Positives = 239/454 (52%), Gaps = 7/454 (1%)

Query: 36  EVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVA 95
           E  S+    + S  K+ +K RHV M                  +   GP G L+ Y  V+
Sbjct: 69  EGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVS 128

Query: 96  TMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIG 154
            +AY + Q+ GEMA   P +  +F V++S F+S + G A  +LY L W     LE+    
Sbjct: 129 VVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITAS 188

Query: 155 RLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVV 214
             I YW+ ++   A++AIF+ ++  I+      YGE EF  ++ KV  I  F+   +V+ 
Sbjct: 189 LTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVIN 248

Query: 215 CGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAG 273
           CGG+  G      YW++PG +  G          F G    L+ A F++ G EL  +T  
Sbjct: 249 CGGAGTGGYIGGEYWRNPGAFAGGSP-----IGHFKGIAYVLVTAYFSYGGMELFALTVN 303

Query: 274 ETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAI 333
           E  NPR+ VP A     +RIL+ Y+ ++++IG LV Y+  +L+     +  +ASP+V+A+
Sbjct: 304 EQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAV 363

Query: 334 NAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVA 393
            + G KV+P I+N VI+++++S GNS +Y   R+L  L   G AP   S     G P VA
Sbjct: 364 ASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVA 423

Query: 394 VLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRD 453
           ++  S+FG L ++  S K   VF WL +I  +S  FTW  I +SH+RF   +K +G S  
Sbjct: 424 LVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLS 483

Query: 454 DLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
           +L +K+K   +G+ YA FF I++ + Q + A  P
Sbjct: 484 ELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAP 517

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  261 bits (667), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 163/515 (31%), Positives = 264/515 (51%), Gaps = 25/515 (4%)

Query: 9   KGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXX 68
           KGD  S +   A  G +K +V  H                + ++L  RH+          
Sbjct: 70  KGDSHSLTRDEAGSGVMKEDVDGH--------------PQMNKDLDVRHLLTLAVGGAIG 115

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                   + + + GP   ++ ++ ++T  + V  SLGE+A   PV   F V+ +RF+ P
Sbjct: 116 TGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDP 175

Query: 129 ALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFY 188
           + G A    Y   W +   LE+      I YW+D +   AW+AIF+  +   N++ VK +
Sbjct: 176 SFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSF 235

Query: 189 GEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGF-RYWKDPGPWGVGIVSQEIHTAQ 247
           GE EF ++ +K++AI+ F   G+V+ CGG   G     +YW DPG + VG    E    +
Sbjct: 236 GETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAF-VG----ETSGTK 290

Query: 248 FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLL 307
           F G  S  + AAF++ G EL  V+A E+ NPR T+PKA    F+ I L Y+  L +IG L
Sbjct: 291 FKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCL 350

Query: 308 VRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRV 367
           V Y++P+L+   S+ +A +SP V+AI   G + LP +MN +I++ I+S  NS +Y  SR 
Sbjct: 351 VPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRC 410

Query: 368 LYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSG 427
           +  + R    P F+ R   +G P  A L T  FG L ++  S K   VF WL +++ +S 
Sbjct: 411 MVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLST 470

Query: 428 FFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
            F W+ I++SHIRF Q +  +GIS D+LP+ +     G++Y    + ++++   +T+  P
Sbjct: 471 IFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFP 530

Query: 488 F-----SAVDFVAYYISAFIFVVIWLLFQFLFKGR 517
                  A  F   Y+S  I +V ++  +   + +
Sbjct: 531 LGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKK 565

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  259 bits (662), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 157/489 (32%), Positives = 255/489 (52%), Gaps = 21/489 (4%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPV 85
           K E   HN    E     PN + VKR LK RH+++                + +   GP+
Sbjct: 24  KEEPDTHNIKSFEQF--DPN-TGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPL 80

Query: 86  GSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCIT 145
             LL +  +  +A+ V +S+GEM T  P  S F+  + RF S AL A +GY Y + +   
Sbjct: 81  SLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAV 140

Query: 146 FALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILC 205
            A E + +  ++ +W   VP+  ++ IF V      ++ V  +GEFE+W+A  K+I ++ 
Sbjct: 141 LANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIA 200

Query: 206 FLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQG 264
           +  + ++ + GG K     GF YW +PG    G          F G     +  +  + G
Sbjct: 201 YYIFSIIYISGGIKNRPAFGFHYWNNPGALADG----------FKGIAVVFVFCSSFYSG 250

Query: 265 TELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNA 324
           TE V + A E++NP + VP AI   F+RI++ Y+G  +  G  V Y+D  L   G+ T A
Sbjct: 251 TESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL---GAHTKA 307

Query: 325 NASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRT 384
             SP  +AI  AG +    ++N  I++T +SA N ++Y+GSR L  L   GLAP F+  T
Sbjct: 308 LKSPIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWT 367

Query: 385 TSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQC 444
             RGVP  A+   +  G +  +NVS  + + + ++++++ V  F  W +IS++H+RF + 
Sbjct: 368 DKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKA 427

Query: 445 LKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYI----SA 500
              +G S  +LP+K+   P+G  ++    I + L+QG+T F PFSA DFV  YI    + 
Sbjct: 428 WDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVPFSAKDFVDAYILLPAAV 487

Query: 501 FIFVVIWLL 509
            +++VI L+
Sbjct: 488 ILYIVISLV 496

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  261 bits (667), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 153/494 (30%), Positives = 259/494 (52%), Gaps = 16/494 (3%)

Query: 35  SEVESLCEKPNQSD---VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAY 91
           S+ + L  + N  D   +++ ++PRHV M                S +  AGP   ++ Y
Sbjct: 102 SKSKQLHGQKNGDDDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGY 161

Query: 92  IFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEI 150
             + +  YC+ Q+ GEMA  +  +  +F  + S  V   +     ++Y L W     LE+
Sbjct: 162 GIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLEL 221

Query: 151 SVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYG 210
                 I YW+  V    ++ IF+VL+T IN    K Y E EF+  S KV+ +  F    
Sbjct: 222 VTASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILA 281

Query: 211 LVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
           +V+  GG+   G IG +YW +PG +       +    +F   +S+   AAF F  +E + 
Sbjct: 282 IVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIA 336

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPF 329
           + A E  NPRR +P A  T+ +RIL  ++ S+ ++G LV YD  +L+  G + ++ ASP+
Sbjct: 337 IGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPY 396

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           V+A+ + G +V+P  +N VI+++++S  NS  Y   R+LY L + G AP +       G 
Sbjct: 397 VIAVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGR 456

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           P  A+L T++FG + + + S K   VF WLLSI  +S  FTW  I +SHIRF + +K +G
Sbjct: 457 PARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQG 516

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFV 504
            S D++ FK++   +G+ YAA  +I+ ++ + + +  P       A +F   Y++  I +
Sbjct: 517 RSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILI 576

Query: 505 VIWLLFQFLFKGRW 518
           V++  ++ ++K  W
Sbjct: 577 VLYFGYK-IYKKDW 589

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  259 bits (662), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 153/492 (31%), Positives = 261/492 (53%), Gaps = 15/492 (3%)

Query: 10  GDGSSSSTITAKPG-AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXX 68
           G  S  S      G AI ++ L+ N    E         ++ ++L  RH+          
Sbjct: 44  GQSSKDSGYKISTGSAIDSDSLHGNNVAFEY------GENLNKDLDIRHLLTLAIGGSIG 97

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                   + +   GP   ++ ++ +++  + V  +LGE+A   P+   F V+ +RFV P
Sbjct: 98  TGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDP 157

Query: 129 ALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFY 188
           +   A    Y + W ++  LE+      I YW+  +   AW+ IF+V +  +N++ VKF+
Sbjct: 158 SFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFF 217

Query: 189 GEFEFWIASLKVIAILCFLFYGLVV-VCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQ 247
            E EF ++ +K++AI+ F   G+V+ V GG   G IG +YW DPG +       +   ++
Sbjct: 218 SEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSR 272

Query: 248 FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLL 307
           F G  S  + AAF++ G E+  V+A E+KNPR+T+PKA    F+ I   YI  L +IG+L
Sbjct: 273 FKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGIL 332

Query: 308 VRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRV 367
           V Y+D +L+   S+ +A+ASP V+AI  AG K LP +MN +I++ ++S  NS +YV SRV
Sbjct: 333 VPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRV 392

Query: 368 LYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSG 427
           +  +  +   P   S+   RG P  ++ AT   G L ++  S K   VF WL +I  +S 
Sbjct: 393 MVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLST 452

Query: 428 FFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
            F W+ I+++HIRF   LK +  S D+L + ++   +G++Y    ++++++   + +  P
Sbjct: 453 IFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFP 512

Query: 488 F--SAVDFVAYY 497
              S+ D  A++
Sbjct: 513 VGESSADAEAFF 524

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  259 bits (663), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 157/492 (31%), Positives = 256/492 (52%), Gaps = 20/492 (4%)

Query: 31  NHNTSEVESLCEKPNQSD--VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSL 88
            H  S++E   +     D  +K+ +K RHV M                  +  AGP   +
Sbjct: 58  KHADSDLEDGSKSITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLV 117

Query: 89  LAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFA 147
           L Y  V+ + Y + Q+ GEMA   P + +SF  +AS FVS   G A  +L+ + W     
Sbjct: 118 LGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLP 177

Query: 148 LEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFL 207
           LE+      I YW+D +    ++ IF+V L  I+   VK YGE EF   S K++ I  F+
Sbjct: 178 LELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFI 237

Query: 208 FYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTE 266
              +V+ CGG+ + G IG +YW +PG +     + E   A+F G    L+   F++ GTE
Sbjct: 238 ILSIVINCGGAGRDGYIGNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTE 292

Query: 267 LVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANA 326
           L  ++  E KNPR++ P A     +RIL+ Y+ ++++IG  V +D  QL+  G +   +A
Sbjct: 293 LFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSAT-HA 351

Query: 327 SPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTS 386
           SP+V+A +  G KV+P  +N VI+++++S  NS +Y   R++  L   G AP + +    
Sbjct: 352 SPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDR 411

Query: 387 RGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLK 446
            G P  A+    +FG +G++  S +    F WL +I  +S  FTW  I +SHIRF   +K
Sbjct: 412 EGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMK 471

Query: 447 KRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAYYISA 500
            +G S ++L ++A    +G+ Y+ FF +++ + Q + A +P      + A  F   Y++A
Sbjct: 472 VQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAA 531

Query: 501 FIFVVIWLLFQF 512
                +WL+F F
Sbjct: 532 ----PLWLVFYF 539

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  260 bits (665), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 150/498 (30%), Positives = 261/498 (52%), Gaps = 14/498 (2%)

Query: 22  PGAIKAEVLNHNTSEVESLCEKPNQS-DVKRELKPRHVTMXXXXXXXXXXXXXXXASPIR 80
           P +  A+ L  N S  +      N+S  +K+ ++PRHV M                + + 
Sbjct: 88  PSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALV 147

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYW 139
           +AGP G L+ Y  + ++ YC+ Q+ GE+A  +  +T  +  + S  V    G A  ++Y 
Sbjct: 148 HAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYC 207

Query: 140 LSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199
           L W     LE+      I YW+ +V    ++ IF+VL+  IN+   + Y E EF+    K
Sbjct: 208 LQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCK 267

Query: 200 VIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKA 258
           ++ +  F    +++  GG+   G IG +YW DPG +     + +    +F G V++L+ A
Sbjct: 268 ILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHSIDRFKGVVATLVTA 322

Query: 259 AFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD 318
           AF F G+E + +T  E  NPR+ +P A   + +RIL  ++ +++++G LV Y+  QL+  
Sbjct: 323 AFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGS 382

Query: 319 GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAP 378
           G      ASP+V+AI + G +V+P  +N VI+++++S  NS+ Y  +R+   L   G AP
Sbjct: 383 GGG-GTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAP 441

Query: 379 AFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSH 438
            F S     G P +A+  +++F  + +   S K   VF WLL+I+ +S  FTW  I  SH
Sbjct: 442 KFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSH 501

Query: 439 IRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDF 493
           IRF + +K +G S  +L FK++   +G+ YA   +++I++ Q + A  P       A  F
Sbjct: 502 IRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAF 561

Query: 494 VAYYISAFIFVVIWLLFQ 511
              Y++  I + +++ ++
Sbjct: 562 FENYLAMPILIALYVGYK 579

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  258 bits (660), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 138/443 (31%), Positives = 235/443 (53%), Gaps = 6/443 (1%)

Query: 46  QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSL 105
           Q  +K  +K RH+TM                  +   GP G ++ Y+  +TM YCV Q+ 
Sbjct: 65  QQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQAC 124

Query: 106 GEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
            E+   +  +  ++  + +  V    G A   +Y L W     LE+      + YW+ +V
Sbjct: 125 CELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSV 184

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224
               ++AIF+V L  I+    + Y E EF   SLKV+ +  F+   + +  G S+ G IG
Sbjct: 185 NPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIG 244

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
            +YW DPG +G      +    +F G  S  ++AAF + G+E + +TA E  NPR +VPK
Sbjct: 245 GQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           A     +R+++ ++  +++IG LV ++  QL+     + + ASPFV+A    G +V+P I
Sbjct: 300 ATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHI 359

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
           +N +I+ ++IS GNS +Y   R+L  L   G+ P   +    +G P V ++  S+FG + 
Sbjct: 360 INFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIA 419

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           ++  S++  +VF WL +I  +S  FTW  I+VSH+RF + ++ +G S  +L ++A     
Sbjct: 420 FVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGAL 479

Query: 465 GAYYAAFFVIVIILVQGFTAFTP 487
           G+YYA FF +++++ Q + A  P
Sbjct: 480 GSYYAIFFNVIVLIAQFWIAIAP 502

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  260 bits (665), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 168/520 (32%), Positives = 273/520 (52%), Gaps = 21/520 (4%)

Query: 8   PKGDGSSSSTITAKPGAIKAEVL---NHNTSEVESLCEKPNQSD-VKRELKPRHVTMXXX 63
           P+ D   +++IT+    I  E+L   N +   V    +  N+SD +K+ +KPRHV M   
Sbjct: 107 PEKD---TASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTIKPRHVLMISL 163

Query: 64  XXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFA 122
                        S +  AGP G LL +  + T  YC+ Q++GEMA  +  +   F  + 
Sbjct: 164 GTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYP 223

Query: 123 SRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINL 182
           S  V PA G +  ++Y L W     LE+      I YW+  V    ++ IF+VL+ AIN+
Sbjct: 224 SFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINI 283

Query: 183 IP-VKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVS 240
           +     Y E EF   S K++ ++ F   G++++CGG+   G IG +YW +PG +      
Sbjct: 284 VGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAF-----R 338

Query: 241 QEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
            E    +F G +++L+ AAF F  +E +GVTA E  NPR+ +P A   + +RI+  ++ S
Sbjct: 339 GEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLAS 398

Query: 301 LLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSN 360
           + ++G LV YD  QL+   S     ASP+V+A++  G KV+P  +N VI+++++S  NS 
Sbjct: 399 ITIVGFLVPYDSDQLL-GSSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSA 457

Query: 361 IYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLL 420
            Y  SR+L  L   G AP         G P V +   S+FG + +   S K   VF WLL
Sbjct: 458 FYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLL 517

Query: 421 SITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQ 480
           +I+ +S  FTW+ I VSH+RF + +  +G S  +L F+++   +G+ YAA  ++ I++ Q
Sbjct: 518 AISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQ 577

Query: 481 GFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQFLFK 515
            + A  P       A +F   Y++  I + ++  ++   K
Sbjct: 578 FWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTK 617

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/484 (30%), Positives = 248/484 (51%), Gaps = 14/484 (2%)

Query: 42  EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCV 101
           ++ + +++++ +KPRHV M               A P+  AGP   ++ Y  + T  YC+
Sbjct: 152 KEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCI 211

Query: 102 TQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW 160
            Q+ GEMA  +  +T SF  F S  V P    A  ++Y + W     LE+      I YW
Sbjct: 212 IQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYW 271

Query: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL 220
           +  V    ++ IF+VL+  IN    K Y E EF   + KV+ I  F    + +  G +  
Sbjct: 272 TTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGT 331

Query: 221 -GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279
            G IG +YW DPG +       +    +F G + + + AAF F  TE + +TA E  NPR
Sbjct: 332 DGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPR 386

Query: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTK 339
           + +P A   + +R+L+ ++ ++++IG LV YD  QL+  G +    ASP+V+AI+  G +
Sbjct: 387 KAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSA-TKASPYVLAISLHGVR 445

Query: 340 VLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSM 399
           V    +N VI++++IS GNS  Y  SR+L  L + G AP         G P +A+  +++
Sbjct: 446 VAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAV 505

Query: 400 FGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKA 459
              + +   S K   VF WL++I  +S  FTW  I +SH+RF + +K +G S  ++ + +
Sbjct: 506 IAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLS 565

Query: 460 KFMPYGAYYAAFFVIVIILVQGFTAFTPF-----SAVDFVAYYISAFIFVVIWLLFQFLF 514
           +    G+ YAA  +I+ ++ Q + A  P       A  F + Y++  I +V +  ++ ++
Sbjct: 566 QTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYK-IW 624

Query: 515 KGRW 518
           K  W
Sbjct: 625 KRDW 628

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  257 bits (657), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/486 (32%), Positives = 249/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + +++KR LK RH+ M                  I   GP+  ++ +    +        
Sbjct: 81  DTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHG 140

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  +++RF+ P+L      +Y + W     LEI      + YW+ ++
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSI 200

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRI 223
               W+AIF+  + +INL   + +GE EF  +S+KV+ I  F+   +V++CGG      +
Sbjct: 201 DPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFV 260

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G +YW DPG    G          F G +S L+ A+++  GTE+V + +GET +P+  +P
Sbjct: 261 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DPKE-LP 308

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI   F+RIL F++ SL +IG LV Y +  L+   S  N   SPFV+AI     KVLP 
Sbjct: 309 SAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNN---SPFVIAIKLHQIKVLPS 365

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+++I+S GNS I+  SR L  +   GL P F       G P   ++  S+FG L
Sbjct: 366 IVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLL 425

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  SS    VFDWL++I  ++    WL I++SHIRF   +K +G S D+L F +    
Sbjct: 426 AFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGI 485

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+A    +I++ Q + A  P          A  F   Y+ A I +V+++  +  ++
Sbjct: 486 WGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYR 545

Query: 516 ---GRW 518
              G+W
Sbjct: 546 YKTGKW 551

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 155/510 (30%), Positives = 264/510 (51%), Gaps = 15/510 (2%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           E   +G     + +   A    + + N  E  +   K N   +K+ +K RHV M      
Sbjct: 45  EESRNGLVHRFVDSFKRAESQHLEDDNDLEDGTRSMKSNNR-LKKSMKSRHVVMMSLGTG 103

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRF 125
                    A  ++ AGP   ++ Y+ V+ + Y + Q+ GEM    P +  +F  + S F
Sbjct: 104 IGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIF 163

Query: 126 VSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPV 185
           +S + G A  +++ + W     LE+      I YW+D +    ++ IF+V L  I+   V
Sbjct: 164 ISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGV 223

Query: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIH 244
           K YGE EF  +S K++ I  F+   +V+ CGG+ + G IG +YW+DPG +  G       
Sbjct: 224 KAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGN-----G 278

Query: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304
             +F G    L+ A F+F G EL  ++  E  NPR++ P A     +RIL+ Y+ ++++I
Sbjct: 279 ATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILI 338

Query: 305 GLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVG 364
           G  V +++ QL+  GS    +ASP+V+A +    +V+P I+N VI++++IS  NS +Y  
Sbjct: 339 GFNVPHNNDQLMGSGSAA-THASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAA 397

Query: 365 SRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITA 424
            R++  L + G AP F+      G P  A+    + G +G++  S +    F WL +I  
Sbjct: 398 PRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAG 457

Query: 425 VSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA 484
           +S  FTW  I +SHIRF + +K +G S D++ +KA    +G+YY  FF I++ + Q + A
Sbjct: 458 LSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVA 517

Query: 485 FTPF------SAVDFVAYYISAFIFVVIWL 508
            +P       +A  F   Y++A +++ ++L
Sbjct: 518 LSPIGNGGKCNAQAFFESYLAAPLWLCMYL 547

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  257 bits (657), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/492 (31%), Positives = 256/492 (52%), Gaps = 16/492 (3%)

Query: 31  NHNTSEVESLCEKP--------NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNA 82
           ++  SEV+S  E+           + +K+ +K RHV M               A  +   
Sbjct: 65  DNKHSEVDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFG 124

Query: 83  GPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLS 141
           GP   ++ Y  V+ + Y + Q+ GEMA   P +  +F  +AS FVS   G A  +L+ + 
Sbjct: 125 GPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQ 184

Query: 142 WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVI 201
           W     LE+     +I YW++ V    ++ IF+V L  I+ I VK YGE EF     K++
Sbjct: 185 WLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKIL 244

Query: 202 AILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAF 260
            I  F+ + +VV CGG+   G IG +YW  PG +  G  + E    +F G    L+   F
Sbjct: 245 MIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFA-GTNAAE----RFKGVCYVLVSGYF 299

Query: 261 TFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGS 320
           ++ GTEL  ++  E +NPR++ P A     +RIL+ Y+ ++++IG  V ++D QL+  G 
Sbjct: 300 SYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGG 359

Query: 321 TTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAF 380
           +   +ASP+V+A +  G +V+P I+N VI++ +IS  NS++Y   R+L  L   G AP F
Sbjct: 360 SAT-HASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKF 418

Query: 381 ISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIR 440
           ++     G P  A+LA ++FG + +   S +   VF WL +I  +S  FTW  I +SH+R
Sbjct: 419 MTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVR 478

Query: 441 FMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISA 500
           F Q +K +G   +++ + A    +G+ Y   F I++ + Q + A  P  +      +  +
Sbjct: 479 FRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFES 538

Query: 501 FIFVVIWLLFQF 512
           ++   IW+ F F
Sbjct: 539 YLAFPIWIAFYF 550

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  258 bits (658), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/491 (30%), Positives = 270/491 (54%), Gaps = 10/491 (2%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           N ++ + +SL  +  +   +R+L PR V+M                + I   GP   L+A
Sbjct: 101 NRDSPKSQSLSLE--ERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIA 158

Query: 91  YIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEI 150
           +   + +   +++ +  M T++PVT SF  F  RFV  + G A G+ Y++        EI
Sbjct: 159 FCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEI 218

Query: 151 SVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYG 210
           + +  ++ YW+D +P  A +++  +L  ++NL  V F+GE EF+++  KV+  +  + + 
Sbjct: 219 TAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFT 278

Query: 211 LVVVCGGSKLGRI-GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
           +VV+ GG+    + GF+ W +PG +   I    +   +F G++S L+ A + F G + +G
Sbjct: 279 VVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSV--GRFHGFMSCLVFALYVFWGVDYLG 336

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ--DGSTTNANAS 327
             A E  NPR+ +P +   VF R+++FYIG  + +G+L+ Y+DP +I+        A AS
Sbjct: 337 NAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGAS 396

Query: 328 PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSR 387
           P+V A+   G +VLP I+N +I+ +IISAGNS++Y  SRVL+ L     AP     TT +
Sbjct: 397 PYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKK 456

Query: 388 GVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKK 447
           GVP    +A  +   L YL+VS+ + +V  W L++   +    ++ I VS+++F +    
Sbjct: 457 GVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLA 516

Query: 448 RGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYISAFI--FVV 505
           + +    LP+ +  +PY A+++ F++++++LV G+T F   S  D  ++  S F+  F +
Sbjct: 517 QNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSW-DTQSFVFSYFMIPFFL 575

Query: 506 IWLLFQFLFKG 516
           ++L    L+KG
Sbjct: 576 VFLFGHKLYKG 586

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  256 bits (654), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 157/494 (31%), Positives = 257/494 (52%), Gaps = 20/494 (4%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSD-VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           +AEV NHN  ++E         D +K+ +K RHV M               A  +  AGP
Sbjct: 54  RAEV-NHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGP 112

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWC 143
              ++ Y  V+ + Y V Q+ GEMA   P +   F  +AS FVS   G A  +L+ + W 
Sbjct: 113 ASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWL 172

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
               LE+      I YW+D +    ++ I +V L  I+   V+ YGE EF   S K++ I
Sbjct: 173 TVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMI 232

Query: 204 LCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
             F+   +VV CGG+ + G IG +YW+DPG +     + +   ++F G    L+ A F++
Sbjct: 233 GGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSY 287

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            G EL  ++  E +NPRR+ P A     +RIL+ Y+ ++++IG  V ++  QL+  G + 
Sbjct: 288 GGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSA 347

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
             +ASP+V+A++  G KV+P I+N VI++++ S  NS +Y   R+L  L   G AP + +
Sbjct: 348 -THASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFN 406

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
                G P  A++  S+FG + +   S +   +F WL +I  +S  FTW  I +SH+RF 
Sbjct: 407 YVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFR 466

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP------FSAVDFVAY 496
             +K +G S ++L + +    +G+ Y  FF +++ + Q + A +P      +SA  F   
Sbjct: 467 LAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFES 526

Query: 497 YISAFIFVVIWLLF 510
           Y++      +WL F
Sbjct: 527 YLA----FPVWLFF 536

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  258 bits (659), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 151/464 (32%), Positives = 249/464 (53%), Gaps = 14/464 (3%)

Query: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLA 90
           +H+ +++    +     ++K+ +KPRHV M                S +  AGP G ++ 
Sbjct: 143 HHHDAQIN---DNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIG 199

Query: 91  YIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149
           +  + +  YC+ Q++GE+A  +  +   F  + S  V  A   A  +LY + W     LE
Sbjct: 200 FGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLE 259

Query: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKVIAILCFLF 208
           +      I YW+  V    ++ IF++L+  INL+     Y E EF   S K++ ++ F  
Sbjct: 260 LVTASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFI 319

Query: 209 YGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTEL 267
            G+ V+CGG+   G IG +YW DPG      +  +    +F G +++L+ AAF F  +E 
Sbjct: 320 LGITVICGGAGTDGYIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEF 374

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGST-TNANA 326
           +GVTA E  NPR+ +P A   + +RIL  ++ S+ ++G LV Y+  QL+  GST +   A
Sbjct: 375 IGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLL--GSTGSGVKA 432

Query: 327 SPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTS 386
           SP+V+AI+  G +V+P  +N VI+++++S  NS  Y  SR+L  L   G AP   S    
Sbjct: 433 SPYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDR 492

Query: 387 RGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLK 446
            G P V +   ++FG + +   S K   VF WLL+I+ +S  FTW+ I +SHIRF + + 
Sbjct: 493 EGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMH 552

Query: 447 KRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSA 490
            +G S  +L F+++   YG+ YAA  + +I++ Q + A  P +A
Sbjct: 553 VQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINA 596

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  256 bits (653), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 142/464 (30%), Positives = 247/464 (53%), Gaps = 8/464 (1%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPV 85
           +++ L  +    +      + + +K+ +K RHV M               A  +  AGP 
Sbjct: 63  ESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPG 122

Query: 86  GSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
             ++ Y+ V+ + Y + Q+ GEM    P +  +F  + S F+S + G A  +L+ + W  
Sbjct: 123 SLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLT 182

Query: 145 TFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
              LE+      + YW+D +    ++ IF+V L  I+   VK YGE EF   S K++ + 
Sbjct: 183 VLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVA 242

Query: 205 CFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
            F+   +V+ CGG+ + G IG +YW+DPG +  G         +F G    L+ A F+F 
Sbjct: 243 GFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGS-----GATRFKGICYILVSAYFSFG 297

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           G EL  ++  E  NPR++ P A     +RIL+ Y+ ++++IG  V +++ QL+  G +  
Sbjct: 298 GIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSA- 356

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
            +ASP+V+A +    +V+P I+N VI++++IS  NS +Y   R++  L + G AP F++ 
Sbjct: 357 THASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNY 416

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
               G P  A++  S+ G +G++  S +    F WL +I  +S  FTW  I +SHIRF +
Sbjct: 417 IDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRK 476

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
            +K +G S D++ +KA    +G+YY  FF +++ + Q + A +P
Sbjct: 477 AMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSP 520

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  255 bits (652), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 250/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + S++KR LKPRH+ M                  I   GP+G ++ +    +        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHG 133

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  + +RF+ P++      +Y L W     LEI      + YW+ ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-I 223
               W+AIF+ ++ +INL  V+ +GE EF  +++K I +  F+   +V++CGG      I
Sbjct: 194 DPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFI 253

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G +YW DPG    G          F G +S L+ A+++  G E+  + +GET +P+  +P
Sbjct: 254 GAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DPK-GLP 301

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI  VF+RIL F++ SL ++G LV Y +  L+   S  N   SPFV+AI     K LP 
Sbjct: 302 SAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDN---SPFVIAIKLHHIKALPS 358

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+++++S GNS I+  SR L  +   GL P +       G P V ++A S+FG L
Sbjct: 359 IVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLL 418

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  S     VF+WL++I  ++    WL I++SHIRF   +K +G S D+L F +    
Sbjct: 419 AFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGI 478

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+A    +I++ Q + +  P          A  F   Y+ A I + I+++ +  +K
Sbjct: 479 WGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYK 538

Query: 516 ---GRW 518
              G+W
Sbjct: 539 CQTGKW 544

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  254 bits (650), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 158/512 (30%), Positives = 259/512 (50%), Gaps = 18/512 (3%)

Query: 19  TAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASP 78
           + KP A K + L   T + +S  +    +   R LK RHV +                  
Sbjct: 33  SVKP-AKKTDWLGCVTDDEDSSSDLLYSTQTFRRLKNRHVQLIAISGVIGTALFVAIGKA 91

Query: 79  IRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLY 138
           +   GP   L+A+        C+T S  EM  F+PV+S F   A+R    +L     + +
Sbjct: 92  LYKGGPAFLLIAFALWCVPILCITVSTAEMVCFLPVSSPFLRLAARCADDSLAVMASWNF 151

Query: 139 WLSWCITFALEISVIGRLILYWSD----AVPITAWMAIFWVLLTAINLIPVKFYGEFEFW 194
           W   C+    EI  +  +I YW D    A+P+   + ++++    I++  VK+YGE EFW
Sbjct: 152 WFLQCVQIPFEIVSVNTIIHYWRDDYSAAIPLVVQIVLYFL----ISICAVKYYGETEFW 207

Query: 195 IASLKVI-AILCFLFYGLVVVCGGSKLGRIGFRYWKD---PGPWGVGIVSQEIHTAQFLG 250
           +AS K+I A+  FLF  + ++ G  K  R GFRY+ +      +  G          F G
Sbjct: 208 LASFKIILALGLFLFTFITMLGGNPKHDRYGFRYYGETPFKKYYPNGDKDAGASVGYFQG 267

Query: 251 WVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRY 310
           +++ LI+A+FT  G E + + AGE K PR+ +P+A   VF+R+   ++GS L +G++   
Sbjct: 268 FLACLIQASFTIAGGEYISMLAGEVKLPRKVLPRAFKQVFYRLTFLFLGSCLCVGIICSA 327

Query: 311 DDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVL 368
           +DP L    D S   A +SP+V+A+N  G KVLPDI+N  ++    SAGN+  Y  SR L
Sbjct: 328 NDPALTAAIDESRPGAGSSPYVIAMNNLGIKVLPDIVNAALITAAFSAGNAYTYCSSRTL 387

Query: 369 YGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGF 428
           YG+   G AP   +R    GVP  +VL + ++G +  L ++  S  V +WL+++   S  
Sbjct: 388 YGMALDGYAPRIFTRCNKHGVPIYSVLISLLWGLISLLQLNDNSAVVLNWLINLITASQL 447

Query: 429 FTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP- 487
             + ++ + ++ F +           LPFK+   PY A         +IL+QG+T F P 
Sbjct: 448 INFTVLCIIYLFFRRAYLLHKDILPKLPFKSWGQPYTAIVGLVSATAMILIQGYTVFFPS 507

Query: 488 -FSAVDFVAYYISAFIFVVIWLLFQFLF-KGR 517
            ++  DF+  Y+  FI + I++ ++F++ +GR
Sbjct: 508 LWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGR 539

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  256 bits (653), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 156/482 (32%), Positives = 258/482 (53%), Gaps = 18/482 (3%)

Query: 46  QSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSL 105
           + ++K+ +KPRHV M                S +  AGP G +  Y  + T  YC+ QS 
Sbjct: 107 EDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSA 166

Query: 106 GEMAT-FIPVTSSFTVFASRFVSPA--LGAANGYLYWLSWCITFALEISVIGRLILYWSD 162
           GEMA  +  +   F  + +  V P   +    G L+ +  C++F   I        YW+ 
Sbjct: 167 GEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFG--IGYCFDDYKYWTT 224

Query: 163 AVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLG 221
            V    ++ IF+VL+  IN+   + Y E EF+    KV+ +  F   G+++  GG+   G
Sbjct: 225 RVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDG 284

Query: 222 RIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRT 281
            +G  YW++PG +       +     F G V++L+ AAF F GTE + +TA E  NPR+ 
Sbjct: 285 YLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKA 339

Query: 282 VPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVL 341
           +P A   V +RI+L Y+ S+++IG LV +  P+L+  GS   A ASP+V+A+ + G +V+
Sbjct: 340 IPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATA-ASPYVIAVASHGVRVV 398

Query: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401
           P  +N VI+++++S GNS  Y  SR+L  L + G AP +       G P  A++ +++FG
Sbjct: 399 PHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFG 458

Query: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461
            + +   S K   VF WLL+I+ +S  FTW+ I +SHIRF   +K +G S  ++ FKA+ 
Sbjct: 459 VIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQT 518

Query: 462 MPYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWLLFQFLFKG 516
             +G+YY+ F +I+ ++ Q + A  P      SA +F   Y++  I +  +  ++ ++K 
Sbjct: 519 GIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYK-IWKK 577

Query: 517 RW 518
            W
Sbjct: 578 DW 579

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  255 bits (651), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 250/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + S++KR LKPRH+ M                  I   GP+G +L +    +        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 133

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  + +RF+ P++      +Y L W     LEI      + YW+ ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-I 223
               W+AIF+V++ +INL  V+ +GE EF  +++K I +  F+   +V++ GG      +
Sbjct: 194 DPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYV 253

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G +YW DPG    G          F G +S L+ A+++  G E+  + +GET +P+  +P
Sbjct: 254 GAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DPK-GLP 301

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI  VF+RIL F++ SL ++G LV Y +  L+   S  N   SPFV+AI     KVLP 
Sbjct: 302 SAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSSVDN---SPFVIAIKLHHIKVLPS 358

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+++++S GNS I+  SR L  +   GL P +       G P V ++A S+FG L
Sbjct: 359 IVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLL 418

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  S   G VF+WL++I  ++    WL I+VSHIRF   +K +G   D+L F +    
Sbjct: 419 AFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGI 478

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+A    +I+L Q + +  P          A  F   Y+ A I + I++  +  +K
Sbjct: 479 WGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYYK 538

Query: 516 ---GRW 518
              G+W
Sbjct: 539 CQTGQW 544

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 153/486 (31%), Positives = 249/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + S++KR LKPRH+ M                  I   GP+G +L +    +        
Sbjct: 75  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 134

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  + +RF+ P++      +Y L W     LEI      + YW+ ++
Sbjct: 135 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 194

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-I 223
               W+AIF+ ++  INL   + +GE EF  +++K I +  F+   +V++CGG      I
Sbjct: 195 DPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFI 254

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G +YW DPG    G          F G ++ L+ A+++  G E+  + +GET +P+  +P
Sbjct: 255 GAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGET-DPK-GLP 302

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI  VF+RIL F++ SL ++G LV Y +  L+   S  N   SPFV+A+     KVLP 
Sbjct: 303 GAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSSVDN---SPFVIAMKLHHIKVLPT 359

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+++++S GNS I+  SR L  +   GL P +       G P V ++A S+FG L
Sbjct: 360 IVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLL 419

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  S     VF+WL++I  ++    WL I++SHIRF   +K +G S D+L F +    
Sbjct: 420 AFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGI 479

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+A    +I++ Q + +  P          A  F   Y+ A I + I+++ +  +K
Sbjct: 480 WGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYK 539

Query: 516 ---GRW 518
              G+W
Sbjct: 540 CQTGKW 545

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  254 bits (650), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/511 (30%), Positives = 258/511 (50%), Gaps = 17/511 (3%)

Query: 14  SSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXX 73
           S S++T+    I+ E ++  T+ + S       +   R+L  RHV +             
Sbjct: 39  SDSSLTSNTTQIEEEEVDSTTNLIYS-------TKTHRKLLNRHVQLIAISGVIGTALFV 91

Query: 74  XXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAA 133
                + + GP   L+A+        C+T S  EM +F+PV S F   AS+    +L   
Sbjct: 92  AIGKALYHGGPAFLLIAFALWCIPILCITVSTAEMVSFLPVASPFLRLASKCADESLAVT 151

Query: 134 NGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEF 193
             + +W   C+    EI  +  +I YW D       + +  VL   I++  VK+YGE EF
Sbjct: 152 ASWNFWFLECVQIPFEIVSVNTIIHYWRDDYNAAIPLVVQVVLYLFISIATVKYYGEMEF 211

Query: 194 WIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQ----F 248
           W+AS K+I  +   F+ LV + GG+ K  R GFRYW +  P+         +       F
Sbjct: 212 WLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRYWGEE-PFKKYYPDNNTNGTDSLGYF 270

Query: 249 LGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLV 308
            G+++ LI+AAFT  G E + + AGE K PR+ +PKA   VF+R+ + ++G+ L +G++ 
Sbjct: 271 QGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPKAFKQVFWRLTIIFLGTCLCLGIVC 330

Query: 309 RYDDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSR 366
             +DP L    + +   A +SPFV+A+N    +VLPDI+N  ++ +  SAGN+  Y  SR
Sbjct: 331 SPNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLPDIVNAALITSAFSAGNAYTYCSSR 390

Query: 367 VLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVS 426
            LYG+   G AP   +R    GVP  AV  + ++  +  L ++S S  V +WL+++   S
Sbjct: 391 TLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWALISLLQLNSNSAIVLNWLVNLITAS 450

Query: 427 GFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF- 485
               ++ + V ++ F +    +      LPF++   PY A +       +I +QG+T F 
Sbjct: 451 QLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQPYTAIFGLVCAFSMIFIQGYTVFI 510

Query: 486 -TPFSAVDFVAYYISAFIFVVIWLLFQFLFK 515
            + ++  DF+  Y+  FI V I+L ++F++K
Sbjct: 511 HSLWNTRDFLFCYLMVFINVAIYLGYKFIWK 541

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  254 bits (648), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 157/479 (32%), Positives = 247/479 (51%), Gaps = 21/479 (4%)

Query: 51  RELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMAT 110
           R+L+ RHV +                  +   G V  LL +        C+T S  EM  
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVC 114

Query: 111 FIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWM 170
           ++P+ S F   ASR V+ +L    G+ +W   C+    EI  +  +I YW D       +
Sbjct: 115 YLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYWRDDYSAAITL 174

Query: 171 AIFWVLLTAINLIPVKFYGEFEFWIASLKV---IAILCFLFYGLVVVCGGSKLGRIGFRY 227
            +  +L   I+L  V++YGE EFW+AS KV   + + CF F  + +V G  K  R GFRY
Sbjct: 175 VVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTF--VTMVGGNPKRDRYGFRY 232

Query: 228 -----WKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
                +K   P    I S       F G+++ LI+A+FT  G + V + AGETK PR+ +
Sbjct: 233 IGEAPFKQYSPTMEPISSS---AGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVL 289

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTKV 340
           P A   VF R+ + ++G  L +G++   +DP L    + S   A +SP+V+A+N  G K+
Sbjct: 290 PVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKI 349

Query: 341 LPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMF 400
           LPDI+N  ++    SAGN+  Y  SR LYGL   G APA   R    GVP  AV  + M+
Sbjct: 350 LPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMW 409

Query: 401 GALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAK 460
             L  L ++S S  V +WL+S+   S    + ++ V ++ F +    +  +  +L FK+ 
Sbjct: 410 SVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSW 469

Query: 461 FMPYGAYYAAFFVIVIILVQGFTAFTPFSAV----DFVAYYISAFIFVVIWLLFQFLFK 515
           + PY AY     V++I++VQG+T F  +SA+    DF+  Y+  FI + I+L ++++++
Sbjct: 470 WQPYTAYVGLTCVLLIVVVQGYTVF--YSALWNVKDFLFCYLMVFIDIAIYLGYRYIWR 526

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  255 bits (652), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/495 (30%), Positives = 263/495 (53%), Gaps = 28/495 (5%)

Query: 7   EPKGDGSSSSTITAKP----------GAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPR 56
           EP+  GS   T   KP           + K ++ +   SE+ES      ++++++ +K R
Sbjct: 43  EPEQQGSPQKT-DRKPKLRNEFRKFFDSFKRQLPSDQNSELES----QEKNNLRKSIKSR 97

Query: 57  HVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVT 115
           H+ M                  +  AGP G +L Y   + M YC+ Q+ GE+   +  +T
Sbjct: 98  HLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLT 157

Query: 116 SSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWV 175
            ++T ++S  V P+LG A   +Y + W     L++      + YW++ V    ++A+ ++
Sbjct: 158 GNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN-VNADIFVAVVFI 216

Query: 176 LLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-IGFRYWKDPGPW 234
            +  INL   + Y E EF     K++ +  F+   +V+ CGG+   R IG  YW +PGP+
Sbjct: 217 FVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYIGTEYWHNPGPF 276

Query: 235 GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRIL 294
             G          F G  +    AAF++ G E++ ++A E +NP  ++P A   V +RIL
Sbjct: 277 AHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNACKKVVYRIL 326

Query: 295 LFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTII 354
           L Y+ + ++IG LV Y+  +L+  GS++ ++ASPFV+A+++ G KV+P  +N VI++++I
Sbjct: 327 LIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFINAVILISVI 386

Query: 355 SAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGS 414
           S  NS++Y G R+L  L   G+ P  ++     G P +  L +  FG +G++  S+    
Sbjct: 387 SVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFVATSNAEEQ 446

Query: 415 VFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVI 474
           VF WLL+I+++S  F W+ + +SHIRF   + K+G S D++ +KA+   +G++ A    +
Sbjct: 447 VFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWIAVLIAV 506

Query: 475 VIILVQGFTAFTPFS 489
             ++ Q + A  P S
Sbjct: 507 FFLVCQFWVAIAPVS 521

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  254 bits (649), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/486 (31%), Positives = 250/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + S++KR LKPRH+ M                  I   GP+G +L +    +        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHG 133

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  + +RF+ P++      +Y L W     LEI      + YW+ ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-I 223
               W+AIF+ ++ +INL   + +GE EF  +++K I +  F+   +V++CGG      I
Sbjct: 194 DPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFI 253

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G +YW DPG    G          F G +S L+ A+++  G E+  + +GET +P+  +P
Sbjct: 254 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DPK-GLP 301

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI  VF+RI+ F++ SL ++G LV Y +  L+   S  N   SPFV+AI     KVLP 
Sbjct: 302 SAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDN---SPFVIAIKLHHIKVLPS 358

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+++++S GNS I+  SR L  +   GL P +       G P V ++A S+FG L
Sbjct: 359 IVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLL 418

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  S     VF+WL++I  ++    WL I++SH+RF   +K +G S D+L F +    
Sbjct: 419 AFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGI 478

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+A    +I++ Q + +  P          A  F   Y+ A I V I+++ +  ++
Sbjct: 479 WGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYYR 538

Query: 516 ---GRW 518
              G+W
Sbjct: 539 CQMGKW 544

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 163/483 (33%), Positives = 263/483 (54%), Gaps = 21/483 (4%)

Query: 50  KRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA 109
           K+ L  RH+TM                  +  +GP   L+ ++ V T  +CV QS  E++
Sbjct: 91  KKSLHQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPASLLIGFLIVGTSMFCVVQSAAELS 149

Query: 110 TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAW 169
              PV+ S+    SRF+  +LG      Y L+W I+F  E+  I   I YW+D++    W
Sbjct: 150 CQYPVSGSYATHVSRFLDESLGFTVSTNYALAWLISFPSELIGISMTISYWNDSINPCVW 209

Query: 170 MAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGG--SKLGRIGFRY 227
           +AIF+V +  +NL  VK + E EFW++ +KVIAI+ F+  G+V++CGG     G IG +Y
Sbjct: 210 IAIFYVFIMILNLFGVKGFAETEFWLSLIKVIAIIIFIIVGIVLICGGGPESSGYIGTKY 269

Query: 228 WKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAIN 287
           W DPG +   +         F G  ++ + AAF+F G+ELV +TA E+KN    + +A  
Sbjct: 270 WHDPGSFAPPV---------FKGLCNTFVSAAFSFGGSELVLLTAAESKNI-SAISRAAK 319

Query: 288 TVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGT--KVLPDIM 345
             F+RI +FYI ++++IG LV Y+D +L+   S  + +ASPFV+A+ ++    + L + M
Sbjct: 320 GTFWRIAVFYIATVVIIGCLVPYNDRRLLGGASDEDVSASPFVLALGSSTDLGRKLSNFM 379

Query: 346 NGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGY 405
           N VI++ ++S  NS +Y  SRV+  LG SG  P+        G P V +    +FG LG+
Sbjct: 380 NFVILIAVVSVANSCVYASSRVIQALGSSGQLPSICGYIDKSGRPLVGIAICGVFGLLGF 439

Query: 406 LNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYG 465
           L  SS   +VF WL ++ ++S FFTW  I  S +RF   LKK+  S DD+ FK+    YG
Sbjct: 440 LVASSNERTVFTWLFALCSISSFFTWFCICFSQVRFRLALKKQNRSTDDIAFKSMLGIYG 499

Query: 466 AYYAAFFVIVIILVQGFTAFTPF----SAVDFVAYYISAFIFVVIWLLFQFLFKG--RWF 519
               +   I++I+ + + + +P     SA  F    +S  + +++++  +F  K    W+
Sbjct: 500 GILGSILNILLIMGEIYVSASPLGEPSSAEAFFENCLSIPLMLLVFIAHRFYRKNWRDWY 559

Query: 520 HTV 522
            ++
Sbjct: 560 KSL 562

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  256 bits (654), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/497 (31%), Positives = 257/497 (51%), Gaps = 15/497 (3%)

Query: 25  IKAEVLNHNTSEVES--LCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNA 82
           I+ + L++ T  V+S  + ++   + +K+ +KPRHV M                +P+  A
Sbjct: 124 IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQA 183

Query: 83  GPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLS 141
           GP   ++ Y  + T  YC+ Q+ GE+A  +  V  SF  F S  V P    A  ++Y + 
Sbjct: 184 GPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQ 243

Query: 142 WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVI 201
           W     LE+      I YW+  V    ++ IF+VL+  IN    K Y E EF+    KV+
Sbjct: 244 WLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVM 303

Query: 202 AILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAF 260
            ++ F    + +  G +   G IG +YW DPG +       +    +F G + + + AAF
Sbjct: 304 MMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAF 358

Query: 261 TFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGS 320
            F  TE + +TA E  NPR+ +P A   V +RILL ++ S+++IG LV Y+  QL+   S
Sbjct: 359 AFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMG-SS 417

Query: 321 TTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAF 380
           +   +ASP+V+A +  G  V+   +N VI+++++S  NS  Y  SR+L GL + G AP +
Sbjct: 418 SGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKW 477

Query: 381 ISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIR 440
                  G P  ++L  ++   + +   S K   VF WLL+I+ +S  FTW  I VSHIR
Sbjct: 478 FDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIR 537

Query: 441 FMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFS-----AVDFVA 495
           F + ++ +G S  +L F+A+    G+YYAA  + + ++ Q + A  P +     A +F  
Sbjct: 538 FRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQ 597

Query: 496 YYISAFIFVVIWLLFQF 512
            Y++  I + +++ F+ 
Sbjct: 598 NYLAMPILLALYVGFKL 614

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  256 bits (654), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/501 (30%), Positives = 258/501 (51%), Gaps = 14/501 (2%)

Query: 21  KPGAIKAE---VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXAS 77
            P   K E    LN +  +  +          K  +K RHV M               A 
Sbjct: 123 DPNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAK 182

Query: 78  PIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGY 136
            +  +GP G ++ Y  V+ + Y V Q+ GEMA   P +   F  + S F+S   G A  +
Sbjct: 183 SLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVW 242

Query: 137 LYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIA 196
           ++ L+W     LE+      + YW+ ++    ++ IF++ L  ++ I ++ Y E EF+  
Sbjct: 243 IFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFN 302

Query: 197 SLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSL 255
           S K++ I  F+ + +VV CGG+   G IG +YW DPGP+     + +   A+F      L
Sbjct: 303 SCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVL 357

Query: 256 IKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQL 315
           I A F++ GTEL  ++  E +NPR+ VP A  T  +R+ + Y+ ++++IG  V Y+ P L
Sbjct: 358 INAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDL 417

Query: 316 IQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSG 375
           +  G+  + +ASP+V+A    G K++P  +N VI++++IS  NS ++ G R+L  L   G
Sbjct: 418 M--GNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQG 475

Query: 376 LAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLIS 435
            AP F++     G P +A+   S+FG + +   S K   VF WL +I  +S  F W  I 
Sbjct: 476 FAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGIL 535

Query: 436 VSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFT-PFSAVDFV 494
           +SHIRF   +K  G S D++ +KA    +G+YY  FF +++++ Q + A + P S     
Sbjct: 536 LSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVT 595

Query: 495 AY-YISAFIFVVIWLLFQFLF 514
           A  +  +++  VIW+ F   +
Sbjct: 596 AISFFESYLAFVIWVFFYLCY 616

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  253 bits (647), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/513 (30%), Positives = 269/513 (52%), Gaps = 17/513 (3%)

Query: 8   PKGDGSSSSTITAK--PGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXX 65
           P G G+S   +       +I+ + L   + +V  + EKP+   ++R LK RH+ +     
Sbjct: 18  PIGQGASDMKVKENFVTESIQEDDLERGSIDV-LIDEKPSH-QMQRGLKSRHMQLIALGC 75

Query: 66  XXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPV--TSSFTVFAS 123
                        +   GP   L++YI ++   + +   L EM    P+   +S    A 
Sbjct: 76  AIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALAR 135

Query: 124 RFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLI 183
            +++  L    G+  + +  +    EI+    LI YW+DA     +++IF V+  A+  +
Sbjct: 136 AYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDANS-AIFVSIFIVITIAVTAL 194

Query: 184 PVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGG--SKLGRIGFRYWKDPGPWGVGIVSQ 241
           PVK +GE EFW++ +K+I I   +  G+V+  GG  ++   +GF YWK PG +   I + 
Sbjct: 195 PVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHISTG 254

Query: 242 EIHTAQFLGWVSSLIKAAFTF-QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGS 300
             +T +FL   +++IK+ F F    E +   + E   PRR +P+A N   +R++LFYIG 
Sbjct: 255 --NTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGG 312

Query: 301 LLVIGLLVRYDDPQLIQD--GSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN 358
            LV+G+ V YD+  L+       +NA ASPFV+ I   G KVLP I+N  I+    SAG 
Sbjct: 313 ALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGT 372

Query: 359 SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW 418
           + +Y  SR+L+ +   G AP   +R    GVPY +++  S F  L YLN S+ +  VF W
Sbjct: 373 AEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTW 432

Query: 419 LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL 478
           L +I+ +SGF +W+ +S++++RF + +    ++ D + F+  F    AY++  F +++ L
Sbjct: 433 LTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFVILSL 491

Query: 479 VQGFTAFTP--FSAVDFVAYYISAFIFVVIWLL 509
             G+  FT   +S  DF A YI+    VV++++
Sbjct: 492 TNGYAVFTKGNWSVSDFFANYITIGFVVVLFIM 524

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  253 bits (647), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/483 (30%), Positives = 254/483 (52%), Gaps = 23/483 (4%)

Query: 36  EVESLC----EKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAY 91
           +V+ +C    E    + +K+ +K RH+ M                S +  AGP G +L Y
Sbjct: 48  DVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGY 107

Query: 92  IFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEI 150
           +  + M Y + ++ GE+   +  +T ++T ++S  V PA+G +  ++Y + W   F L++
Sbjct: 108 VVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQL 167

Query: 151 SVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYG 210
                +I YW+D  P   ++AI + ++  INL   K Y E EF+    KV+ I+ F+  G
Sbjct: 168 VTAAMIIQYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILG 226

Query: 211 LVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVG 269
           +V+ CGG+   G IG +YW +P P+  G          F G       AAF + G E++ 
Sbjct: 227 VVINCGGAGTSGYIGDKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMV 276

Query: 270 VTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPF 329
           ++A E +NPR+++  A   V +RI+L Y+ + +++  LV  D P L  +GS     ASP 
Sbjct: 277 LSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS----RASPL 332

Query: 330 VVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGV 389
           V+A++  G K++P I+N VI++ ++S GNS++Y   R+L  L   G AP   +    +G 
Sbjct: 333 VIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGR 392

Query: 390 PYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRG 449
           P  A     +FG L +L  S     VF WLL+I+ +S  F W+ I +SHIRF   +K +G
Sbjct: 393 PLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQG 452

Query: 450 ISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFS--AVDFVAYYISAFIFVVIW 507
            S  ++ +KA+   +G++ A     +I++ Q + A +P     VD  +++ S   F ++ 
Sbjct: 453 RSMGEVGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILL 512

Query: 508 LLF 510
           L +
Sbjct: 513 LAY 515

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  251 bits (642), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 145/464 (31%), Positives = 242/464 (52%), Gaps = 14/464 (3%)

Query: 36  EVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVA 95
           +   + E    + VKR LK RH+++                + ++  GP+  LL ++ + 
Sbjct: 19  DDRDVSEFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIG 78

Query: 96  TMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGR 155
            +A+ V +S+GEM T  P    FT  A RF S AL A  GY Y + +    A E + +  
Sbjct: 79  IIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSS 138

Query: 156 LILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVC 215
           ++ +W   VP+ A+  IFW++     LI V  +GE E+W++ LK++ ++ +  + ++ + 
Sbjct: 139 ILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMS 198

Query: 216 GGSKLG-RIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGE 274
           GG +     GF YWKDPG    G          F G     +  +  + GTE V +TA E
Sbjct: 199 GGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATE 248

Query: 275 TKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAIN 334
           +KNP ++VP A+    +RI++ YIG  +  G  V ++DP L      T    SP  +AI+
Sbjct: 249 SKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL---SVNTKVLKSPIAIAIS 305

Query: 335 AAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAV 394
            AG      ++N  I+ + ISA N ++Y+GSR L  L   GLAP F++ T  RGVP  A+
Sbjct: 306 RAGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAI 365

Query: 395 LATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDD 454
              +  G +  +N+S  + + + ++++++ V  F  W +IS +H+R  +    +G   ++
Sbjct: 366 TIFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEE 425

Query: 455 LPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYI 498
           LP+KA F P+   ++    I + L+QG+T+  PF A +FV  YI
Sbjct: 426 LPYKALFYPWTPIFSLISNIFLALIQGWTSLVPFKAPEFVDAYI 469

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  254 bits (648), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 143/464 (30%), Positives = 247/464 (53%), Gaps = 8/464 (1%)

Query: 26  KAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPV 85
           +++ L  N    +      + + +K+ +K RHV M               A  ++ AGP 
Sbjct: 63  ESQCLEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPG 122

Query: 86  GSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
             ++ Y+ V+ + Y + Q+ GEM   +  +  +F  + S F+S + G A  +L+ + W  
Sbjct: 123 SLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLT 182

Query: 145 TFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
              LE+      I YW+D++    ++ IF+V L  I+   VK YGE EF   S K++ + 
Sbjct: 183 VLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVA 242

Query: 205 CFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
            F+   +V+ CGG+ + G IG +YW+DPG +  G      +  +F G    L+ A F+F 
Sbjct: 243 GFIILSVVINCGGAGVDGYIGGKYWRDPGSFADGS-----NATRFKGICFILVTAYFSFG 297

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323
           G EL  ++  E  N R++ P A     +RIL+ Y+ ++++IG  V +++ QL+  GS   
Sbjct: 298 GIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAA- 356

Query: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383
            +ASP+V+A +    +V+P I+N VI++++IS  NS +Y   R++  L + G AP F++ 
Sbjct: 357 THASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNY 416

Query: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443
               G P  A+   ++ G +G++  S +    F WL +I  +S  FTW  I +SHIRF +
Sbjct: 417 IDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRK 476

Query: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
            +K +G S  +L +KA    +G+YY  FF I++ + Q + A +P
Sbjct: 477 AMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSP 520

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  253 bits (645), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 151/486 (31%), Positives = 248/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + S++KR LK RH+ M                  +   GP+  ++ +    +        
Sbjct: 59  DTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHG 118

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  +++RF+ P++      +Y + W     LEI      I YW+ ++
Sbjct: 119 LGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSI 178

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-I 223
               W+AIF+ ++ +INL   + +GE EF  +++K I I  F+   +V++CGG      I
Sbjct: 179 DPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFI 238

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G +YW DPG    G          F G +S L+ A+++  GTE+  + +GET +P+  +P
Sbjct: 239 GAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGET-DPKE-LP 286

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI  VF+RIL F++ SL ++G LV Y +  L+   S  N   SPFV+AI     K LP 
Sbjct: 287 SAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDN---SPFVIAIKLHHIKALPS 343

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+++I+S GNS I+  SR L  +   GL P F       G P   ++  S+FG L
Sbjct: 344 IVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLL 403

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  SS    VFDWL++I  ++    WL I++SHIRF   +K +  + D+L F +    
Sbjct: 404 AFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGI 463

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+A   ++I++ Q + +  P          A  F   Y+ A I ++I+ + +  ++
Sbjct: 464 WGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYR 523

Query: 516 ---GRW 518
              G+W
Sbjct: 524 VSFGKW 529

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  253 bits (645), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 141/467 (30%), Positives = 249/467 (53%), Gaps = 9/467 (1%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           ++ EV N +  E +      + + +K+ +K RHV +               AS +   GP
Sbjct: 48  VEGEVRNSSDLE-DGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGP 106

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWC 143
            G L+ Y FV+ ++Y + Q+ GEMA   P +  +F  ++S F+S   G A  +L+ + W 
Sbjct: 107 GGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWT 166

Query: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203
               LE+     ++ YW+  +    ++ IF++ +  I+    + YGE EF   S KV+ +
Sbjct: 167 TILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMV 226

Query: 204 LCFLFYGLVVVCGG-SKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTF 262
             F+  G+++ CG     G IG +YW +PG +  G         +F G    L+ A F++
Sbjct: 227 AGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAGS-----GIDRFKGIAYVLVTAYFSY 281

Query: 263 QGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTT 322
            G EL  ++  E  NPR+ +P A     +RIL+ Y+ ++++IG LV +D  +L+  GS+ 
Sbjct: 282 GGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSS- 340

Query: 323 NANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFIS 382
             + SP+V+A++  G K++P I+N VI++++IS GNS +Y G R+L  L + G AP  + 
Sbjct: 341 GVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILD 400

Query: 383 RTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFM 442
               +G P +A++  S+FG + ++  S     +F WL +I+ +S  FTW  I +SH RF 
Sbjct: 401 YVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFR 460

Query: 443 QCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFS 489
           + +K +G S + L +++    +G+ YA  F + +++ Q + A  P  
Sbjct: 461 RAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMD 507

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  252 bits (643), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 144/464 (31%), Positives = 254/464 (54%), Gaps = 10/464 (2%)

Query: 25  IKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGP 84
           + AE +     +  SL E+      +R+L PR V+M                + I + GP
Sbjct: 25  VGAETIRSLEGQAPSLEER----IARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGP 80

Query: 85  VGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCI 144
              L+A+   + +   ++Q +  M T++PVT SF  F  RFV  + G + G+ Y++    
Sbjct: 81  GSLLIAFCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAA 140

Query: 145 TFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAIL 204
               EI+ +  ++ +W+D +P  A ++I   L  ++NL  V  +GE EF+++  KVI  +
Sbjct: 141 NVCFEITAVCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAI 200

Query: 205 CFLFYGLVVVCGGSKLGRI-GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263
             +F+ +VV+ GG+   ++ GF+ W +PG +   I   +    +F G++S LI A + F 
Sbjct: 201 GLIFFTIVVMAGGNPQHKVLGFKNWSNPGAFAEYI--SKGSAGKFHGFMSCLIFALYVFW 258

Query: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGS--T 321
           G + +G  A E  NPR+ +P +   VF R+++FYIG  + +G+LV ++D  +I+  S   
Sbjct: 259 GVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGA 318

Query: 322 TNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFI 381
             A ASP+V A+   G  VLP I+N +I+ +IISAGNS++Y  SRVL+ L   G AP   
Sbjct: 319 VGAGASPYVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF 378

Query: 382 SRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRF 441
            + T RGVP    +A  +   L YL+VS+ + +V  W L++   +    ++ I +S+++F
Sbjct: 379 -KITKRGVPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQF 437

Query: 442 MQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF 485
            +  K + I    LP+ + F+PY  +++ F++++++ + G+  F
Sbjct: 438 AKGCKAQNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVF 481

>Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar to
           Ashbya gossypii AAR038W
          Length = 559

 Score =  251 bits (642), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 160/523 (30%), Positives = 263/523 (50%), Gaps = 22/523 (4%)

Query: 11  DGSSSSTITAKPGAIKAEVLNHNTSEVES-LCEKPNQ-SDV----KRELKPRHVTMXXXX 64
           + ++  T +AK    K  V N     + S +CE+ ++ SDV    +R+L+ RHV      
Sbjct: 3   EDATEETHSAKESGEKMPVNNGEYRSLRSSMCEECDENSDVYRSTQRKLENRHVQFVGIS 62

Query: 65  XXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASR 124
                         + + GP+  LL +        C+T S  EM +++P+ S F   ASR
Sbjct: 63  GVIGTALFVSIGKALHHGGPISLLLGFTLWCIPILCITVSTAEMVSYLPLNSPFLRLASR 122

Query: 125 FVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP 184
            V+ +L    G+ +W   C+    EI  +  +I YW+D    T  + +   L   I++  
Sbjct: 123 CVNDSLTFTAGWNFWFLECVQIPFEIVAVNVVIHYWTDDYSATIPLCVQVALYFLISVFA 182

Query: 185 VKFYGEFEFWIASLKVI-AILCFLFYGLVVVCGGSKLGRIGFRYWKD-------PGPWGV 236
           V++YGE EFW+AS K+I A+  F F  + +V G  K  R GF++ ++       PG    
Sbjct: 183 VRYYGEIEFWLASFKIILAVGLFAFTFVTMVGGNPKRERYGFKHIRELPFKTYFPG---- 238

Query: 237 GIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLF 296
           G   Q      F G+++ LI+A+FT  G + V + AGETK PR+ +P A   VF R+   
Sbjct: 239 GDSDQGSALGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPIAFKQVFVRLTFL 298

Query: 297 YIGSLLVIGLLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTII 354
           ++G  L +G++   +DPQL    + S   A +SP+V+A+N  G ++LPDI+N  ++    
Sbjct: 299 FLGGCLCVGIVCGANDPQLTAAINDSRPGAASSPYVIAMNHLGIRILPDIVNAALITAAF 358

Query: 355 SAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGS 414
           SAGN+  Y  SR LYGL   G AP    R    GVP  AV  +  +  L  L ++  S  
Sbjct: 359 SAGNAYTYCSSRSLYGLALDGYAPPIFKRCNRYGVPIYAVGVSLFWAVLSLLQLNENSSI 418

Query: 415 VFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVI 474
           V +WL+++   S    + ++ + ++ F +    +  +   LPFK+ + PY A      V 
Sbjct: 419 VLNWLINLITASQLINFGILCIIYLYFRRAYIAQQDNLPALPFKSWWQPYTAICGLVSVT 478

Query: 475 VIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFK 515
           ++++VQG+T F  + ++  DF+  Y   F  + I+L   F++K
Sbjct: 479 IMVIVQGYTVFYSSLWNVQDFLFCYFMVFANIAIYLACYFVWK 521

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  251 bits (642), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 159/521 (30%), Positives = 259/521 (49%), Gaps = 24/521 (4%)

Query: 3   NIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXX 62
           N+    KGD  S S +  K   I  E    + S+ +     PN + VKR LK RH+++  
Sbjct: 12  NVEKTDKGDAKSPSALIIKAVDISEE---PDVSKFD-----PN-TGVKRALKNRHISLLA 62

Query: 63  XXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFA 122
                         + +   GP+  LL +  +  +A+ V +S+GE+ T  P    FT  A
Sbjct: 63  LGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEIITLYPSGGGFTTLA 122

Query: 123 SRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINL 182
            RF   AL A  GY Y + +    A E + +  ++ +W   VP+  ++ IFW       L
Sbjct: 123 RRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQL 182

Query: 183 IPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVGIVSQ 241
           I V  +GE E+W++  K++ ++ +  + ++ + GG K     GF YW  PG    G    
Sbjct: 183 IGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHYWNSPGSLSHG---- 238

Query: 242 EIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSL 301
                 F G     +  +  + GTE V + A E+KNP + VP A+    +R+L+ YIG  
Sbjct: 239 ------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVRQTLWRVLIVYIGIA 292

Query: 302 LVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNI 361
           +  G  V +DDP L    +TT    SP  +AI+ AG      ++N  I+VT ISA N ++
Sbjct: 293 VFYGATVPFDDPNL---SATTKVLKSPISIAISRAGWAGGAHLVNAFILVTCISAINGSL 349

Query: 362 YVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLS 421
           Y+GSR L  L   GLAP  ++ T  RGVP  A+   +  G +  +NVS  +   + ++++
Sbjct: 350 YIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGASDAYSYIVN 409

Query: 422 ITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQG 481
           ++ V  F  W +IS +H+R  +    +G S ++LP+KA   P+   ++    + + L+QG
Sbjct: 410 LSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIANVFLALIQG 469

Query: 482 FTAFTPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTV 522
           +T+F PF A +FV  YI   + +V+++    +FK   F  V
Sbjct: 470 WTSFVPFDAGNFVDAYILLPVAIVLYVAIC-VFKNHHFRIV 509

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  252 bits (643), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 149/494 (30%), Positives = 246/494 (49%), Gaps = 9/494 (1%)

Query: 21  KPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIR 80
           K   +  +V      E  +      Q  +K  +K RH+TM                  + 
Sbjct: 43  KRADVVEDVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALH 102

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYW 139
             GP G L+ Y+  +TM YCV Q+  E+   +  +  ++  + +  V    G A   +Y 
Sbjct: 103 YGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYG 162

Query: 140 LSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLK 199
           L W I   LE+      I YW+++V    ++AIF++ +  I+    + Y E EF   +LK
Sbjct: 163 LQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLK 222

Query: 200 VIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAA 259
           V+ +  F+  G+ + CG SKLG IG +YW +PG +     + E       G  S  +++A
Sbjct: 223 VLLMAGFIIMGISLNCGASKLGYIGAKYWSNPGTF-----AGERSINHLKGICSVWVQSA 277

Query: 260 FTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDG 319
           F + G+E + +TA E  NPR +VP A     +R+++ ++  + +I  LV Y   QL+   
Sbjct: 278 FAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSS 337

Query: 320 STTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379
             + ++ASPFV+A    G K++P I+N +I+ ++IS GNS +Y   R+L  L  +GL P 
Sbjct: 338 GASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPK 397

Query: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439
             +     G P   +L   +FG L ++  S    SVF WL +I  +S  FTW  I++SHI
Sbjct: 398 IFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHI 457

Query: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFS---AVDFVAY 496
           RF   +K +G S  +L + +     G+YYA FF IV+++ Q + A  P      +D  ++
Sbjct: 458 RFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESF 517

Query: 497 YISAFIFVVIWLLF 510
           + +   F V+ L +
Sbjct: 518 FKNYLAFAVLVLFY 531

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  253 bits (645), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 153/499 (30%), Positives = 262/499 (52%), Gaps = 22/499 (4%)

Query: 23  GAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNA 82
           G  + + L+   S+ +S+      + +K+ +K RHV M               A  +   
Sbjct: 92  GGFEEDSLDLEGSDHDSII---TNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFG 148

Query: 83  GPVGSLLAYIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLS 141
           GP   ++ Y+ V+ + Y + Q+ GEMA   P +  +F  ++S FVS A G A  +++ + 
Sbjct: 149 GPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQ 208

Query: 142 WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP-VKFYGEFEFWIASLKV 200
           W     LE+      I YW+D +    ++ IF+V L  I+L   V  YGE EF     K+
Sbjct: 209 WLTVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKI 268

Query: 201 IAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAA 259
           + ++ F+   +V+  GG+     IG ++W DPG +     + +   ++F G    L+   
Sbjct: 269 LMVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAF-----AGKTAGSRFKGICYVLVSGY 323

Query: 260 FTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDG 319
           F++ GTEL  ++  E  NPRR+ P+A  +  +RIL+ Y+ ++++IG  V YD  +L+  G
Sbjct: 324 FSYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSG 383

Query: 320 STTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379
            +   +ASP+V+A +  G K+ P  +N VI++++IS  NS++Y   R++  L + G AP 
Sbjct: 384 GSA-THASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPK 442

Query: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439
           F+     +G P +A++A  + G +G++  S K   VF WL +I  +S  FTW  I +SH+
Sbjct: 443 FLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHV 502

Query: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF------SAVDF 493
           RF   +K +  S ++L +KA    YG+ Y   F +++   Q +TA  PF      +A  F
Sbjct: 503 RFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSF 562

Query: 494 VAYYISAFIFVVIWLLFQF 512
            A Y++    + IWL+F F
Sbjct: 563 FANYLA----MPIWLVFYF 577

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score =  250 bits (639), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 174/497 (35%), Positives = 267/497 (53%), Gaps = 24/497 (4%)

Query: 28  EVLNHNTSEVESLCEKPNQSDVK----RELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           +V   ++S+V+   E      V+    R L PRH+ M                  +   G
Sbjct: 15  KVARTSSSDVQYDSEGQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGG 74

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143
           P   ++ Y  +  + Y     LGEM+TF+P++ SF  +A +F S +L       YW +  
Sbjct: 75  PASLVINYSIIGLVVYLTMLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDA 134

Query: 144 ITFALEISVIGRLILYW--SDA-VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV 200
           ++ A +++ +  ++ +W  SDA  P  A   IFW +L  +N++ V+ YGE E+W+A LKV
Sbjct: 135 VSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVRVYGEAEYWLAMLKV 194

Query: 201 IAILCFLFYGLVVVCGGSK-LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAA 259
           IAI+ F    +VV  G ++    IGF+ W          V +      F G+ S  + ++
Sbjct: 195 IAIIIFFIISIVVNAGHNQDHSYIGFKNWS---------VGEAPFVNGFKGFASLFVSSS 245

Query: 260 FTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDG 319
           F + GTE + +TAGE KNP R  PK I TVF+RIL+FY+ +   IG+ V Y+ P+L +  
Sbjct: 246 FAYGGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKLSEKS 305

Query: 320 STTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSG-LAP 378
             T    SPF +     GTK     MN VI+ ++ISAGN  ++ GSRVL+ LG  G   P
Sbjct: 306 VMT----SPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFP 361

Query: 379 AFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSH 438
           + I++T    +PYVAVL T   G L + +    +G+++ WL +I  VS    WL IS+  
Sbjct: 362 SIITKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVS 421

Query: 439 IRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSAVDFVAYYI 498
           IRF + L K+G +  +L F     PYG Y+   FV  IILVQG+++F P++  DF +YYI
Sbjct: 422 IRFRRGLAKQGKTH-ELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAPWNVTDFFSYYI 480

Query: 499 SAFIFVVIWLLFQFLFK 515
              +FV ++ +F +L+K
Sbjct: 481 ELIVFVALY-VFWWLWK 496

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  252 bits (644), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/471 (31%), Positives = 246/471 (52%), Gaps = 14/471 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
            + ++KR++  RH+                 AS + +AGP G L+ Y  + T  YCV Q+
Sbjct: 113 KKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQA 172

Query: 105 LGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163
            GE+  T+  +   F  + +  V+P+   + G++Y L W     LE+      I YW+  
Sbjct: 173 AGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTK 232

Query: 164 VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGR 222
           V    ++ IF++L+  IN    K Y E +F+   +K+  I  F   G+VV CGG+   G 
Sbjct: 233 VDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGY 292

Query: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           +G +YW +PG +       E     F G  S  + +AF F G+E V ++A E  NPR+++
Sbjct: 293 LGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSI 347

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLP 342
           P A   + +RI+  Y+ S+ ++G LV +D PQL    S+     SP+VVAI   G KV+P
Sbjct: 348 PSAAKLILYRIIWVYLTSITILGFLVPWDSPQL--QPSSDGKKTSPYVVAIAMHGVKVVP 405

Query: 343 DIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGA 402
            ++N VI++ ++S  NS  +  SR+L  L + G AP +      +G P  A+L +++FG 
Sbjct: 406 HLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGV 465

Query: 403 LGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFM 462
           + +   S K   VF WLL+I+ +S  FT+  I VSHIR    +K +G S  +L F+++  
Sbjct: 466 ICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVG 525

Query: 463 PYGAYYAAFFVIVIILVQGFTAFTP-----FSAVDFVAYYISAFIFVVIWL 508
            YG++YA   +++ ++ + + A  P       A  F   Y++A I +V + 
Sbjct: 526 TYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYF 576

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  251 bits (640), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 148/486 (30%), Positives = 250/486 (51%), Gaps = 27/486 (5%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           +  ++KR LK RH+ M                  +   GP+  L+ +    T        
Sbjct: 64  DPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHG 123

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  +++RF+ P++      +Y L W     LEI      + +W+ +V
Sbjct: 124 LGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSV 183

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-I 223
               W+A+F+ L+ +INL  V+++G+ +F  + +K++ I  F+   LV++ GG      I
Sbjct: 184 DPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFI 243

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G RYW DPG    G          F G  + ++ A+++  G+E+  + +GET +P+  +P
Sbjct: 244 GARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DPKE-IP 291

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI  +F+RI+ F++ SL ++G LV Y + QL+     +N N SPFV+AI     +VLP 
Sbjct: 292 HAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLL---GGSNVNNSPFVIAIKMHNIRVLPH 348

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+NGVI+V+I+S GNS I+  SR L  +   GL P         G P   +L  S+FG L
Sbjct: 349 IINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLL 408

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  SS +G+VF WL+++  ++    WL I+VSHIRF   +K +G S D+L F +    
Sbjct: 409 AFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGM 468

Query: 464 YGAYYAAFFVIVIILVQGFTAFTPFSA--------VDFVAYYISAFIFVVIWLLFQFLFK 515
           +G+ Y+    +V+++ Q + +  P             F   Y+ A I + +++  +  ++
Sbjct: 469 WGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYR 528

Query: 516 ---GRW 518
              G+W
Sbjct: 529 STTGQW 534

>NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.397
           YBR132C
          Length = 584

 Score =  251 bits (640), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 149/478 (31%), Positives = 246/478 (51%), Gaps = 17/478 (3%)

Query: 50  KRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMA 109
           KR L  RHV +                 P+   GP   LLA+        C+T S  EM 
Sbjct: 74  KRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLLLAFAIWCIPILCITVSTAEMV 133

Query: 110 TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAW 169
            F+PV+S F   A++ V  +L     + +W   C+    EI  +  +I YW D       
Sbjct: 134 CFMPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPYEIVTVNTIIHYWRDDYSAAIP 193

Query: 170 MAIFWVLLTAINLIPVKFYGEFEFWIASLKVI---AILCFLFYGLVVVCGGSKLGRIGFR 226
           + I  +L   I+L  VK+YGE EFW+AS K++    + CF F  + ++ G  K  R GFR
Sbjct: 194 LVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLFCFTF--ITMLGGNPKKDRFGFR 251

Query: 227 YWKDPG-----PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRT 281
           Y+ D       P G+   S       F G+   LI+A+FT  G E + + AGE + PRR 
Sbjct: 252 YFHDTPFKKYFPDGIDRGSS---AGYFQGFFICLIQASFTIAGGEYISMLAGEIEIPRRV 308

Query: 282 VPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTK 339
           +P+A   VF R+ + ++GS L +G+L   +D  L    + +   A +SP+V+A+N  G +
Sbjct: 309 LPRAFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARPGAGSSPYVIAMNNLGIR 368

Query: 340 VLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSM 399
           +LPDI+N  ++    S+GN+  Y  SR LYG+   G AP   +R   +GVP  AV  + +
Sbjct: 369 ILPDIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFTRCNKQGVPIYAVGVSLL 428

Query: 400 FGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKA 459
           +  +  L ++S S  V +WL++I   S    + ++ ++++ F +    +     +LPFK+
Sbjct: 429 WAFISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFRRAYLLQKDKLPELPFKS 488

Query: 460 KFMPYGAYYAAFFVIVIILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWLLFQFLFK 515
            + PY A +     +V+++VQG+T F P  ++  DF+  Y+  FI + I++ ++F+++
Sbjct: 489 WWQPYTAIFGLVCAMVMMIVQGYTVFFPKNWNVQDFLFCYLMIFINIGIYIFYKFIWR 546

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  251 bits (640), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 164/542 (30%), Positives = 271/542 (50%), Gaps = 42/542 (7%)

Query: 2   TNIIYEPKGDGSSSSTITAKPGAIKAEVLNHNTSE-----VESLCE--KP------NQSD 48
           T    + K +  S +  T + G  K  +LN +T E     V+ + +  KP      + S+
Sbjct: 20  TETCSDSKLNTKSHNEYTYESG--KCSLLNGSTEERKRNVVQRVIDSFKPPVDGSFDPSN 77

Query: 49  VKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108
           +KR LK RH+ M                  +   GP+  ++ +    T        LGE+
Sbjct: 78  MKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGEL 137

Query: 109 ATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITA 168
              +PV  +F  +++RF+ P++      +Y + W     LEI      + +W+ +V    
Sbjct: 138 TVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPII 197

Query: 169 WMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-IGFRY 227
           W+A+F+ ++ +INL+ V+ +GE EF  +S+KVI I  F+   +V++ GG    + +G RY
Sbjct: 198 WVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRY 257

Query: 228 WKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAIN 287
           W DPGP   G          F G  + ++ A+++  G+E+  + +GET +P+  +P AI 
Sbjct: 258 WHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DPKE-LPHAIK 305

Query: 288 TVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNG 347
            +F+RIL F++ SL ++G LV Y +  L+   S  N   SPFV+A+     KV+P I+NG
Sbjct: 306 QIFWRILFFFLVSLTLVGFLVPYTNENLLGGSSAEN---SPFVLALYLHHVKVVPHIVNG 362

Query: 348 VIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLN 407
           VI+V+I+S GNS I+  SR L  +   GL P         G P V +LA S+FG L +L 
Sbjct: 363 VILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLV 422

Query: 408 VSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAY 467
             S   +VF WL++I  ++    WL I+VSH+RF   +K +  S D+L F +    +G+ 
Sbjct: 423 KFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSV 482

Query: 468 YAAFFVIVIILVQGFTAFTPFS--------AVDFVAYYISAFIFVVIWLLFQFLFK---G 516
           YA     + ++ Q + A  P          A  F   Y+ A I + ++   +  F+   G
Sbjct: 483 YAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTG 542

Query: 517 RW 518
           +W
Sbjct: 543 KW 544

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  250 bits (638), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 144/469 (30%), Positives = 250/469 (53%), Gaps = 11/469 (2%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           + + +++ ++ RHV M               A+ +   GP G L+ Y+ V+ ++Y +  +
Sbjct: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118

Query: 105 LGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDA 163
            GEMA   P +  +F  ++S F+S   G A  +L+ L W   F LE+     +I YW  +
Sbjct: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVS 178

Query: 164 VPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGG-SKLGR 222
           V    ++ IF++ +  I+    + YGE EF     KV+ I+ F+  G+++  G     G 
Sbjct: 179 VNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGY 238

Query: 223 IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282
           IG RYW++PG +  G    ++    ++     L+ A F+F G EL  ++  E  NP+  +
Sbjct: 239 IGDRYWRNPGSFVSGTPLDKLKGTAYV-----LVTAYFSFGGMELYALSVNELPNPKTAI 293

Query: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLP 342
           P A     +RILL Y+ ++++IG LV +D  +L+  GS  + + SP+V+AI   G KVLP
Sbjct: 294 PSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSN-DVHPSPYVLAIEMHGVKVLP 352

Query: 343 DIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGA 402
            I+N VI++++IS GNS +Y   R+L  L + G AP  +      G P ++++  ++FG 
Sbjct: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412

Query: 403 LGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFM 462
           + +   S     +F WL +I  +S  FTW  I +SH RF Q +K +G S + L ++A   
Sbjct: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472

Query: 463 PYGAYYAAFFVIVIILVQGFTAFTPFS--AVDFVAYYISAFIFVVIWLL 509
            +G+ YA FF +++ + Q + A  P +   VD ++++ +   F  +WL+
Sbjct: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAF-PLWLI 520

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  247 bits (631), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 147/463 (31%), Positives = 231/463 (49%), Gaps = 22/463 (4%)

Query: 15  SSTITAKPGAIKAEVLNHNTSEVESLCEKP------NQSDVKRELKPRHVTMXXXXXXXX 68
           S   T +   ++    N N  +      KP      +  ++K+ LK RH+ M        
Sbjct: 33  SEKTTPENDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIG 92

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                     +   GP+  ++ +    T        LGE+    PV  +F  + +RF+ P
Sbjct: 93  TGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEP 152

Query: 129 ALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFY 188
           ++      +Y L WC    LEI      + YW  +V    W+AIF+ ++  INL+ V+ +
Sbjct: 153 SISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGF 212

Query: 189 GEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQ 247
           GE EF  + +KVI I+ F+   +V++CGG  K   +G +YW DPGP   G          
Sbjct: 213 GEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLANG---------- 262

Query: 248 FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLL 307
           F G    L+ A+++  GTE+  + +GET +P+  +P AI  VF+RI+ F++ SL ++G L
Sbjct: 263 FKGVAGVLVIASYSLGGTEMACLASGET-DPKE-LPSAIKQVFWRIVFFFLVSLTLVGFL 320

Query: 308 VRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRV 367
           V Y +  L+   S  N   SPFV+AI   G   LP I+N VI+V+++S GNS I+  SR 
Sbjct: 321 VPYTNQNLMGGSSVDN---SPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRT 377

Query: 368 LYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSG 427
           L  +   GL P         G P   +L   +FG L +L  S  +G VF WL++I  ++ 
Sbjct: 378 LCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLAT 437

Query: 428 FFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAA 470
              WL I++SHIRF   +K +G+  ++L F +    YG+ Y+A
Sbjct: 438 CVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSA 480

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  247 bits (631), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 147/463 (31%), Positives = 231/463 (49%), Gaps = 22/463 (4%)

Query: 15  SSTITAKPGAIKAEVLNHNTSEVESLCEKP------NQSDVKRELKPRHVTMXXXXXXXX 68
           S   T +   ++    N N  +      KP      +  ++K+ LK RH+ M        
Sbjct: 33  SEKTTPENDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIG 92

Query: 69  XXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSP 128
                     +   GP+  ++ +    T        LGE+    PV  +F  + +RF+ P
Sbjct: 93  TGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEP 152

Query: 129 ALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFY 188
           ++      +Y L WC    LEI      + YW  +V    W+AIF+ ++  INL+ V+ +
Sbjct: 153 SISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGF 212

Query: 189 GEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQ 247
           GE EF  + +KVI I+ F+   +V++CGG  K   +G +YW DPGP   G          
Sbjct: 213 GEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLANG---------- 262

Query: 248 FLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLL 307
           F G    L+ A+++  GTE+  + +GET +P+  +P AI  VF+RI+ F++ SL ++G L
Sbjct: 263 FKGVAGVLVIASYSLGGTEMACLASGET-DPKE-LPSAIKQVFWRIVFFFLVSLTLVGFL 320

Query: 308 VRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRV 367
           V Y +  L+   S  N   SPFV+AI   G   LP I+N VI+V+++S GNS I+  SR 
Sbjct: 321 VPYTNQNLMGGSSVDN---SPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRT 377

Query: 368 LYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSG 427
           L  +   GL P         G P   +L   +FG L +L  S  +G VF WL++I  ++ 
Sbjct: 378 LCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLAT 437

Query: 428 FFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAA 470
              WL I++SHIRF   +K +G+  ++L F +    YG+ Y+A
Sbjct: 438 CVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYSA 480

>NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa]
           {ON} Anc_3.397
          Length = 586

 Score =  249 bits (637), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 151/492 (30%), Positives = 251/492 (51%), Gaps = 10/492 (2%)

Query: 33  NTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYI 92
           N  + +S       +  +R+L  RHV +                 P+   G    LL + 
Sbjct: 57  NDEDNDSRTNLLYSTSTQRKLLNRHVQLIAISGVIGTVLFVAIGKPLYRGGAAFLLLGFA 116

Query: 93  FVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISV 152
                  C+T S  EM  F+PV+S F     + V  +L     + +W   C+    EI  
Sbjct: 117 IWCIPILCITVSTAEMVCFMPVSSPFLRLTKKCVDDSLAMMASWNFWFLECVQIPFEIVT 176

Query: 153 IGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVI-AILCFLFYGL 211
           +  +I YW D       + +  +L   I+   VK+YGE EFW+ASLK+I A+  FLF  +
Sbjct: 177 VNTIIHYWRDDYSPAIPLIVQIILYVLISFCAVKYYGETEFWMASLKIIMAMGLFLFTFI 236

Query: 212 VVVCGGSKLGRIGFRYWKDPGPWGV----GIVSQEIHTAQFLGWVSSLIKAAFTFQGTEL 267
            ++ G  K  R GFRY+ +  P+ +    G VSQ      F G+++ LI+A+F+  G E 
Sbjct: 237 TMLGGNPKRDRFGFRYFGET-PFKMYFPNGDVSQGHSAGYFQGFLTCLIQASFSIAGGEY 295

Query: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ--DGSTTNAN 325
           + + AGE K PR+ +P A   VF R+ + ++GS L +G+L   +DP L    + +   A 
Sbjct: 296 ISMLAGEIKIPRKVLPIAFKQVFIRLTILFLGSCLCVGILCSANDPALTAAINEARPGAG 355

Query: 326 ASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTT 385
           +SP+V+A+N  G ++LPDI+N +++    S+GN+  Y  SR LYG+   G AP   +R  
Sbjct: 356 SSPYVIAMNNMGIQILPDIVNVILITAAFSSGNAYTYCSSRTLYGMAMDGYAPKIFTRCN 415

Query: 386 SRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCL 445
            +GVP  AV  +  +G +  L ++S S  V +WL++I   S    +  I ++++ F +  
Sbjct: 416 KQGVPIYAVGISVAWGFISLLQLNSNSAVVLNWLINIITTSQLINFACICITYLFFRRAY 475

Query: 446 KKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIF 503
             +      LPFK+   PY        VI++I VQG++ F  + ++  DF+  Y+  F+ 
Sbjct: 476 LLQKDDLPHLPFKSWGQPYTVIVGLVSVIIMIFVQGYSVFYKSLWNKQDFLFCYLMVFVD 535

Query: 504 VVIWLLFQFLFK 515
           + I+L+++F++K
Sbjct: 536 LGIYLIYKFIWK 547

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  248 bits (634), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 147/444 (33%), Positives = 229/444 (51%), Gaps = 16/444 (3%)

Query: 45  NQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQS 104
           +   +KR LK RH+ M                  +   GP+  ++ ++   T        
Sbjct: 73  DPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHG 132

Query: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164
           LGE+    PV  +F  + +RF+ P+L      +Y L W     LEI      I +W+ ++
Sbjct: 133 LGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSI 192

Query: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGR-I 223
               W+AIF+V + AINL  V+ +GE EF  +S+KVI I  F+   +V++ GG      +
Sbjct: 193 DPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYV 252

Query: 224 GFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVP 283
           G RYW DPG    G          F G  S  + A+++  G+E+  + +GET +P+  +P
Sbjct: 253 GARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLASGET-DPKE-LP 300

Query: 284 KAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPD 343
            AI  VF+RI+ F++ SL ++G LV Y +  L+   S  N   SPFV+A N    KVLP 
Sbjct: 301 SAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVNN---SPFVIACNLYHIKVLPS 357

Query: 344 IMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGAL 403
           I+N VI+V+I+S GNS I+  SR L  +   GL P         G P V ++  S+FG L
Sbjct: 358 IINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLL 417

Query: 404 GYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMP 463
            +L  SS    VF+WL++I  ++    WL I+VSHIRF   +K +  + D+L F +    
Sbjct: 418 AFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGI 477

Query: 464 YGAYYAAFFVIVIILVQGFTAFTP 487
           +G+ Y+A   ++I++ Q + +  P
Sbjct: 478 WGSVYSAVVNVLILIAQFYISLWP 501

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  249 bits (636), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 151/521 (28%), Positives = 259/521 (49%), Gaps = 18/521 (3%)

Query: 7   EPKGDGSSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXX 66
           +P    +  STI  + G +        +++ +S       ++ +R+L+ RHV +      
Sbjct: 37  DPAESLNHVSTIHEE-GNMHVHEDGETSTDEDSRTNLLFSTETRRKLENRHVQLIAISGV 95

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                       +   GP   LLA+        C+T S  EM  F PV+S F   A++ V
Sbjct: 96  IGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCV 155

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVK 186
             +L     + +W   C+    EI  +  +I YW D       +A+  VL   I++  VK
Sbjct: 156 DESLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVK 215

Query: 187 FYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKD-------PGPWGVGI 238
           +YGE EFW+AS K+I  L    +  V + GG+ K  R GFRY+ +       P    VG 
Sbjct: 216 YYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFRYYGESPFKQYFPDGKDVGK 275

Query: 239 VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI 298
            S       F G+++ LI+A+FT  G E + + AGE K PR+ +PKA   VF R+   ++
Sbjct: 276 SS-----GYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFL 330

Query: 299 GSLLVIGLLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISA 356
           GS L +G++   +DP L    + +   A +SP+V+A+N    ++LPD++N  ++    SA
Sbjct: 331 GSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRILPDVVNIALITAAFSA 390

Query: 357 GNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVF 416
           GN+  Y  SR  YG+   G AP   ++    GVP  AV  + ++  +  L ++S S  V 
Sbjct: 391 GNAYTYCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWALVSLLQLNSNSAVVL 450

Query: 417 DWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVI 476
           +WL+++   S    ++++ + ++ F +    +  S   LPF++   PY A       + +
Sbjct: 451 NWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWGQPYTAIIGLVSCLAM 510

Query: 477 ILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWLLFQFLFK 515
           I++QG+T F P  +++ DF+  Y+  FI + I++ ++F++K
Sbjct: 511 IMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWK 551

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  249 bits (636), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 148/436 (33%), Positives = 239/436 (54%), Gaps = 18/436 (4%)

Query: 81  NAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWL 140
           ++GP   L+ ++ V  M +CV QS  E+A   PV+ S+ V  SRF+ P++G      Y L
Sbjct: 116 SSGPGSLLIGFLIVGLMMFCVVQSAAELACQYPVSGSYAVHVSRFMEPSIGFTVATNYAL 175

Query: 141 SWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKV 200
           +W I+F  E+      + YW+ +V    W+AIF+V + ++N+  V+ YGE EFW++  KV
Sbjct: 176 AWLISFPSELIGCAMTLQYWNKSVNPAVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKV 235

Query: 201 IAILCFLFYGLVVVCGG--SKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKA 258
           +AI+ F+  G+V++CGG  +  G IG +YW DPG +   +         F G  ++ + A
Sbjct: 236 VAIVIFIIIGIVLICGGGPNSTGYIGTKYWHDPGSFAKPV---------FKGLCNTFVSA 286

Query: 259 AFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQD 318
           AF+F G ELV +TA E++    +V +A    F+RI +FYI +++VIG LV Y + QL+  
Sbjct: 287 AFSFGGAELVVLTASESRKV-ESVSRAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLLGG 345

Query: 319 GSTTNANASPFVVAINAAGT--KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGL 376
            +  +  ASPFV+A++  G+        MN VI++ ++S  NS +Y  SR++  LG  G 
Sbjct: 346 DNDEDITASPFVIALSGQGSMGTKASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQ 405

Query: 377 APAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISV 436
            P        +G P V +    +FG LG+L  S   G VF WL ++ ++S FFTW  I  
Sbjct: 406 LPKICGYVDQKGRPLVGIAICGVFGLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICA 465

Query: 437 SHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPF----SAVD 492
           S +RF   L+ +G S D++  K+    YG +       ++I  + + +  P     SA  
Sbjct: 466 SQVRFRFALRAQGRSSDEIAHKSMLGIYGGFLGCLLNALLIAGEIYVSIFPLGGDPSAKQ 525

Query: 493 FVAYYISAFIFVVIWL 508
           F  Y +S  I + +++
Sbjct: 526 FFQYCLSIPIMIAVYI 541

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  249 bits (635), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 130/443 (29%), Positives = 237/443 (53%), Gaps = 13/443 (2%)

Query: 47  SDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLG 106
           + +K+ +K RH+ M                  +  AGP G ++ Y   + M YC+ Q+ G
Sbjct: 68  TKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAG 127

Query: 107 EMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVP 165
           E+   +  +  ++T ++S  V PALG +  ++Y + W     L++      + YW++A P
Sbjct: 128 ELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTNANP 187

Query: 166 ITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIG 224
              ++A+F+V++  IN+   K Y E EF     KV+ I  F+  G+ + CGG+   G IG
Sbjct: 188 -DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIG 246

Query: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284
            +YW  PG +  G          F G       AAF++ G E++ +TA E +NPR+++P 
Sbjct: 247 AKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPN 296

Query: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344
           A   V +RIL+ Y+ + +++  LV Y+  +L+     + ++ASP V+A+ + G K++P I
Sbjct: 297 ACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHI 356

Query: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404
           +N VI++++IS GNS++Y   R+L  L   G AP F++    +G P +    T +   + 
Sbjct: 357 INAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIA 416

Query: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464
           ++  S     +F WLL+I+ +S  F W  I +SH+RF   +  +G+S   + +K++   +
Sbjct: 417 FVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYW 476

Query: 465 GAYYAAFFVIVIILVQGFTAFTP 487
           G+++A    +++++ Q + A  P
Sbjct: 477 GSWFAIVISVLVLIAQFWVAIAP 499

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  249 bits (635), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 160/534 (29%), Positives = 279/534 (52%), Gaps = 28/534 (5%)

Query: 2   TNIIYEPKGDGSS------SSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKP 55
           T+++  P  +G++      +S       AI+  +L    SE E +         K+ L  
Sbjct: 16  TSVLSTPSNEGNNLIHRFKNSFKRNDSPAIQEGLLYSELSEEEKIQWDLANQPYKKVLDQ 75

Query: 56  RHVTMXXXXXXXXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVT 115
           RH+TM                  +  +GP   L+ ++ V     CV Q   E++   PV+
Sbjct: 76  RHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQYPVS 134

Query: 116 SSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWV 175
            S+ + ASRF+ P++G + G  Y L W I++  E+      I YW+ +V   AW+AI +V
Sbjct: 135 GSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFV 194

Query: 176 LLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGG--SKLGRIGFRYWKDPGP 233
           L   +NL   + + E EF+++  K++A+  F+  G+V++ GG     G IG +YW DPG 
Sbjct: 195 LSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTKYWHDPGS 254

Query: 234 WGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRI 293
           + V +         F    ++ + AA++F GTE+V +T+ E ++   +V +A    F+RI
Sbjct: 255 FAVPV---------FKNLCNTFVSAAYSFSGTEMVVLTSTEARSV-SSVSRAAKGTFWRI 304

Query: 294 LLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAIN---AAGTKVLPDIMNGVIM 350
           ++FYI ++++IG LV Y+DP+LI   S+ +  ASPFV+A++   A GT+V    MN VI+
Sbjct: 305 IIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRV-SHFMNAVIL 363

Query: 351 VTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSS 410
           + + S  NS +Y  SR++ GL  +G  P   +     G P V +     FG LG+L VS 
Sbjct: 364 IAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSK 423

Query: 411 KSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAA 470
             G+VF WL ++ ++S F TW  I    +RF   +K +G S+DD+ +++    YG  +  
Sbjct: 424 NQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGC 483

Query: 471 FFVIVIILVQGFTAF----TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFH 520
              +++++ + + +     +P SA +F  Y +S  I + +++  + +++  W H
Sbjct: 484 ILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHR-IYRRDWRH 536

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  248 bits (633), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 153/521 (29%), Positives = 258/521 (49%), Gaps = 25/521 (4%)

Query: 13  SSSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQS------DVKRELKPRHVTMXXXXXX 66
           SS + I+  P     +V  H   + ES  ++ +++      + +R+L+ RHV +      
Sbjct: 46  SSLAHISTIPEG--GDVHVHEHEDGESFIDEDSRTHLLFSTETRRKLENRHVQLIAISGV 103

Query: 67  XXXXXXXXXASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFV 126
                       +   GP   LLA+        C+T S  EM  F PV+S F   A++ V
Sbjct: 104 IGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCV 163

Query: 127 SPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVK 186
             +      + +W   C+    EI  +  +I YW D       +A+  VL   I++  VK
Sbjct: 164 DDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVK 223

Query: 187 FYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGFRYWKD-------PGPWGVGI 238
           +YGE EFW+AS K+I  L    +  + + GG+ K  R GFR + +       P    VG 
Sbjct: 224 YYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDRYGFRNYGESPFKKYFPDGKDVGK 283

Query: 239 VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI 298
            S       F G+++ LI+A+FT  G E + + AGE K PR+ +PKA   VF R+   ++
Sbjct: 284 SS-----GYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFL 338

Query: 299 GSLLVIGLLVRYDDPQLIQ--DGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISA 356
           GS L +G++   +DP L    + +   A +SP+V+A+N    ++LPDI+N  ++    SA
Sbjct: 339 GSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSA 398

Query: 357 GNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVF 416
           GN+  Y  SR  YG+   G AP   +R    GVP  +V  + ++  +  L ++S S  V 
Sbjct: 399 GNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVL 458

Query: 417 DWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVI 476
           +WL+++   S    ++++ ++++ F +    +  S   LPF++   PY A         +
Sbjct: 459 NWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAM 518

Query: 477 ILVQGFTAFTP--FSAVDFVAYYISAFIFVVIWLLFQFLFK 515
           IL+QG+T F P  +S  DF+  Y+  FI + I++ ++F++K
Sbjct: 519 ILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWK 559

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  248 bits (634), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 136/466 (29%), Positives = 250/466 (53%), Gaps = 17/466 (3%)

Query: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMXXXXXXXXXXXXXXXASPIRNAG 83
           + K ++     SE+ES      ++++ + +K RH+ M                  +  AG
Sbjct: 69  SFKRQLPPSQNSELES----QEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAG 124

Query: 84  PVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSW 142
           P G +L Y   + M YC+ Q+ GE+   +  +T ++T + S  V P+LG A   +Y + W
Sbjct: 125 PAGLVLGYGVASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQW 184

Query: 143 CITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIA 202
                L++      + YW+ +V    ++A+ ++ +  INL   + Y E EF     K++ 
Sbjct: 185 LTVLPLQLVTAAMTVKYWT-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILM 243

Query: 203 ILCFLFYGLVVVCGGSKLGR-IGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFT 261
           ++ F+   +++ CGG+   + IG  YW +PGP+  G          F G  +    AAF+
Sbjct: 244 VIGFVILAIIINCGGAGDRKYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFS 293

Query: 262 FQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGST 321
           + G E++ ++A E +NP +++P A   V +RILL Y+ + +++  LV Y+  +L+    +
Sbjct: 294 YGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDS 353

Query: 322 TNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFI 381
           + ++ASPFV+A+ + G KV+P  +N VI++++IS  NS++Y G R+L  L   G+ P  +
Sbjct: 354 SGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCL 413

Query: 382 SRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRF 441
           +    RG P +  L +  FG +G++  S     VF WLL+I+++S  F W+ +S+SHIRF
Sbjct: 414 AYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRF 473

Query: 442 MQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP 487
              + K+G S +++ +KA+   +G++ A    +  ++ Q + A  P
Sbjct: 474 RDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAVFFLVCQFWVAIAP 519

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,291,514
Number of extensions: 1922342
Number of successful extensions: 8495
Number of sequences better than 10.0: 444
Number of HSP's gapped: 7159
Number of HSP's successfully gapped: 468
Length of query: 556
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 441
Effective length of database: 40,294,809
Effective search space: 17770010769
Effective search space used: 17770010769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)