Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR531Wna 1ON27427414970.0
Ecym_1475na 1ON3492386322e-80
Kwal_34.15946na 1ON2792845462e-68
KLTH0H15048gna 1ON2963034882e-59
SAKL0B05434gna 1ON3441294425e-52
Skud_8.555.586ON5351853312e-34
KAFR0A067205.586ON2351423152e-34
YHR006W (STP2)5.586ON5411683303e-34
Smik_8.635.586ON5421683232e-33
Suva_8.625.586ON5451853223e-33
ZYRO0D13992g5.586ON5871183172e-32
TDEL0A045305.586ON4841813133e-32
KNAG0B033505.586ON6001183154e-32
KLTH0G05104g5.586ON5381113144e-32
SAKL0G06292g5.586ON5171073134e-32
Kwal_47.183375.586ON5361063083e-31
TBLA0E028205.586ON3121212993e-31
Ecym_14045.586ON5621073057e-31
NCAS0H028905.586ON5321223031e-30
Kpol_1023.635.586ON5561123022e-30
NDAI0C006905.586ON6501123032e-30
NCAS0A079005.586ON3671072962e-30
KNAG0C060305.586ON3141372906e-30
AFR461C5.586ON5441072987e-30
NDAI0H011105.586ON4541062941e-29
KLLA0F10109g5.586ON6231482962e-29
Smik_4.7425.586ON5281062899e-29
YDR463W (STP1)5.586ON5191062881e-28
CAGL0K06413g5.586ON3591172794e-28
TPHA0K002105.586ON4811062791e-27
CAGL0E04312g5.586ON6881332822e-27
Skud_4.7395.586ON5141062783e-27
KAFR0C057105.586ON4421102738e-27
Suva_2.6395.586ON5161062741e-26
Kwal_26.93004.222ON3041271862e-15
KAFR0A061204.222ON3421361784e-14
NCAS0J013004.222ON435991768e-14
KLLA0F07073g4.222ON5581401742e-13
NDAI0J020604.222ON489621742e-13
SAKL0H03894g4.222ON358671722e-13
Kpol_337.64.222ON4001001732e-13
KNAG0B059404.222ON377661705e-13
KLTH0D13618g4.222ON414621705e-13
Suva_10.4914.222ON344731679e-13
YLR375W (STP3)4.222ON343661662e-12
Smik_12.4624.222ON341661652e-12
Skud_12.4604.222ON344661652e-12
Ecym_27684.222ON431941643e-12
TDEL0E015204.222ON399731634e-12
TBLA0A082004.222ON350981625e-12
TBLA0I027704.222ON6131311636e-12
ZYRO0B07436g4.222ON343731616e-12
TPHA0B009304.222ON347881617e-12
AFR588W4.222ON319941581e-11
Suva_4.2014.222ON503911592e-11
CAGL0H04873g4.222ON451731582e-11
Skud_4.2064.222ON486911582e-11
SAKL0H26224gsingletonON227711533e-11
Smik_4.1904.222ON489911563e-11
YDL048C (STP4)4.222ON490911555e-11
CAGL0K04697g4.222ON515581475e-10
NCAS0A023604.222ON478711404e-09
NDAI0D045104.222ON560581371e-08
Kpol_472.34.222ON311991219e-07
TPHA0B023904.222ON3461451164e-06
NCAS0F009002.533ON525681051e-04
SAKL0D06776g1.326ON7671521051e-04
NDAI0K018602.533ON730611042e-04
AGL071C2.533ON396611032e-04
Kwal_26.80212.533ON507821032e-04
Ecym_72552.533ON544611022e-04
KNAG0D041904.214ON1010601023e-04
KLLA0E18547g2.533ON43163995e-04
TDEL0A030702.533ON23964977e-04
KLTH0D06842g2.533ON50662988e-04
KAFR0A018602.533ON49081988e-04
ZYRO0B02002g2.533ON29477970.001
Skud_13.2262.533ON475114970.001
NDAI0H014002.533ON54178940.002
Suva_13.2462.533ON41991940.002
KNAG0H011803.281ON25466930.003
CAGL0K03003g2.533ON64761940.003
SAKL0A09482g2.533ON38895930.003
NDAI0A075403.298ON370132930.003
Ecym_21596.256ON46075930.003
Smik_13.2492.533ON47377920.004
KNAG0G012808.144ON47269920.005
YMR070W (MOT3)2.533ON490105920.005
TBLA0I014802.533ON51364910.006
TPHA0G035102.533ON38767900.007
Ecym_62951.326ON66360910.007
KAFR0A010903.281ON24963890.007
NCAS0A048002.533ON51169900.008
SAKL0H04070g4.214ON89995900.008
KAFR0H022108.330ON64394900.009
TPHA0C041902.533ON41766890.010
KNAG0C058102.533ON55464890.010
KNAG0J008703.281ON28061880.010
CAGL0L03916g2.162ON64282880.017
NCAS0I015603.281ON26659860.019
SAKL0D03146g3.281ON15762830.020
KNAG0D022208.130ON120661870.021
ACR264W2.162ON76988860.026
TBLA0F003708.144ON687115860.026
KAFR0B021608.144ON453101850.031
Kwal_47.166214.351ON1178110850.039
Smik_4.2813.281ON23164830.039
KNAG0I020702.162ON57264840.039
Ecym_54242.162ON77588840.044
NCAS0A021604.189ON412102840.044
SAKL0A03476g6.256ON32268830.044
KNAG0E026101.326ON74666840.047
KAFR0J003402.533ON21864820.051
CAGL0K04631g4.214ON101368840.052
Kpol_1023.1004.351ON91696840.052
NDAI0A074703.281ON26359820.053
KLLA0B07909g4.214ON92260840.054
Kpol_1052.183.281ON35761830.056
NDAI0B022508.234ON1156104830.060
Kpol_1065.153.281ON22060810.064
TBLA0G022302.533ON21664810.065
NDAI0D032404.351ON1362116830.068
Kwal_47.178882.162ON78688830.068
YDR043C (NRG1)3.281ON23161810.069
Kpol_1018.332.533ON58958820.071
KLTH0E09724g2.162ON76888830.071
KNAG0H034802.162ON79699820.074
AFR580C4.214ON83860820.075
KLTH0D06798g2.531ON11188770.078
Kwal_27.109253.281ON264110810.079
Suva_2.2003.281ON23261800.083
AEL174W1.326ON66193820.087
Skud_4.2973.281ON23161800.088
Suva_8.244.21ON63188810.099
Smik_6.4356.256ON38682810.10
KAFR0G030504.214ON74960810.10
Skud_16.486.256ON39881810.11
ZYRO0B07568g4.214ON61660810.12
KLTH0C07172g3.281ON265113790.13
TPHA0M011803.281ON35061800.13
TBLA0F013001.326ON98562800.14
TDEL0E015904.214ON77060800.16
Kpol_472.104.214ON83058790.20
SAKL0E10714g2.162ON81988790.20
TDEL0F010308.130ON107765790.21
Ecym_27604.214ON93860790.21
Ecym_26543.281ON25761770.21
NCAS0B069602.162ON839145790.22
NDAI0D042404.214ON116974790.22
TPHA0C021608.425ON137561790.24
TBLA0H006608.425ON131161780.25
CAGL0K12078g3.281ON46363780.26
Skud_8.174.21ON62786780.28
ZYRO0C13508g3.281ON18959760.28
CAGL0L07480g3.281ON31459770.28
TBLA0E047704.351ON165589780.29
NCAS0B045008.130ON120773780.30
YBR066C (NRG2)3.281ON22080760.31
KNAG0J022503.296ON29666760.34
Smik_2.1993.281ON220100750.37
NCAS0A129102.598ON82295770.38
YPL230W (USV1)6.256ON39181760.38
Suva_7.3494.214ON81260760.41
ZYRO0G20526g1.326ON84967760.42
CAGL0J05060g1.326ON71369760.43
Kpol_529.138.425ON141061760.47
KAFR0C003403.298ON39485750.49
Skud_7.3644.214ON81076760.49
TDEL0B015008.486ON12874720.49
KNAG0D021208.144ON40279750.49
TPHA0A039103.298ON35170750.50
Smik_6.1504.214ON80687760.52
Kwal_47.172418.144ON40363750.53
KLTH0D18062g4.351ON112897750.56
Kpol_1001.14.351ON134187750.59
YGR067C4.214ON80467750.59
NCAS0C040708.144ON28970740.62
Kpol_1072.582.162ON79467750.67
Ecym_23012.598ON76776740.70
Kpol_1050.193.518ON22172730.73
TBLA0I032803.518ON33088740.74
SAKL0H24816g8.144ON41062740.76
KLLA0F23782g2.162ON78257740.78
ACL057W8.144ON52072740.79
KLLA0C17072g8.144ON47463740.82
TDEL0D019501.326ON75561740.84
KAFR0C004903.281ON22459720.85
KAFR0B068104.351ON115560740.86
KLLA0F01463g1.326ON78161740.87
Smik_16.4507.543ON43234730.88
NCAS0A091601.326ON77357740.88
KLTH0E06688g8.144ON39762730.88
Skud_5.1373.518ON39467730.91
TBLA0B061604.351ON138460740.92
ZYRO0G19140g8.144ON55760730.92
AFL136W6.256ON40969730.93
KNAG0D009006.256ON32269730.93
KLTH0D08734g2.598ON67763730.97
TDEL0D034303.281ON17559710.98
KNAG0A070402.533ON35261730.99
Kpol_1052.83.298ON38666731.0
Skud_16.4907.543ON40733731.0
KAFR0F039404.189ON45233731.1
CAGL0E03762g4.21ON58473731.1
Suva_6.1321.326ON878128731.1
TPHA0A039803.281ON31462721.1
NDAI0B060203.518ON42695721.2
Suva_16.766.256ON39255721.2
AER159C4.351ON119180731.2
KLLA0C16005g6.256ON33174721.3
YHL027W (RIM101)4.21ON62556721.3
Skud_5.2488.144ON44262721.3
YER130C8.144ON44362721.3
SAKL0G18062g4.351ON1238112721.3
Suva_5.2518.144ON44959721.4
Skud_2.1893.281ON22057711.4
Smik_8.144.21ON62958721.4
KAFR0B025508.234ON89063721.4
TDEL0B046708.144ON31262711.4
Kwal_26.80112.531ON19058701.4
NCAS0G012706.256ON27499711.5
NCAS0B048408.234ON864116721.5
KLLA0F18524g3.281ON35762711.5
KAFR0B063608.425ON62761721.5
Suva_13.3636.256ON21163701.5
NDAI0C005602.598ON97259721.5
TBLA0A084604.21ON54157721.5
CAGL0K04257g4.189ON547106711.6
Suva_4.3053.281ON22057701.6
TDEL0D058603.518ON33058711.6
Suva_13.704.351ON777111711.7
ABR089C2.598ON57159711.7
Smik_5.2768.144ON44262711.7
Smik_5.1513.518ON38862711.7
CAGL0K02145g8.144ON31773701.7
SAKL0B11330g2.598ON49959711.8
NDAI0G058001.326ON836128711.8
Skud_10.1521.326ON87964711.8
Suva_16.5187.543ON42765711.8
Smik_10.1841.326ON88564711.8
AGL246W8.486ON22782691.9
TPHA0B003804.351ON131081711.9
NCAS0A023104.214ON87958712.0
NDAI0C048608.425ON135061712.0
NDAI0B042902.162ON106458712.1
ZYRO0F01012g2.598ON58471702.1
NCAS0F037403.518ON288106702.2
Kpol_1035.221.326ON79755702.2
TPHA0C025802.598ON36575702.2
Kpol_1002.256.256ON29472702.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR531W
         (274 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...   581   0.0  
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...   248   2e-80
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...   214   2e-68
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...   192   2e-59
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...   174   5e-52
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...   132   2e-34
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....   125   2e-34
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...   131   3e-34
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)   129   2e-33
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...   128   3e-33
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...   126   2e-32
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...   125   3e-32
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...   125   4e-32
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...   125   4e-32
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...   125   4e-32
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...   123   3e-31
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...   119   3e-31
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...   122   7e-31
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...   121   1e-30
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...   120   2e-30
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...   121   2e-30
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...   118   2e-30
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....   116   6e-30
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...   119   7e-30
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586    117   1e-29
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...   118   2e-29
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...   115   9e-29
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...   115   1e-28
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...   112   4e-28
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...   112   1e-27
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...   113   2e-27
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...   111   3e-27
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...   109   8e-27
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...   110   1e-26
Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375...    76   2e-15
KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa] ...    73   4e-14
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    72   8e-14
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    72   2e-13
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    72   2e-13
SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {...    71   2e-13
Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON} (17510..18...    71   2e-13
KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON} Anc_4...    70   5e-13
KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} simi...    70   5e-13
Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 ...    69   9e-13
YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}  STP3Zinc-...    69   2e-12
Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375...    68   2e-12
Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375...    68   2e-12
Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar...    68   3e-12
TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {O...    67   4e-12
TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa] ...    67   5e-12
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    67   6e-12
ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {...    67   6e-12
TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {O...    67   7e-12
AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic h...    65   1e-11
Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON...    66   2e-11
CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {...    65   2e-11
Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON...    65   2e-11
SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some ...    64   3e-11
Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON...    65   3e-11
YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}  ...    64   5e-11
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    61   5e-10
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     59   4e-09
NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa] ...    57   1e-08
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    51   9e-07
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    49   4e-06
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    45   1e-04
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    45   1e-04
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    45   2e-04
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    44   2e-04
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    44   2e-04
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    44   2e-04
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    44   3e-04
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    43   5e-04
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    42   7e-04
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    42   8e-04
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    42   8e-04
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    42   0.001
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    42   0.001
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    41   0.002
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    41   0.002
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    40   0.003
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    41   0.003
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    40   0.003
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    40   0.003
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    40   0.003
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    40   0.004
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    40   0.005
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    40   0.005
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    40   0.006
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    39   0.007
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    40   0.007
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    39   0.007
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    39   0.008
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    39   0.008
KAFR0H02210 Chr8 complement(420773..422704) [1932 bp, 643 aa] {O...    39   0.009
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    39   0.010
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    39   0.010
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    39   0.010
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    39   0.017
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      38   0.019
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    37   0.020
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    38   0.021
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    38   0.026
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    38   0.026
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    37   0.031
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    37   0.039
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    37   0.039
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    37   0.039
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    37   0.044
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    37   0.044
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    37   0.044
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    37   0.047
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       36   0.051
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    37   0.052
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    37   0.052
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    36   0.053
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    37   0.054
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    37   0.056
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    37   0.060
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    36   0.064
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    36   0.065
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    37   0.068
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    37   0.068
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    36   0.069
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    36   0.071
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    37   0.071
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    36   0.074
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    36   0.075
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    34   0.078
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    36   0.079
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    35   0.083
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    36   0.087
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    35   0.088
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    36   0.099
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    36   0.10 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    36   0.10 
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    36   0.11 
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    36   0.12 
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    35   0.13 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    35   0.13 
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    35   0.14 
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    35   0.16 
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    35   0.20 
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    35   0.20 
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    35   0.21 
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    35   0.21 
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    34   0.21 
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    35   0.22 
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    35   0.22 
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    35   0.24 
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    35   0.25 
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    35   0.26 
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    35   0.28 
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    34   0.28 
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    34   0.28 
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    35   0.29 
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    35   0.30 
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    34   0.31 
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               34   0.34 
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    33   0.37 
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    34   0.38 
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    34   0.38 
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    34   0.41 
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    34   0.42 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    34   0.43 
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    34   0.47 
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    33   0.49 
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    34   0.49 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    32   0.49 
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    33   0.49 
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    33   0.50 
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    34   0.52 
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    33   0.53 
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    33   0.56 
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    33   0.59 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    33   0.59 
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      33   0.62 
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    33   0.67 
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    33   0.70 
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    33   0.73 
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    33   0.74 
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    33   0.76 
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    33   0.78 
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    33   0.79 
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    33   0.82 
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    33   0.84 
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    32   0.85 
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    33   0.86 
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    33   0.87 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    33   0.88 
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    33   0.88 
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    33   0.88 
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    33   0.91 
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    33   0.92 
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    33   0.92 
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    33   0.93 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    33   0.93 
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    33   0.97 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    32   0.98 
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    33   0.99 
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    33   1.0  
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    33   1.0  
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    33   1.1  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   1.1  
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    33   1.1  
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    32   1.1  
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    32   1.2  
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    32   1.2  
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    33   1.2  
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    32   1.3  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    32   1.3  
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    32   1.3  
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    32   1.3  
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    32   1.3  
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    32   1.4  
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    32   1.4  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    32   1.4  
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    32   1.4  
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    32   1.4  
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    32   1.4  
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      32   1.5  
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     32   1.5  
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    32   1.5  
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    32   1.5  
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    32   1.5  
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     32   1.5  
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    32   1.5  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    32   1.6  
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    32   1.6  
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    32   1.6  
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    32   1.7  
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    32   1.7  
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    32   1.7  
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    32   1.7  
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    32   1.7  
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    32   1.8  
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    32   1.8  
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    32   1.8  
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    32   1.8  
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    32   1.8  
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    31   1.9  
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    32   1.9  
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    32   2.0  
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    32   2.0  
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    32   2.1  
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    32   2.1  
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    32   2.2  
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    32   2.2  
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    32   2.2  
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    32   2.2  
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    32   2.2  
Kpol_278.5 s278 complement(13304..14383) [1080 bp, 359 aa] {ON} ...    32   2.2  
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    32   2.3  
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    31   2.3  
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    31   2.3  
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    32   2.3  
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    31   2.3  
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    32   2.4  
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    32   2.4  
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    31   2.5  
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    32   2.5  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    32   2.6  
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    32   2.7  
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    31   2.7  
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    31   2.7  
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    32   2.8  
Kwal_27.11691 s27 (906321..906827) [507 bp, 168 aa] {OFF} [conti...    30   2.8  
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    32   2.9  
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    31   2.9  
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    32   3.0  
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    31   3.0  
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    31   3.1  
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    31   3.1  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    31   3.1  
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    31   3.1  
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    31   3.1  
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    31   3.2  
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    31   3.2  
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     31   3.4  
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    31   3.5  
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    31   3.5  
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    30   3.6  
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    31   3.7  
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    31   3.8  
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    31   3.9  
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    31   4.0  
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    30   4.2  
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    30   4.3  
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    31   4.3  
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    31   4.3  
SAKL0G16434g Chr7 (1423039..1423932) [894 bp, 297 aa] {ON} some ...    30   4.3  
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    31   4.5  
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     31   4.6  
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    31   4.6  
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    30   4.7  
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    31   4.7  
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    30   4.8  
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    31   4.9  
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               30   4.9  
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    30   5.3  
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    30   5.4  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    30   5.4  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 30   5.5  
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    30   5.6  
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    30   5.6  
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    30   5.7  
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    30   5.7  
Kwal_14.1457 s14 complement(331338..332885) [1548 bp, 515 aa] {O...    30   5.7  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    30   5.8  
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    30   5.8  
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    30   6.0  
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    30   6.1  
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    30   6.1  
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    30   6.2  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    30   6.3  
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    30   6.7  
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                30   7.0  
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    30   7.1  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    30   7.2  
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     30   7.4  
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    30   7.4  
NDAI0D04090 Chr4 complement(959363..960733) [1371 bp, 456 aa] {O...    30   7.5  
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    29   7.5  
TDEL0D04500 Chr4 (825355..826758) [1404 bp, 467 aa] {ON} Anc_3.1...    30   7.6  
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    30   7.6  
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    30   7.6  
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    30   7.9  
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    30   8.1  
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    30   8.3  
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    30   8.6  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    30   8.7  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    30   8.8  
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    29   9.0  
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    29   9.0  
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    30   9.4  
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    30   9.4  
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    30   9.7  
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    30   9.7  

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/274 (100%), Positives = 274/274 (100%)

Query: 1   MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQEFTGQPGRQHNLQIGGQGKDEEANMAQLWD 60
           MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQEFTGQPGRQHNLQIGGQGKDEEANMAQLWD
Sbjct: 1   MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQEFTGQPGRQHNLQIGGQGKDEEANMAQLWD 60

Query: 61  VLMGNDGLPAGAEVQPLRAAEVPTLRCSPEPSSLEEDMQGQFQYKDLISVHLSPCTQDEQ 120
           VLMGNDGLPAGAEVQPLRAAEVPTLRCSPEPSSLEEDMQGQFQYKDLISVHLSPCTQDEQ
Sbjct: 61  VLMGNDGLPAGAEVQPLRAAEVPTLRCSPEPSSLEEDMQGQFQYKDLISVHLSPCTQDEQ 120

Query: 121 ASGDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMP 180
           ASGDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMP
Sbjct: 121 ASGDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMP 180

Query: 181 YKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQ 240
           YKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQ
Sbjct: 181 YKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQ 240

Query: 241 FNNNKDWLKYHIDAGRCTEFKLRQDEKTHVYGTF 274
           FNNNKDWLKYHIDAGRCTEFKLRQDEKTHVYGTF
Sbjct: 241 FNNNKDWLKYHIDAGRCTEFKLRQDEKTHVYGTF 274

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score =  248 bits (632), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 155/238 (65%), Gaps = 26/238 (10%)

Query: 52  EANMAQLWDVLMGNDGLP---AGAEVQPLRAAEVPTLRCS--PEPSSLEEDMQGQFQYKD 106
           E    QLWD LM  D L    AG + Q L A E P    S   EPSSL+E++   F +K 
Sbjct: 104 ELTTTQLWDFLMTADNLSLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKL 163

Query: 107 LISVHL-SPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPT-FARDSA---------- 154
             S  L SP   D+ +S DS D+ QI +  ++    +   +P+ FA +SA          
Sbjct: 164 PGSSSLVSPVNFDDISSTDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIVC 223

Query: 155 ---------VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKD 205
                    +Y+C YCPS+FKVRGYLTRHLKKHMP K FRCPYWSEDCRCH SGEFSRKD
Sbjct: 224 HPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKD 283

Query: 206 TFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTEFKLR 263
           TFRTHLKSIHFVYPVGTTKAQR NS GRCAACYE FN+NKDWLKYHIDA  C +FK++
Sbjct: 284 TFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIK 341

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 26/30 (86%)

Query: 1  MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQ 30
          MGYIQFH V +P+ NVVSLG+L++ LQRQ+
Sbjct: 1  MGYIQFHPVGVPQGNVVSLGLLNEQLQRQR 30

>Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 272] FULL
          Length = 279

 Score =  214 bits (546), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 166/284 (58%), Gaps = 35/284 (12%)

Query: 1   MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQEFT--GQPGRQHNLQ--------IGGQGKD 50
           MGYIQF  V +PEDNVVSLG+L+K L+RQ+     G+ G +  +         +  +   
Sbjct: 1   MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMGEIGAEMGVTCDEIDSKPVHTRLCA 60

Query: 51  EEANMAQLWDVLMG--------NDGLPA-GAEVQPLRAAEVPTLRCSPEPSSLEEDMQGQ 101
             A++AQ+W+ L+G        N G P+   E   LR   VP++      + L       
Sbjct: 61  TSASIAQMWESLLGFEHYSEVPNAGQPSLDEETCGLRFDTVPSVESFCTDADLAASASST 120

Query: 102 FQYK---DLISVHLSPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPT----FARDSA 154
             Y    DL  VH           G+ +  P   ET      + P+   T     A  +A
Sbjct: 121 CSYSVVDDLDHVH---------QPGNGTRPPACLETQPSSFGDTPSAINTPAAAAAASTA 171

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           +++C++CPSNFKV+GYLTRH+KKH+  KDFRCP+WS DCRCH+SGEFSRKDT++THLKSI
Sbjct: 172 MFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSI 231

Query: 215 HFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCT 258
           HFVYPVG  K+QR+ S GRCAACY++F NN +WL  H+++  C+
Sbjct: 232 HFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCS 275

>KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 296

 Score =  192 bits (488), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 158/303 (52%), Gaps = 55/303 (18%)

Query: 1   MGYIQFHGVYLPEDNVVSLGVLSKHL----------------QRQQEFTGQPGRQHNLQI 44
           MGYIQF  V +PEDNVVSLG+LS+ L                +   E+    GR++  + 
Sbjct: 1   MGYIQFDKVDVPEDNVVSLGLLSRQLQKQQLGQLGELAGLGDEYASEYASGFGREYGGEY 60

Query: 45  GGQGKDE-----------------EANMAQLWDVLMGNDGLPAGAEVQPLRAAEVPTLRC 87
            G+   E                  A++AQ W  L+G D   + ++ +P    E   +R 
Sbjct: 61  SGEYGHEYRGEYARKSVHTTLSATSASIAQTWHALLGFDHYDSASDGKPSLDEETCGVRF 120

Query: 88  SPEPSSLEEDMQGQFQYKDLIS----VHLSPCTQDEQASGDSSDAPQISETPVDVAVEAP 143
              P+++                   V  SP +  E  S  +  A             A 
Sbjct: 121 DTVPAAIAAASMASSSSSSCTERSALVPASPASSTECGSAGAKPAALSG---------AA 171

Query: 144 AQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSR 203
            Q P        ++C++CPS+FKV+GYLTRH+KKH+  KDF+CP+WSEDCRCH+SGEFSR
Sbjct: 172 MQQP--------FQCAFCPSSFKVKGYLTRHMKKHLVTKDFQCPFWSEDCRCHASGEFSR 223

Query: 204 KDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTEF-KL 262
           KDT++THLKS+HFVYPVG  K+QR  S GRCAACY +F +N +WL  H++  +C    KL
Sbjct: 224 KDTYKTHLKSVHFVYPVGVAKSQRGQSKGRCAACYHEFASNAEWLLRHVETRQCEALVKL 283

Query: 263 RQD 265
           + +
Sbjct: 284 KHE 286

>SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 344

 Score =  174 bits (442), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 100/129 (77%), Gaps = 2/129 (1%)

Query: 141 EAPAQSPTF-ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSG 199
           E  A SP   A    +++C +CPSNFKV+GYLTRHLKKH+P KD+ CPYWS DC+CH++G
Sbjct: 216 ELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTG 275

Query: 200 EFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTE 259
           EFSRKDTF+THLKSIHFVYPVG  K+QR+ S GRCAAC+++F +N  WL  HI+ G C  
Sbjct: 276 EFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRG 335

Query: 260 -FKLRQDEK 267
            F+++ +E+
Sbjct: 336 LFEVKNEEQ 344

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 5/53 (9%)

Query: 1  MGYIQFHGVYLPEDNVVSLGVLSKHLQ-----RQQEFTGQPGRQHNLQIGGQG 48
          MGYIQF  V +P+DN+VSLG+L+K LQ     R+Q    +     +  + GQG
Sbjct: 1  MGYIQFDKVNIPQDNLVSLGLLNKQLQKLKDEREQALQVENDNDKSSSVSGQG 53

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score =  132 bits (331), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 104/185 (56%), Gaps = 13/185 (7%)

Query: 94  LEEDMQGQFQYKDLISVHLSPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARDS 153
           L+E      QYK L   +  P T        +S    + E+P+  + E P  +   + ++
Sbjct: 146 LDESYINNEQYKALFPSNFLPITPISSVITPASKK-SVDESPL--SDEVPQGTADESSET 202

Query: 154 AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYW----SEDCRCHSSGEFSRKDTFRT 209
             Y C YC + F++RGYLTRH+KKH   K + CP++    S++ RCH+SG FSR+DT++T
Sbjct: 203 LPYVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFSRRDTYKT 262

Query: 210 HLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTEF------KLR 263
           HLKS HF YP G     RN S G CA C E F+ ++ W++ HI+AG C         ++R
Sbjct: 263 HLKSRHFNYPEGVKPQDRNKSSGACAQCGEHFSTSESWVENHIEAGSCKGLPEGYSERIR 322

Query: 264 QDEKT 268
           + +KT
Sbjct: 323 EKKKT 327

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score =  125 bits (315), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 87/142 (61%), Gaps = 5/142 (3%)

Query: 123 GDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYK 182
           G  S    ++ T       AP    T ++ + +Y C YC ++F++RGYLTRH+KKH   K
Sbjct: 3   GAQSGNMMVAGTQYKYKSSAPLSDKT-SKTNGMYVCHYCDASFRIRGYLTRHIKKHSIEK 61

Query: 183 DFRCPYWSE----DCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACY 238
            + CP+++E    + +CH+SG FSR+DT++THLKS H +YP G  + +RN S G CA C 
Sbjct: 62  AYHCPFYNEHQPSELKCHNSGGFSRRDTYKTHLKSRHILYPKGVKQNERNKSTGHCAQCG 121

Query: 239 EQFNNNKDWLKYHIDAGRCTEF 260
           E F N   W++ HI++G CT  
Sbjct: 122 EFFQNLDHWVETHIESGECTAL 143

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score =  131 bits (330), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 95/168 (56%), Gaps = 8/168 (4%)

Query: 94  LEEDMQGQFQYKDLISVHLSPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARDS 153
           LEE      QYK L   +  P T        +S    I E+P+   V+  A     + ++
Sbjct: 146 LEESYINNDQYKALFPSNFLPITPVSSVITPASKK-SIDESPLSDEVQGIADE---SSET 201

Query: 154 AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYW----SEDCRCHSSGEFSRKDTFRT 209
             Y C YC + F++RGYLTRH+KKH   K + CP++    S++ RCH+SG FSR+DT++T
Sbjct: 202 LPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKT 261

Query: 210 HLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           HLKS HF YP G     RN S G C  C E F+ ++ W++ HI+AG C
Sbjct: 262 HLKSRHFTYPEGVKPQDRNKSPGVCTQCGEHFSTSESWVENHIEAGSC 309

>Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)
          Length = 542

 Score =  129 bits (323), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 95/168 (56%), Gaps = 8/168 (4%)

Query: 94  LEEDMQGQFQYKDLISVHLSPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARDS 153
           L E      QYK L   +  P T        +S    I E+P+   ++  A     + ++
Sbjct: 146 LHESYINTDQYKALFPSNFLPITPISSVITPASKKC-IDESPLSDEIQGTADE---SSEA 201

Query: 154 AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYW----SEDCRCHSSGEFSRKDTFRT 209
             Y C YC + F++RGYLTRH+KKH   K + CP++    S++ RCH+SG FSR+DT++T
Sbjct: 202 LSYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKT 261

Query: 210 HLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           HLKS HF YP G     RN S G CA C E F+ ++ W++ HI+AG C
Sbjct: 262 HLKSRHFTYPEGVKPQDRNKSSGACAQCGEYFHTSESWVENHIEAGSC 309

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score =  128 bits (322), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 103/185 (55%), Gaps = 14/185 (7%)

Query: 94  LEEDMQGQFQYKDLISVHLSPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARDS 153
           L+E      QYK L      P T        +S    + ++P+  +V+        + ++
Sbjct: 146 LDESYMNNEQYKALFPSSFLPITPVSNVITPASKK-SVDDSPLSDSVQGNTDE---SSET 201

Query: 154 AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYW----SEDCRCHSSGEFSRKDTFRT 209
             Y C YC S F++RGYLTRH+KKH   K + CP++    S++ RCH+SG FSR+DT++T
Sbjct: 202 LPYICHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYKT 261

Query: 210 HLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTEF------KLR 263
           HLKS HF YP G     RN S G CA C E F++++ W++ HI+AG C         ++R
Sbjct: 262 HLKSRHFNYPEGIKPQYRNKSSGACAQCGEYFSSSESWVENHIEAGSCKGLPEGYSERIR 321

Query: 264 QDEKT 268
           + +KT
Sbjct: 322 EKKKT 326

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score =  126 bits (317), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 76/118 (64%), Gaps = 4/118 (3%)

Query: 144 AQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYW----SEDCRCHSSG 199
           A+ P  A    ++ C YC + FK+RGYLTRH+KKH   K + CP++      + RCH+SG
Sbjct: 192 AEVPEGANSEGLFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSG 251

Query: 200 EFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
            FSR+DT++THL++ HF+YP G   ++RN S G C  C + F N   W++ HI++G C
Sbjct: 252 GFSRRDTYKTHLRTRHFIYPKGVKPSERNKSAGNCGQCGQSFENTDKWVEQHIESGEC 309

>TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.586
           YHR006W
          Length = 484

 Score =  125 bits (313), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 95/181 (52%), Gaps = 9/181 (4%)

Query: 81  EVPTLRCSPEPSSLEEDMQGQFQYKDLISVHLSPCTQDEQASGDSSDAPQISETPVDVAV 140
           +V    C+ + S++E  M      +  +S     C    +    S   P+ S T      
Sbjct: 68  DVSVTPCAMDMSTMETPMTMTVSPEGNVS-----CKLKNEIKATSPITPESSTTAKTPTP 122

Query: 141 EAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWS----EDCRCH 196
           +  +     A+D  V+ C YC + F++RGYLTRH+KKH   K + CP++S    +D RCH
Sbjct: 123 DGVSPQDEVAKDKEVFVCHYCDAKFRIRGYLTRHIKKHAIQKAYHCPFFSAEAPQDMRCH 182

Query: 197 SSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGR 256
           +SG FSR+DT++THL++ HF YP G     R  S G C+ C + F N   W++ HI+ G 
Sbjct: 183 NSGGFSRRDTYKTHLRARHFTYPKGVKPQDRTKSSGHCSQCEQFFENTDQWVEQHIETGE 242

Query: 257 C 257
           C
Sbjct: 243 C 243

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score =  125 bits (315), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 76/118 (64%), Gaps = 4/118 (3%)

Query: 147 PTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWS----EDCRCHSSGEFS 202
           P  A D   Y C YC + FK+RGYLTRH+KKH   K + CP+++     + +CH++G FS
Sbjct: 190 PAVASDVGTYICHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTELKCHNTGGFS 249

Query: 203 RKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTEF 260
           R+DT++THLK+ HFVYP G   + R+ S G CA C + F +   W+K HI+ G+C+  
Sbjct: 250 RRDTYKTHLKTRHFVYPNGVKPSDRSKSNGTCAHCGDYFESADKWIKEHIEGGQCSSL 307

>KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 538

 Score =  125 bits (314), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 74/111 (66%), Gaps = 4/111 (3%)

Query: 151 RDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDC----RCHSSGEFSRKDT 206
           +D   + C YC + F +RGYLTRH+KKH   K + CPY++ D     RCH++G FSR+DT
Sbjct: 154 KDQKRFVCHYCNAKFYIRGYLTRHIKKHAVEKAYYCPYFNADAPKDQRCHTTGGFSRRDT 213

Query: 207 FRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           ++THL+S HF+ P G    ++  S GRCA C EQF+   DW+K H++AG C
Sbjct: 214 YKTHLRSRHFICPKGVRSQEKAKSSGRCAHCNEQFDKTDDWIKSHVEAGEC 264

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score =  125 bits (313), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 73/107 (68%), Gaps = 4/107 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE----DCRCHSSGEFSRKDTFRTHL 211
           Y C YC + F++RGYLTRH+KKH   K + CP+++     + RCH++G FSR+DT++THL
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTHL 221

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCT 258
           KS HF+YP G    +RN S G C+ C E F N + W++ HI+ G CT
Sbjct: 222 KSRHFIYPKGIKTQERNKSSGNCSHCGEWFENTEKWIENHIETGDCT 268

>Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 196] FULL
          Length = 536

 Score =  123 bits (308), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (67%), Gaps = 4/106 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWS----EDCRCHSSGEFSRKDTFRTHL 211
           + C YC + F +RGYLTRH+KKH   K + CP+++    +D RCH++G FSR+DT++THL
Sbjct: 157 FVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDTYKTHL 216

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           +S HFV P G    ++  S GRCA C E F N  DW+K H++AG C
Sbjct: 217 RSRHFVCPKGVRSQEKAKSSGRCAHCNEHFENTDDWIKGHVEAGEC 262

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score =  119 bits (299), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 8/121 (6%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE----DCRCHSSGEFSRKDTFRTHL 211
           Y C YC ++F++  YLTRH+KKH   K F+CP+++E    D RCH SG FSRKDTF+ HL
Sbjct: 13  YICHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHL 72

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTE----FKLRQDEK 267
           K  HF+YP G  + +R+   G CA C E F+N+ DW+  HI  G+C      F+++ + K
Sbjct: 73  KCRHFIYPKGIKQNERSKYSGNCAQCGEFFHNSNDWMDNHISTGQCKSLPQGFRMKSEVK 132

Query: 268 T 268
           +
Sbjct: 133 S 133

>Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR461C
          Length = 562

 Score =  122 bits (305), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWS----EDCRCHSSGEFSRKDTFRTHL 211
           Y C YC + F++RGYLTRH+KKH   K + CP+++     + RCH++G FSR+DT++THL
Sbjct: 163 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNGCSPPETRCHTTGGFSRRDTYKTHL 222

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCT 258
           +S HF+YP G     RN S G CA C + F N   W++ HI++G CT
Sbjct: 223 RSRHFIYPEGVKTQDRNRSPGHCAHCGKWFENTSKWIEKHIESGYCT 269

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score =  121 bits (303), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 8/122 (6%)

Query: 144 AQSPTFARDSAV----YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDC----RC 195
           +Q+PT   D       + C YC + F++RGYLTRH+KKH   K + CP+++ D     RC
Sbjct: 167 SQTPTKEEDEETDDGPFICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRC 226

Query: 196 HSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAG 255
           H++G FSR+DT++THLK+ HFVYP G     R  S G C+ C + F    DW+K HI++G
Sbjct: 227 HNTGGFSRRDTYKTHLKARHFVYPKGMKPQDRAKSSGHCSQCGQSFTTADDWIKNHIESG 286

Query: 256 RC 257
            C
Sbjct: 287 DC 288

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score =  120 bits (302), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 76/112 (67%), Gaps = 4/112 (3%)

Query: 150 ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE----DCRCHSSGEFSRKD 205
           +++   + C YC ++F++RGYLTRH+KKH   K + CP++++    D RCH+SG FSR+D
Sbjct: 174 SKNDGEFVCHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRD 233

Query: 206 TFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           T++THLK  HF+YP G     R+ S G CA C E F N ++W++ HI+ G C
Sbjct: 234 TYKTHLKVRHFMYPDGVKPQDRSKSSGHCAQCGEFFENTENWVEQHIETGNC 285

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score =  121 bits (303), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 72/112 (64%), Gaps = 4/112 (3%)

Query: 150 ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDC----RCHSSGEFSRKD 205
             +   + C YC + F++RGYLTRH+KKH   K + CP+++ D     RCH+SG FSR+D
Sbjct: 267 TEEEGTFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRD 326

Query: 206 TFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           T++THLK+ HF+YP G     RN S G C+ C E FN+   W+  H+++G C
Sbjct: 327 TYKTHLKARHFIYPKGVKPQDRNKSSGHCSQCGEFFNSTDIWISKHLESGNC 378

>NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa]
           {ON} Anc_5.586
          Length = 367

 Score =  118 bits (296), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 74/107 (69%), Gaps = 4/107 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSED----CRCHSSGEFSRKDTFRTHL 211
           Y C YC + F+++GYLTRH+KKH   K + CP++S +     RCH+SG FSR+DT++THL
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTHL 155

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCT 258
           K+ H ++P G    +RN S G CA C E F N ++W++ HI++G C+
Sbjct: 156 KARHILFPKGIRPHERNKSKGHCAQCGEFFTNFENWVELHIESGDCS 202

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score =  116 bits (290), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 125 SSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           S+DA   S   +D    A    P+ +     + C YC + F++RGYLTRH+KKH   K F
Sbjct: 30  STDAAGKSAGVIDEEWAAGPARPSSSSAMEPFVCHYCDARFRMRGYLTRHIKKHAIEKAF 89

Query: 185 RCPYWSE----DCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQ 240
           RCP++      D +CH SG FSR+DT++THLK  H +YP G   + RN S G C AC E 
Sbjct: 90  RCPFFQRGQPRDLQCHPSGGFSRRDTYKTHLKVKHVLYPPGVRPSDRNRSGGHCTACGEY 149

Query: 241 FNNNKDWLKYHIDAGRC 257
             +  +W++ HI++G C
Sbjct: 150 TESLHEWVEQHIESGAC 166

>AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR463W
           (STP1)
          Length = 544

 Score =  119 bits (298), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 71/107 (66%), Gaps = 4/107 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE----DCRCHSSGEFSRKDTFRTHL 211
           + C YC + F++RGYLTRH+KKH   K + CP+++     + RCH++G FSR+DT++THL
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTHL 211

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCT 258
           +S HF+YP G     R  S G CA C + F N   W++ HI++G CT
Sbjct: 212 RSRHFIYPEGVKTQDRGKSCGHCAHCGKWFENTSTWIEKHIESGYCT 258

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score =  117 bits (294), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (70%), Gaps = 4/106 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSED----CRCHSSGEFSRKDTFRTHL 211
           Y C +C + F+++GYLTRHLKKH   K + CP+++ D     RCH+SG FSR+DT++THL
Sbjct: 100 YVCHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKTHL 159

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           KS H ++P G     RN SVG CA C + F++ ++W++ HI++G+C
Sbjct: 160 KSRHILFPKGVRPQDRNKSVGHCAQCGDFFDSCENWVETHIESGKC 205

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score =  118 bits (296), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 122 SGDSS--DAPQISETPVDVA-VEAPAQSPTFARDS-----AVYRCSYCPSNFKVRGYLTR 173
           S DSS    P++S   V V+  ++ +Q PT   D        + C YC + FK+RGYLTR
Sbjct: 200 SEDSSVGSTPEVSSGIVPVSSTDSESQVPTDKSDEKKETDMKFVCHYCDAEFKMRGYLTR 259

Query: 174 HLKKHMPYKDFRCPYWS----EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNN 229
           H+KKH   K + CP+W      + RCHS+G FSR+D+++THL+S HF+YP       R N
Sbjct: 260 HIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTHLRSRHFIYPDNVKNVDRVN 319

Query: 230 SVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           S G C  C + F++  +W+++HI+   C
Sbjct: 320 SHGHCGRCKKHFDSTNEWIEHHIENREC 347

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score =  115 bits (289), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (67%), Gaps = 4/106 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE----DCRCHSSGEFSRKDTFRTHL 211
           + C YC + F++RGYLTRH+KKH   K + CP+++     D RCH+SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           K+ H +YP G     RN S G CA C E F+  +++++ HI++G C
Sbjct: 220 KARHVLYPKGVRPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDC 265

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score =  115 bits (288), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (67%), Gaps = 4/106 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE----DCRCHSSGEFSRKDTFRTHL 211
           + C YC + F++RGYLTRH+KKH   K + CP+++     D RCH+SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           K+ H +YP G     RN S G CA C E F+  +++++ HI++G C
Sbjct: 220 KARHVLYPKGVKPQDRNKSSGHCAQCGEYFSTIENFVENHIESGDC 265

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score =  112 bits (279), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 51/117 (43%), Positives = 77/117 (65%), Gaps = 8/117 (6%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE----DCRCHSSGEFSRKDTFRTHL 211
           + C YC + FK+RGYLTRH+KKH   K + CPY++E    D RCH++G FSR+DT++ H+
Sbjct: 41  FVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYKAHM 100

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCT----EFKLRQ 264
           K+ H +YP G    +R  S G C+ C E   N + W++ H+++G+CT    E+ L+Q
Sbjct: 101 KTRHIMYPSGVKSQERFKSSGHCSHCGEYSPNVEFWVEDHVESGQCTALPEEYILKQ 157

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score =  112 bits (279), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 4/106 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYW----SEDCRCHSSGEFSRKDTFRTHL 211
           + C YC + F++RGYLTRH+KKH   K F CP++    S   +CH++G FSR+DT++ HL
Sbjct: 99  FVCHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHL 158

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           K  HF+YP G     R+ S G C+ C E F   + W++ HI++G C
Sbjct: 159 KIRHFMYPTGVKPRDRHKSSGYCSQCGEFFKTTERWVETHIESGNC 204

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score =  113 bits (282), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 79/133 (59%), Gaps = 4/133 (3%)

Query: 129 PQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPY 188
           P+  ++   +  +  A+S T   D   + C YC + F++RGYLTRH+KKH   K + CP+
Sbjct: 171 PKPVDSITSIKKDTKAKSETLDDDEKEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPF 230

Query: 189 WS----EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNN 244
           ++       RCH+SG FSR+DT++TH+K+ H +YP G   A RN S G CA C       
Sbjct: 231 YNGQEVPSKRCHNSGGFSRRDTYKTHMKARHLIYPEGVNFASRNESSGHCAKCGGFIAKA 290

Query: 245 KDWLKYHIDAGRC 257
             +++ HI++G+C
Sbjct: 291 ATYVEDHIESGQC 303

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score =  111 bits (278), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 71/106 (66%), Gaps = 4/106 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWS----EDCRCHSSGEFSRKDTFRTHL 211
           + C YC + F++RGYLTRH+KKH   K + CP+++     D RCH+SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           K+ H +Y  G     RN S G CA C E F+  +++++ HI++G C
Sbjct: 220 KARHVLYSKGVKPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDC 265

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score =  109 bits (273), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWS----EDCRCHSSGEFSRKDTF 207
           D   + C YC + FK+RGYLTRH++KH   K F+CPY++    +  RCHS+G FSR+DTF
Sbjct: 118 DEEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTF 177

Query: 208 RTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           + HLKS HF++P       + +S G C  C   F++ + W+  H+   RC
Sbjct: 178 KIHLKSRHFIFPNDVKVPNKTHSGGNCKHCQGSFSDIETWINDHVGLRRC 227

>Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463W
           (REAL)
          Length = 516

 Score =  110 bits (274), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 4/106 (3%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWS----EDCRCHSSGEFSRKDTFRTHL 211
           + C YC + F++RGYLTRH+KKH   K + CP+++     D RCH+SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIRKAYHCPFFNCATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 212 KSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRC 257
           K+ H +Y  G     RN S G CA C E F   +++++ HI++G C
Sbjct: 220 KARHVLYSKGVKPQDRNKSSGHCAQCGEYFPVIENFVENHIESGDC 265

>Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375W
           (STP3) - Involved in pre-tRNA splicing [contig 72] FULL
          Length = 304

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 61/127 (48%), Gaps = 27/127 (21%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKD------------FRCPYWSE----DCR----- 194
           ++C  C   F     L RH K+H   +D            FRCPY S     D R     
Sbjct: 173 HKCPVCGRGFTRHNDLLRHRKRHWKDEDNSCSSYNPNQGTFRCPYKSRIAYPDSRSKGLA 232

Query: 195 ------CHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWL 248
                 CH++G+FSR DTF+ HL+++HF YP GT K  R +  G+C  C ++F +   WL
Sbjct: 233 SLGTTSCHATGKFSRCDTFKNHLRALHFEYPPGTRKKDRGHVPGKCKHCGQEFASVNTWL 292

Query: 249 KYHIDAG 255
             H+  G
Sbjct: 293 NTHVGKG 299

>KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa]
           {ON} Anc_4.222 YDL048C
          Length = 342

 Score = 73.2 bits (178), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 59/136 (43%), Gaps = 41/136 (30%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKD--------------------FRCPYWS----- 190
           +RC  C   F     L RH K+H  +KD                    F+CPY S     
Sbjct: 200 HRCPVCERGFARNNDLIRHKKRH--WKDEINVAGEHDQLKSLHQIKGTFKCPYNSTLIQL 257

Query: 191 --------------EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAA 236
                         E   CH +G FSR DTF+ HLK++HF YP GT K  RN   GRC  
Sbjct: 258 DMEIYPFKSKSLNFETSNCHQTGIFSRCDTFKNHLKALHFEYPPGTKKKDRNVVSGRCKH 317

Query: 237 CYEQFNNNKDWLKYHI 252
           C  +F+N + WL  H+
Sbjct: 318 CGLKFDNVEVWLSDHV 333

>NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4.222
          Length = 435

 Score = 72.4 bits (176), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 20/99 (20%)

Query: 174 HLKK-HMPYKDFRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKS 213
           HLK  H     ++CPY S                   E   CH SG FSR DTF+ HLK+
Sbjct: 328 HLKSLHQLSGAYKCPYNSTLIQLDMEMYPFKKQLINFETLNCHPSGIFSRGDTFKNHLKA 387

Query: 214 IHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHI 252
           +HF YP GT K +RN+  G C  C + F N + WL  H+
Sbjct: 388 LHFQYPAGTKKTERNSVPGNCKHCGKHFANVEVWLHDHV 426

>KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 558

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 59/140 (42%), Gaps = 45/140 (32%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKD----------------------FRCPYWS--- 190
           ++C  C   F     L RH K H  +KD                      ++CP+ S   
Sbjct: 411 FKCEVCSRGFARSNDLIRHKKLH--WKDDLNQESMDFVEKLKCLHELKGTYKCPFNSNLI 468

Query: 191 ------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVG 232
                             E   CHS+G FSR DTF+ HLK++HF YP GT K  R N  G
Sbjct: 469 NLDLKLKGSDMKTADLPFETSNCHSTGVFSRCDTFKNHLKALHFEYPPGTKKKDRANVAG 528

Query: 233 RCAACYEQFNNNKDWLKYHI 252
            C  C ++F + + WLK H+
Sbjct: 529 HCKHCGQKFESIETWLKDHV 548

>NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4.222
          Length = 489

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (64%)

Query: 191 EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKY 250
           E   CH SG FSR+DTF+ HLK++HF+YP GT K +RN   G C  C  +F+N   WL  
Sbjct: 419 EAIHCHKSGIFSRRDTFKNHLKALHFLYPPGTKKNERNKVPGTCKHCGMKFDNVDIWLSE 478

Query: 251 HI 252
           H+
Sbjct: 479 HV 480

>SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 358

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 191 EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKY 250
           E   CH++G FSR DTF+ HLK++HF YP GT K  R +  GRC  C E+F N   WL  
Sbjct: 288 ETSNCHATGIFSRCDTFKNHLKALHFEYPPGTKKKDRGSVHGRCKHCGEKFANVDIWLNE 347

Query: 251 HIDAGRC 257
           H+  G+C
Sbjct: 348 HV--GKC 352

>Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON}
           (17510..18712) [1203 nt, 401 aa]
          Length = 400

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 8/100 (8%)

Query: 154 AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
             ++C Y  +  K+   +  H KK  P K        E   CH++G FSR DT++ HLK+
Sbjct: 301 GTFKCPYNSTLIKLDMDIYPH-KKGTPLK-------FESSNCHATGVFSRCDTYKNHLKA 352

Query: 214 IHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHID 253
           +HF YP GT KA R+   G+C  C + F N   WLK HI+
Sbjct: 353 LHFEYPPGTKKANRSIVPGKCKHCGKNFPNVDVWLKTHIE 392

>KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON}
           Anc_4.222 YDL048C
          Length = 377

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%)

Query: 187 PYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKD 246
           P   E   CHS+G FSR DTF+ HLK++HF YP GT K +R    GRC  C  +F N   
Sbjct: 303 PLLFETSNCHSTGVFSRCDTFKNHLKALHFEYPPGTKKKERTVVPGRCRNCGVKFPNVDT 362

Query: 247 WLKYHI 252
           WL  H+
Sbjct: 363 WLTEHV 368

>KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q7LH06 Saccharomyces cerevisiae YDL048C STP4
           Protein involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 414

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%)

Query: 191 EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKY 250
           E   CH +G FSR DTF+ HLK++HF YP GT K  R++  GRC  C   F N  +WL  
Sbjct: 344 ETSECHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRSSVPGRCKQCGRHFANVGEWLSS 403

Query: 251 HI 252
           H+
Sbjct: 404 HV 405

>Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 aa]
           {ON} YLR375W (REAL)
          Length = 344

 Score = 68.9 bits (167), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 180 PYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYE 239
           PYK F+ P   E   CH +G FSR DTF+ HLK++HF YP GT K  RN   GRC  C  
Sbjct: 265 PYK-FK-PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNIVPGRCKHCGL 322

Query: 240 QFNNNKDWLKYHI 252
           +F N   WL  H+
Sbjct: 323 KFENVDVWLNEHV 335

>YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}
           STP3Zinc-finger protein of unknown function, possibly
           involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 343

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (57%)

Query: 187 PYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKD 246
           P   E   CH +G FSR DTF+ HLK++HF YP GT K  RN   GRC  C  +F N   
Sbjct: 269 PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFENVDV 328

Query: 247 WLKYHI 252
           WL  H+
Sbjct: 329 WLNEHV 334

>Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375W
           (REAL)
          Length = 341

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (57%)

Query: 187 PYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKD 246
           P   E   CH +G FSR DTF+ HLK++HF YP GT K  RN   GRC  C  +F N   
Sbjct: 267 PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFENVDV 326

Query: 247 WLKYHI 252
           WL  H+
Sbjct: 327 WLNEHV 332

>Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375W
           (REAL)
          Length = 344

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (57%)

Query: 187 PYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKD 246
           P   E   CH +G FSR DTF+ HLK++HF YP GT K  RN   GRC  C  +F N   
Sbjct: 270 PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFENVDV 329

Query: 247 WLKYHI 252
           WL  H+
Sbjct: 330 WLNEHV 335

>Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar to
           Ashbya gossypii AFR588W
          Length = 431

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 47/94 (50%), Gaps = 19/94 (20%)

Query: 178 HMPYKDFRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVY 218
           HM    ++CP+ S                   E   CH +G FSR DT++ HLK++HF Y
Sbjct: 329 HMIQGTYKCPFNSALIKLDMEIYPTKDRQLLFETSNCHITGVFSRCDTYKNHLKALHFEY 388

Query: 219 PVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHI 252
           P GT K +R N  GRC  C  +F+N   WL  HI
Sbjct: 389 PPGTKKRERANIHGRCKHCGMKFDNVDVWLNEHI 422

>TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {ON}
           Anc_4.222 YDL048C
          Length = 399

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 180 PYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYE 239
           PYK    P   E   CH +G FSR DTF+ HLK++HF YP GT K  R    GRC  C  
Sbjct: 320 PYKSK--PLNFETSSCHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRTVVAGRCKHCGI 377

Query: 240 QFNNNKDWLKYHI 252
           +F N   WL  H+
Sbjct: 378 KFANVDTWLNEHV 390

>TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa]
           {ON} Anc_4.222 YDL048C
          Length = 350

 Score = 67.0 bits (162), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 50/98 (51%), Gaps = 7/98 (7%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
            Y+C Y  S  ++   +  H   H+   +F      E   CH +G FSR DTF+ HLK++
Sbjct: 251 AYKCPYNSSLIQLDMEIYPHKINHLKL-NF------ETSNCHQTGVFSRCDTFKNHLKAL 303

Query: 215 HFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHI 252
           HF YP GT K  R    GRC  C  +F N   WLK H+
Sbjct: 304 HFEYPPGTKKKDRLLVSGRCKHCGLKFKNVDVWLKTHV 341

>TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.222
           YDL048C
          Length = 613

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 9/131 (6%)

Query: 122 SGDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPY 181
           + +S  +  ++ T  +V      Q  +       Y+C Y  +  K+   +        P+
Sbjct: 483 TSNSISSKNVNITGNNVNANTSDQLKSLHNIKGTYKCPYNSTLVKLDMEM-------YPF 535

Query: 182 KDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQF 241
           K     +  +   CH +G FSR DTF+ HLK++HF YP GT +  R  S G+C  C + F
Sbjct: 536 KAKSLNF--QTLNCHQTGVFSRCDTFKNHLKALHFEYPQGTKRKDRLFSSGKCKHCGQNF 593

Query: 242 NNNKDWLKYHI 252
            N   WL YH+
Sbjct: 594 PNVDVWLNYHV 604

>ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 343

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 180 PYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYE 239
           PYK    P   E   CH +G FSR DTF+ HLK++HF YP GT K  R+   GRC  C  
Sbjct: 264 PYKSK--PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRSVVPGRCKHCGL 321

Query: 240 QFNNNKDWLKYHI 252
           +F N   WL  HI
Sbjct: 322 RFANVDLWLNEHI 334

>TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {ON}
           Anc_4.222 YDL048C
          Length = 347

 Score = 66.6 bits (161), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 45/88 (51%), Gaps = 19/88 (21%)

Query: 184 FRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTK 224
           FRCP+ S                   +   CH +G FSR DT++ HLK++HF YP GT K
Sbjct: 251 FRCPFNSTLIKLDMELYSYKSMDLNFDTSNCHQTGIFSRCDTYKNHLKALHFEYPPGTKK 310

Query: 225 AQRNNSVGRCAACYEQFNNNKDWLKYHI 252
             R+   GRC  C ++F N   WLK H+
Sbjct: 311 VNRSAVAGRCRHCGKKFPNVNYWLKNHV 338

>AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR375W (STP3) and
           YDL048C (STP4)
          Length = 319

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (48%), Gaps = 19/94 (20%)

Query: 178 HMPYKDFRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVY 218
           HM    ++CP+ S                   E   CH +G FSR DT++ HLK++HF Y
Sbjct: 217 HMIQGTYKCPFNSTLIKLDMEIYPTKGRRLAFETSNCHITGVFSRCDTYKNHLKALHFEY 276

Query: 219 PVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHI 252
           P GT K +R    GRC  C  +F+N   WL  H+
Sbjct: 277 PPGTKKRERAKIHGRCKHCGMKFDNVDMWLNEHV 310

>Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON}
           YDL048C (REAL)
          Length = 503

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 43/91 (47%), Gaps = 19/91 (20%)

Query: 184 FRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTK 224
           F+CPY S                   E   CH +G FSR DTF+ HLK++HF YP  T K
Sbjct: 407 FKCPYNSTLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKK 466

Query: 225 AQRNNSVGRCAACYEQFNNNKDWLKYHIDAG 255
             R+   G+C  C  QF N   WL  H+  G
Sbjct: 467 EDRSIVPGKCKHCGLQFPNVDVWLNKHVGKG 497

>CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {ON}
           some similarities with uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3 or uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4
          Length = 451

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query: 180 PYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYE 239
           PYK     + +   +CH +G FSR DTF+ HLK++HF YP GT +++R+   G+C  C  
Sbjct: 372 PYKGKEVNFIT--TQCHKTGVFSRCDTFKNHLKALHFEYPQGTRRSERSFVSGKCKHCNM 429

Query: 240 QFNNNKDWLKYHI 252
            F N  +W+  H+
Sbjct: 430 SFANVDEWINEHV 442

>Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON}
           YDL048C (REAL)
          Length = 486

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 43/91 (47%), Gaps = 19/91 (20%)

Query: 184 FRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTK 224
           F+CPY S                   E   CH +G FSR DTF+ HLK++HF YP  T K
Sbjct: 390 FKCPYNSTLINLDMEVYPHKTQSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKK 449

Query: 225 AQRNNSVGRCAACYEQFNNNKDWLKYHIDAG 255
             R+   G+C  C  QF N   WL  H+  G
Sbjct: 450 EDRSIVPGKCKHCGLQFPNVDVWLNKHVGKG 480

>SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 227

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 187 PYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKD 246
           P ++ DC  H +G F+R DT++ HLK++HF YP G +K  R  S G C  C+  F +   
Sbjct: 149 PMYATDC--HKTGLFTRVDTYKYHLKALHFEYPDGISKQDREFSPGHCKHCHAHFPSVHA 206

Query: 247 WLKYHIDAGRC 257
           WL+ HI + +C
Sbjct: 207 WLQDHILSHKC 217

>Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON}
           YDL048C (REAL)
          Length = 489

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 42/91 (46%), Gaps = 19/91 (20%)

Query: 184 FRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTK 224
           F+CPY S                   E   CH +G FSR DTF+ HLK++HF YP  T K
Sbjct: 393 FKCPYNSTLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKK 452

Query: 225 AQRNNSVGRCAACYEQFNNNKDWLKYHIDAG 255
             R    G+C  C  QF N   WL  H+  G
Sbjct: 453 EDRGIVPGKCKHCGLQFPNVDVWLNKHVGKG 483

>YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}
           STP4Protein containing a Kruppel-type zinc-finger
           domain; has similarity to Stp1p, Stp2p, and Stp3p;
           predicted to be a transcription factor
          Length = 490

 Score = 64.3 bits (155), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 42/91 (46%), Gaps = 19/91 (20%)

Query: 184 FRCPYWS-------------------EDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTK 224
           F+CPY S                   E   CH +G FSR DTF+ HLK++HF YP  T K
Sbjct: 394 FKCPYNSTLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKK 453

Query: 225 AQRNNSVGRCAACYEQFNNNKDWLKYHIDAG 255
             R    G+C  C  QF N   WL  H+  G
Sbjct: 454 EDRGVVPGKCKHCGLQFPNVDVWLNKHVGKG 484

>CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some
           similarities with uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4 or uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3
          Length = 515

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%)

Query: 195 CHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHI 252
           CH +G FSR DTF+ HLK++HF YP  T + QR+   G+C  C  +F N   WL  H+
Sbjct: 448 CHPTGVFSRCDTFKNHLKALHFEYPQKTKREQRSQVPGKCKHCGMKFPNVDIWLNQHV 505

>NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222
          Length = 478

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 187 PYWSEDCR-----CHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQF 241
           PY S++       CH +G FSR DT++ HLK++HF YP  T K  R    G C  C  +F
Sbjct: 399 PYKSKNLNFTPLNCHQTGVFSRCDTYKNHLKALHFEYPPKTKKEDRAVMPGNCKHCGMKF 458

Query: 242 NNNKDWLKYHI 252
            N   WL  H+
Sbjct: 459 ENVDVWLNKHV 469

>NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa]
           {ON} Anc_4.222
          Length = 560

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 33/58 (56%)

Query: 195 CHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHI 252
           CH +G FSR DT++ HLK++HF YP  T K  R    GRC  C   F N   WL  H+
Sbjct: 494 CHQTGVFSRCDTYKNHLKALHFEYPPRTRKEDRGVVPGRCKHCGMGFVNVDVWLNKHV 551

>Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON}
           complement(4365..5300) [936 nt, 312 aa]
          Length = 311

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 10/99 (10%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           ++RC Y      +   L +H  K  P    +  Y      CHS+G F RKDT R HL++ 
Sbjct: 213 IFRCPYNEKLINIDLELYKH--KFQP----KTAYVKN---CHSTGLFLRKDTLRNHLRAH 263

Query: 215 HFVYPVGTTKAQRN-NSVGRCAACYEQFNNNKDWLKYHI 252
           HF Y   T   +++  S G C AC + F N   W   H+
Sbjct: 264 HFNYADLTLPKRKSITSPGNCGACGKWFENTTTWTDEHV 302

>TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 50/145 (34%), Gaps = 48/145 (33%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHM------------PYKD----------------FRCP 187
           + C  CP +F       RH K+H+             Y D                FRCP
Sbjct: 193 FHCDICPKSFSRNFDFLRHKKEHVQKALIQDVNSQDAYSDLTNKSKLTQLHNIGNVFRCP 252

Query: 188 Y-------------------WSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRN 228
           Y                    S+   CH +G F RKDT R HL+S HF Y       +  
Sbjct: 253 YNEKVIDLDLSLHKYKVKPASSQVANCHHNGMFFRKDTLRNHLRSHHFDYDKKELSVKEK 312

Query: 229 N-SVGRCAACYEQFNNNKDWLKYHI 252
             + GRC  C E   N K W   H+
Sbjct: 313 ACASGRCRFCNEWHENAKIWADEHV 337

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 148 TFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTF 207
           TF  ++AVY C  C  NFK R +L RHL  H   + + CP+      C S     R+D  
Sbjct: 380 TFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW------CLS--RHKRRDNL 431

Query: 208 RTHLKSIH 215
             H+K  H
Sbjct: 432 LQHMKLKH 439

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 34/152 (22%)

Query: 112 LSPCTQD--EQASGDSS-------DAPQISETPVDVAVEAPAQSPTFARDSAVYRCSY-- 160
           L+P + D  E ++GD S       +  Q+   P   A+    +S    R  + Y+CS+  
Sbjct: 577 LTPVSYDPSEGSTGDESVHVCKWANCSQVFPNPE--ALNNHIESQHIPRGQSSYQCSWDT 634

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPV 220
           C  +F  R  L RHLK H  YK F+CP        H + +FS +D  + H+++     P 
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKCP--------HCTKKFSTEDILQQHIRTHSGERPF 686

Query: 221 GTTKAQRNNSVGRCAACYEQFNNNKDWLKYHI 252
                       +C  C +QF  +   L+ HI
Sbjct: 687 ------------KCTYCTKQFATSSS-LRIHI 705

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           V++CSYC  +FK   +L RHL  H P + + CP+      C S  +  RKD    HLK  
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPW------CLS--KHKRKDNLLQHLKLK 610

Query: 215 H 215
           H
Sbjct: 611 H 611

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           +++C +C   FK + +L RHL  H   K + CP+      CHS     RKD    HLK  
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CHS--RHKRKDNLSQHLKLK 235

Query: 215 H 215
           H
Sbjct: 236 H 236

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 11/82 (13%)

Query: 138 VAVEAPAQSPTFAR---DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCR 194
           VA+ AP  +  F         YRCS C  +FK R +  RHL  H  +K + CP+      
Sbjct: 368 VALLAPMSNGPFGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW------ 421

Query: 195 CHSSGEFSRKDTFRTHLKSIHF 216
           C S     R+D    H+K+ H 
Sbjct: 422 CQS--RHKRRDNLFQHMKTKHV 441

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           +++C +C   FK + +L RHL  H   K + CP+      CHS     RKD    HLK  
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CHS--RHKRKDNLSQHLKLK 336

Query: 215 H 215
           H
Sbjct: 337 H 337

>KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {ON}
           Anc_4.214 YGR067C
          Length = 1010

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CSYC   F    + TRH + H  YK F+C    + C       F R+D  + H+K++H
Sbjct: 8   YICSYCAKAFSRSEHRTRHERSHTGYKPFQCKI-CQHC-------FVRRDLVQRHIKTVH 59

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 8/63 (12%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y+C  C   F+ + +L RHL  H   K F CP+ S   +        RKD    HLK  H
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHK--------RKDNLLQHLKLKH 357

Query: 216 FVY 218
             Y
Sbjct: 358 TQY 360

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           V++C  C  +FK + +L RHL  H P + F CP+      C S  +  RKD    H+K  
Sbjct: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW------CLS--KHKRKDNLLQHMKLK 184

Query: 215 HFVY 218
           H  Y
Sbjct: 185 HTDY 188

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           +YRCS C  +FK + +  RHL  H  +K + CP+      C S     R+D    H+K+ 
Sbjct: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW------CQS--RHKRRDNLFQHMKTK 438

Query: 215 HF 216
           H 
Sbjct: 439 HV 440

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 10/81 (12%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           ++ C  C  +F+ + +L RHL  H   + F CP+      C S     RKD    H+K  
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW------CLS--RHKRKDNLLQHMKLK 403

Query: 215 HFVYPVGTTKAQRNNSVGRCA 235
           H  Y V   + ++NN+V  C 
Sbjct: 404 HSNYLV--IELKKNNAVFSCV 422

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 11/77 (14%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           + C  C  +FK + +L RHL  H P + F CP+      C S  +  RKD    H+K  H
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW------CLS--KHKRKDNLLQHMKLKH 243

Query: 216 FVYPVGTTKAQRNNSVG 232
             Y     +  RN +VG
Sbjct: 244 TEY---VLEKLRNQNVG 257

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 110 VHLSP----CTQDEQASGDSSDAPQISETPVD-VAVEAPAQSPTFARDSAVYRCSYCPSN 164
           +HL P     T  +      S+ P ++  P + VA+ A   S +  R   +++C +C  +
Sbjct: 279 LHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHR--YIHQCQFCEKS 336

Query: 165 FKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVY 218
           FK + +L RHL  H   + F CP+      C S  +  RKD    H+K  H  Y
Sbjct: 337 FKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK--RKDNLLQHMKLKHTNY 382

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 33/78 (42%), Gaps = 8/78 (10%)

Query: 138 VAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHS 197
           VA+        F  +S  YRC  C   FK R +L RHL  H   + + CP+      C S
Sbjct: 382 VAIATILSMGEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW------CLS 435

Query: 198 SGEFSRKDTFRTHLKSIH 215
                R+D    H+K  H
Sbjct: 436 --RHKRRDNLLQHMKLKH 451

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 11/91 (12%)

Query: 142 APAQSPTFARDSA-VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGE 200
           AP   P  + D   +++C +C  +FK + +L RHL  H   + F CP+      C S  +
Sbjct: 312 APNAMPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK 365

Query: 201 FSRKDTFRTHLKSIHFVYPVGTTKAQRNNSV 231
             RKD    H+K  H  Y +   K  +NN +
Sbjct: 366 --RKDNLLQHMKLKHTNYLLDELK--KNNII 392

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C+ C   F   G+L RH + H   K+  CP+  E C+      FSR+D     +RTH 
Sbjct: 185 YLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPF--EGCK----QRFSRQDNCLQHYRTHF 238

Query: 212 KSIHFV 217
           K+  F 
Sbjct: 239 KNFTFT 244

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           +RC  CP  FK + +L RHL  H   + F CP+      C+S     R+D    H+K  H
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW------CNS--RHKRRDNLLQHMKLKH 585

Query: 216 F 216
            
Sbjct: 586 V 586

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 38/95 (40%), Gaps = 13/95 (13%)

Query: 126 SDAPQISETPVDV-----AVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMP 180
           SD P I+   V       A   P Q    A     ++C  C  +FK + +L RHL  H  
Sbjct: 223 SDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSS 282

Query: 181 YKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
            K F CP+      C S     RKD    H+K  H
Sbjct: 283 IKPFNCPW------CQS--RHKRKDNLLQHMKLKH 309

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 55/132 (41%), Gaps = 21/132 (15%)

Query: 107 LISVHLSPCTQDEQASGDSSDAPQISETP--VDVAVEAPAQS-------PTFARDSAVYR 157
           L+ +H  P  QD          PQ+ E P   +  +    +S       P+ + + A Y 
Sbjct: 208 LLQLHSEPLLQDM--------LPQMEEVPRLANPTIHRSKRSNLRYNSGPSISEEIAKYG 259

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK--SIH 215
           C +C   FK    L  H+  H   K + CPY  E+CR   + + +    ++ H K  S  
Sbjct: 260 CKHCNKRFKRPSSLNTHMNIHTGNKPYVCPY--EECRKSFNAKSNMLRHYKLHFKLNSGA 317

Query: 216 FVYPVGTTKAQR 227
           ++ P G   A++
Sbjct: 318 YILPNGEISAEK 329

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 11/75 (14%)

Query: 156 YRCS---YCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           ++C+    C  +F    +L RH++KH   K F+C    E C       FSR D  + H +
Sbjct: 20  FKCTGYGSCDMSFTRAEHLARHIRKHTGEKPFQC----EVCNRF----FSRIDNLKQHRE 71

Query: 213 SIHFVYPVGTTKAQR 227
           S+H++  + TT+++R
Sbjct: 72  SVHWIPTISTTRSKR 86

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           +++C +C  +FK + +L RHL  H   + F CP+      C S  +  RKD    H+K  
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK--RKDNLLQHMKLK 388

Query: 215 HFVYPVGTTKAQRNNSV 231
           H  Y +   K  +NN +
Sbjct: 389 HTNYLLDELK--KNNII 403

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 147 PTFARD-SAVYRCSYCPSNFKVRGYLTRH-LKKHMPYKDFRCPYWSEDCRCHSSGEFSRK 204
           P+   D S  + C YCP  FK + +L RH L  H+  K F CP   ++        FSR 
Sbjct: 390 PSLVDDPSKQFGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKN--------FSRS 441

Query: 205 DTFRTHLKS 213
           D    H+K+
Sbjct: 442 DNLNQHIKT 450

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 16/105 (15%)

Query: 128 APQISETPV-DVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRC 186
           AP  S  PV    V AP+    +     +++C +C  +FK + +L RHL  H   + F C
Sbjct: 322 APVPSSNPVASNLVPAPSSDHKY-----IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 376

Query: 187 PYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSV 231
           P+      C S  +  RKD    H+K  H  Y +   K  +NN +
Sbjct: 377 PW------CLSRQK--RKDNLLQHMKLKHTNYLLDELK--KNNII 411

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           +++C  C  +FK + +L RHL  H   ++F CP     C C S  +  RKD    HLK  
Sbjct: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----C-CLSKHK--RKDNLIQHLKLK 390

Query: 215 HFVY 218
           H  Y
Sbjct: 391 HLDY 394

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 149 FARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFR 208
           +  +  ++RC+ C   FK + +L RHL  H   + + CP+      C S  +  RKD   
Sbjct: 247 YMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW------CLS--KHKRKDNLL 298

Query: 209 THLKSIH 215
            H+K  H
Sbjct: 299 QHMKLKH 305

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 10/60 (16%)

Query: 156 YRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           Y+C +  C  +F  R  L RH+K H  YK F+CP        H S  FS +D    H+++
Sbjct: 516 YQCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKCP--------HCSKTFSTEDILSQHIRT 567

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/95 (17%), Positives = 39/95 (41%), Gaps = 20/95 (21%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           ++C +C   F     L++H++ H   + F+C +  +         F+   + R H+++  
Sbjct: 546 FKCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDK--------RFTTSSSLRIHIRTHT 597

Query: 216 FVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKY 250
              P+             C  C ++FN + +  K+
Sbjct: 598 GEKPLA------------CNVCGKRFNESSNLSKH 620

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 10/63 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K+  CP+  E C+      FSR+D     +RTH 
Sbjct: 172 YICKTCSKGFTTSGHLARHNRIHTGEKNHECPF--EGCQ----QRFSRQDNCLQHYRTHF 225

Query: 212 KSI 214
           KSI
Sbjct: 226 KSI 228

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 151 RDS-AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRT 209
           RD+ +VY+C  C  +F+   +L RHL  H   + + CP      +C S  +  RKD    
Sbjct: 381 RDTPSVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP------KCVS--KHKRKDNLLQ 432

Query: 210 HLKSIHFVY 218
           HLK  H  +
Sbjct: 433 HLKLKHTAF 441

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 13/95 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    + TRH + H   K F C        C  S  F R+D  + H++++H
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTV------CAHS--FVRRDLLQRHIRTVH 59

Query: 216 FVYPVGTTKAQRNN-----SVGRCAACYEQFNNNK 245
             + +  TK Q  +     S+G    C    +N++
Sbjct: 60  RTFLLQCTKEQEQHMVPGPSIGGNEICGSAVHNDR 94

>KAFR0H02210 Chr8 complement(420773..422704) [1932 bp, 643 aa] {ON}
           Anc_8.330 YLR135W
          Length = 643

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 32  FTGQPGRQHNLQIGGQGKDE----EANMAQLWDVLMGNDGLPAGAE--VQPLRAAEVPTL 85
              + GR+ N +I  + ++E      N+  L  VL  N  + + ++  ++P    +   +
Sbjct: 227 LVSEIGREENERIDAERRNEFDTPSLNILSLSQVLEDNTVVESSSQGSIEPEHQGKTEDI 286

Query: 86  RCSPEPSSLEEDMQGQFQYKDLISVHLSPCTQDE 119
             + EP+++  D++G    +DLI   +SP  +DE
Sbjct: 287 EAAAEPTTIISDIEGSSDSEDLIITQVSPAKKDE 320

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query: 150 ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRT 209
           A+    Y C  C   FK   +L RH   H   K+F C +    C    SG++ RKD    
Sbjct: 318 AKKIKFYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNW----C----SGKYKRKDNLVQ 369

Query: 210 HLKSIH 215
           H++  H
Sbjct: 370 HIRKKH 375

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           +++C  C  +FK R +L RHL  H   + + CP+      C S     RKD    H+K  
Sbjct: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW------CLS--RHKRKDNLLQHMKLK 486

Query: 215 HFVY 218
           H  Y
Sbjct: 487 HSNY 490

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 10/61 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           ++C  C   F   G+L+RH K H   K++ CP+  E C       FSR D     +RTHL
Sbjct: 212 FQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPH--ESC----GQRFSRHDNCIQHYRTHL 265

Query: 212 K 212
           K
Sbjct: 266 K 266

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 13/82 (15%)

Query: 129 PQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPY 188
           P+ S  P     + PA+          Y+C+YC   F    +L  H+K HM YK F C +
Sbjct: 458 PEDSNNP-----DKPAKPRKKRPKVKKYQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF 512

Query: 189 WSEDCRCHSSGEFSRKDTFRTH 210
             +         F++    RTH
Sbjct: 513 CGK--------RFTQAGNLRTH 526

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 10/59 (16%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
           C  C + F   G+L+RH + H   K+  CP+  E C    + +FSR D     +RTHLK
Sbjct: 212 CKICSTGFTTSGHLSRHNRIHTGEKNHSCPF--EGC----NQKFSRHDNCLQHYRTHLK 264

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 10/62 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K+  CP+  E C       FSR D     +RTHL
Sbjct: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPF--EGC----GQRFSRHDNCVQHYRTHL 153

Query: 212 KS 213
           K+
Sbjct: 154 KT 155

>KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8.130
           YPR022C
          Length = 1206

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 156 YRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYW--SEDCRCHSSGEFSRKDTFRTHL 211
           Y C +  C   F  + +L RH   H P + FRCPY   + D RC+ +  F RKD    H 
Sbjct: 70  YVCPHPDCNKTFSRQEHLARHKLNHWPKEIFRCPYVFPNTDIRCNKT--FVRKDLLGRHA 127

Query: 212 K 212
           K
Sbjct: 128 K 128

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 15/88 (17%)

Query: 127 DAPQISETPVDV--AVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           DAP I   P  +   VE P      +R    ++C YC   F    +L  H++ H+ YK F
Sbjct: 461 DAPSIIPPPSQLVGGVEKPK-----SRGVKQHKCPYCHKCFTQSTHLEVHVRSHIGYKPF 515

Query: 185 RCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           +C Y  +         F++    RTH++
Sbjct: 516 QCEYCGK--------RFTQGGNLRTHVR 535

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 6/61 (9%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y C  C   F  +G L  H+  H  YK F+C    +DC    +  F++    + H    H
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCKL--DDC----NKSFTQLGNMKAHQNRFH 596

Query: 216 F 216
            
Sbjct: 597 L 597

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 53/115 (46%), Gaps = 16/115 (13%)

Query: 107 LISVHLSPCTQDEQASGDSSDAPQISET------PVDVAVEAPAQSPT-FARDSAVYRCS 159
           +I+++ +  T +  A  + S+   +  T      P+ + ++   + P+ F   S ++ C 
Sbjct: 578 IININDTSTTTNTAAVTEDSNPIDVVTTSKNTNLPITIPLKTRGRKPSPFNDPSKIFICP 637

Query: 160 YCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           YC   FK + +L RH +  HM  K F C        C+   +FSR D    H+K+
Sbjct: 638 YCNRRFKRQEHLKRHNRSLHMGEKPFDCHI------CN--KKFSRSDNLAQHIKT 684

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 115 CTQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARD-SAVYRCSYCPSNFKVRGYLTR 173
            T DE  S D+  A +  ++ +    +   + P+   D +  + C YC   FK + +L R
Sbjct: 356 TTTDEATSQDNKPALKNKKSGISDTPKIRGRKPSLLDDGTKQFSCEYCDRRFKRQEHLKR 415

Query: 174 HLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           H++  H+  K F C      C  H    FSR D    H+K+
Sbjct: 416 HIRSLHICEKPFHCHI----CDKH----FSRSDNLNQHIKT 448

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 44/110 (40%), Gaps = 18/110 (16%)

Query: 115 CTQDEQASGDSS-DAPQISETPVDVAVEAPAQSPTFARDSAV-------YRCSYCPSNFK 166
            TQ    SG SS  +P IS   +      PA  P   +   +       + CS C   F 
Sbjct: 29  TTQYINVSGTSSRSSPTISPPVIGQKASTPATMPIPKKSRTIKTDRPRPFLCSICTRGFA 88

Query: 167 VRGYLTRHLKKHMPYKDFRCPYWSEDC-RCHSSGEFSRKDTFRTHLKSIH 215
            + +L RH + H   K F C +    C RC     F+R+D    H + +H
Sbjct: 89  RQEHLKRHQRAHTNEKPFLCAF----CGRC-----FARRDLVLRHQQKLH 129

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 10/64 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K+  CPY  + C    +  FSR D     +RTHL
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQHYRTHL 227

Query: 212 KSIH 215
           K  H
Sbjct: 228 KKEH 231

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 8/64 (12%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y+C++C   F   G L  H++ H   K F C + S+         FSRK     HL +  
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSK--------RFSRKGNLTAHLVTHE 467

Query: 216 FVYP 219
            V P
Sbjct: 468 KVRP 471

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 15/31 (48%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRC 186
           + C +C   F  +G LT HL  H   + F C
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVC 474

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 15/88 (17%)

Query: 127 DAPQISETPVDV--AVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           DAP I   P  +   VE P      +R    + C YC   F    +L  H++ H+ YK F
Sbjct: 465 DAPSIIPPPSQLVGGVEKPK-----SRGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPF 519

Query: 185 RCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           +C Y  +         F++    RTH++
Sbjct: 520 QCEYCGK--------RFTQGGNLRTHVR 539

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 25/61 (40%), Gaps = 6/61 (9%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y C  C   F  +G L  H+  H  +K F+C    +DC    +  F++    + H    H
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQCKL--DDC----NKSFTQLGNMKAHQNRFH 600

Query: 216 F 216
            
Sbjct: 601 L 601

>NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {ON}
           Anc_4.189
          Length = 412

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 10/102 (9%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           +RC++CP  F+       HL ++   ++F+CP+ +  C  H  G F R+   R H  + H
Sbjct: 270 HRCAHCPRRFRTLYEYAAHLDEYSIVREFKCPFKT--CPWHILG-FPRRSDLRRHCANQH 326

Query: 216 FVYPVGTTKAQRNNSVG-----RCAA--CYEQFNNNKDWLKY 250
                G  K + N   G      C    C ++FN N  + ++
Sbjct: 327 KENLTGQLKNKLNLKDGAYETKNCPNKYCPKKFNRNDAFARH 368

>SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 322

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 11/68 (16%)

Query: 155 VYRCSY---CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           V+RC+    C   F    +L RH++KH   K F+C        CH    FSR D  + H 
Sbjct: 21  VFRCTGYGDCHMTFTRAEHLARHIRKHTGEKPFQCDI------CHRF--FSRVDNLKQHK 72

Query: 212 KSIHFVYP 219
           +S+H + P
Sbjct: 73  ESVHSIIP 80

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 10/66 (15%)

Query: 149 FARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT 206
             R  + Y CS+  C   F  R  + RHLK H  YK ++CP      +C     FS  +T
Sbjct: 604 LPRGQSQYTCSWAGCGKTFTQRQKIARHLKVHTRYKPYKCP------QCQKC--FSSDET 655

Query: 207 FRTHLK 212
            + HL+
Sbjct: 656 LKQHLR 661

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           ++VYRC+ C   F+   +L RH   H   ++F CP+      C S  +  R+D    H+K
Sbjct: 116 TSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW------CKS--KHKRRDNLFKHIK 167

Query: 213 SIHF 216
             H 
Sbjct: 168 LKHM 171

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 37.0 bits (84), Expect = 0.052,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFV 217
           CS+C   F    + TRH + H   K F C   S     HS   F R+D  + H++++H +
Sbjct: 14  CSFCNKAFSRSEHKTRHERSHAGVKPFECQVCS-----HS---FVRRDLLQRHIRTVHRI 65

Query: 218 YPVGTTKA 225
             +  T A
Sbjct: 66  LLLRDTGA 73

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 37.0 bits (84), Expect = 0.052,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 10/96 (10%)

Query: 123 GDSSDAPQISETPVDVAVEA-PAQSPTFARDSA-VYRCSYCPSNFKVRGYLTRHLKKHMP 180
           G+ +++ Q S   +D+ ++  P +S     D      C  C   F  R +L RH + H  
Sbjct: 6   GNENNSLQNSTGKLDIPLQPIPKKSRIIKTDKPRPLLCPTCSRGFVRREHLKRHQRAHTK 65

Query: 181 YKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHF 216
            K F C +     RC     F+R+D    H   +HF
Sbjct: 66  EKPFVCVFCG---RC-----FARRDLIIRHQNKLHF 93

>NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {ON}
           
          Length = 263

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
           C  C   F   G+L+RH + H   K+  CPY  + C    + +FSR D     +RTHLK
Sbjct: 208 CKTCSMGFTTSGHLSRHNRIHTGEKNHSCPY--KGC----NQKFSRHDNCLQHYRTHLK 260

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 37.0 bits (84), Expect = 0.054,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    +  RH + H   K F C   S     HS   F R+D  + H++++H
Sbjct: 8   YICSFCAKPFSRSEHKARHERSHTGSKPFSCSICS-----HS---FVRRDLLQRHIRTVH 59

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 10/61 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C       G+L RH + H   K+  CPY  E C    +  FSR D     +RTHL
Sbjct: 301 YICRVCSKGLTTSGHLARHYRIHTGEKNHFCPY--EGC----NQRFSRHDNCIQHYRTHL 354

Query: 212 K 212
           K
Sbjct: 355 K 355

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 36.6 bits (83), Expect = 0.060,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 20/104 (19%)

Query: 109  SVHLSPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVR 168
            ++  SP +Q E+ +G S   P+ +E  +             + +  +Y C  C   F   
Sbjct: 962  TISPSPSSQTEEQTGQSQQPPKFTEDEI-----------IMSENGKIYVCLECKRQFTSG 1010

Query: 169  GYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
             +LTRH K  H   K   CP      +C    +F R+D    HL
Sbjct: 1011 HHLTRHKKSVHSGEKPHSCP------KC--GKKFKRRDHVLQHL 1046

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           + C  C   F   G+LTRH + H   K+  CP+  E C       FSR D     ++THL
Sbjct: 161 FECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPF--EGCNL----RFSRNDNSLQHYKTHL 214

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score = 35.8 bits (81), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           + A ++C  C   FK + +L RH+  H   + + CP+      C S     RKD    H+
Sbjct: 109 EMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPW------CIS--RHKRKDNLLQHM 160

Query: 212 KSIH 215
           K  H
Sbjct: 161 KLKH 164

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 36.6 bits (83), Expect = 0.068,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 46/116 (39%), Gaps = 14/116 (12%)

Query: 116 TQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARDSA-VYRCSYCPSNFKVRGYLTRH 174
           T     SGDSS     + TP    +  P +S     +    + CS C   F  + +L RH
Sbjct: 34  TASMTGSGDSSQ----TATPTPGLIPIPKKSRRIKTNKPRPFVCSTCTRGFVRQEHLKRH 89

Query: 175 LKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNS 230
            + H   K F C +     RC     F+R+D    H   +H    +GT+     NS
Sbjct: 90  QRSHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLHAAL-IGTSMDSYTNS 136

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 15/88 (17%)

Query: 127 DAPQISETPVDV--AVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           DAP I     ++   VE P      AR +  + C YC   F    +L  H++ H+ YK F
Sbjct: 477 DAPSIIPPASELVGGVEKPK-----ARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPF 531

Query: 185 RCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           +C Y  +         F++    RTH++
Sbjct: 532 QCEYCGK--------RFTQGGNLRTHVR 551

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 35.8 bits (81), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 10/61 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K+  CPY  + C    +  FSR D     +RTHL
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQHYRTHL 227

Query: 212 K 212
           K
Sbjct: 228 K 228

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           C  C   FK + +L RHL  H   ++F CP+      C S  +  RKD    H+K  H
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPW------CLS--KHKRKDNLLQHMKLKH 528

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 15/88 (17%)

Query: 127 DAPQISETPVDV--AVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           DAP I     ++   VE P      AR +  + C YC   F    +L  H++ H+ YK F
Sbjct: 460 DAPSIIPPASELVGGVEKPK-----ARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPF 514

Query: 185 RCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           +C Y  +         F++    RTH++
Sbjct: 515 QCEYCGK--------RFTQGGNLRTHVR 534

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 17/99 (17%)

Query: 112 LSPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYL 171
           LSP + D     +S  +P  S++P +     PAQ+P   +    + C YC   F    +L
Sbjct: 437 LSPISLDN----ESMASPMSSQSPNE---SFPAQTP--QQQQKKHECPYCHHKFAQTTHL 487

Query: 172 TRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTH 210
             H++ H+ YK F C +  +         F++    RTH
Sbjct: 488 EVHVRSHLGYKPFECQFCGK--------RFTQGGNLRTH 518

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    + TRH + H   K F C        C+ S  F R+D  + H++++H
Sbjct: 8   YICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV------CNHS--FVRRDLLQRHIRTVH 59

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 34.3 bits (77), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 35/88 (39%), Gaps = 10/88 (11%)

Query: 126 SDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFR 185
           S AP  S      AV  PA++P   R    Y+CS C   F     L  H+  H   + F 
Sbjct: 23  SSAPLTSAPQRPSAVPTPAEAPKLLR----YQCSRCLKVFTRSSALQSHILVHTGDRPFV 78

Query: 186 CPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           CP+ S       S  F+ K     H K+
Sbjct: 79  CPHSS------CSKSFNVKSNMNRHFKT 100

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 41/110 (37%), Gaps = 29/110 (26%)

Query: 126 SDAPQISETPVDVAVEAPAQSPTFARDSAV-------------------YRCSYCPSNFK 166
           S AP ++  P  V    PA+    A  +A                    Y C  C   F 
Sbjct: 152 SAAPSVASVPSAVLQRQPARVSAHAGAAATTLRSGNGKRTRSPVEQRRRYVCKICVKGFT 211

Query: 167 VRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
             G+L RH + H   K+  CP+  E C       FSR D     ++THL+
Sbjct: 212 TSGHLARHNRIHTGEKNHVCPH--EGC----GQRFSRHDNCVQHYKTHLR 255

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 35.4 bits (80), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 10/61 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K+  CPY  + C    +  FSR D     +RTHL
Sbjct: 175 YICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQHYRTHL 228

Query: 212 K 212
           K
Sbjct: 229 K 229

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 38/93 (40%), Gaps = 20/93 (21%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFV 217
           C +CP  F     L +H++ H   + F C Y    CR     +FS   + R H+++    
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY----CR----KQFSTSSSLRVHIRTHTGE 597

Query: 218 YPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKY 250
            P+             C  C ++FN + +  K+
Sbjct: 598 KPLS------------CTVCGKRFNESSNLSKH 618

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 35.4 bits (80), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 10/61 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K+  CPY  + C    +  FSR D     +RTHL
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQHYRTHL 227

Query: 212 K 212
           K
Sbjct: 228 K 228

>Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)
          Length = 631

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 10/88 (11%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPV 220
           C +  + R ++T HL+ H+P K F C      C    S +F R    + HLK IH     
Sbjct: 191 CTTKTEKRDHITSHLRVHVPLKPFGC----STC----SKKFKRPQDLKKHLK-IHLES-G 240

Query: 221 GTTKAQRNNSVGRCAACYEQFNNNKDWL 248
           G  K +R   +G         N++KD L
Sbjct: 241 GILKRKRGPKIGSKRTSKRNKNSSKDTL 268

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 13/82 (15%)

Query: 137 DVAVEAPAQSPTFARDSAVYRCSY---CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDC 193
           +VA   P +S +  R S  ++C+    C  +F    +L RH++KH   K F+CP   +  
Sbjct: 24  NVAGSTPKRSKSARRKS--FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLK-- 79

Query: 194 RCHSSGEFSRKDTFRTHLKSIH 215
                  FSR D  + H +S+H
Sbjct: 80  ------FFSRVDNLKQHRESVH 95

>KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {ON}
           Anc_4.214 YGR067C
          Length = 749

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    +  RH + H  YK F+C        C+ +  F R+D  + H+K++H
Sbjct: 8   YVCSFCAKAFSRSEHRIRHERSHTGYKPFQCNI------CNHA--FVRRDLVQRHIKTVH 59

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query: 138 VAVEAPAQSPTFARDSAVYRCSY---CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCR 194
           VA  AP +S +  R +  ++C+    C  +F    +L RH++KH   K F+CP   +   
Sbjct: 25  VAASAPKRSKSARRKT--FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLK--- 79

Query: 195 CHSSGEFSRKDTFRTHLKSIH 215
                 FSR D  + H +S+H
Sbjct: 80  -----FFSRVDNLKQHRESVH 95

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    +  RH + H   K F C    + CR H+   F R+D  + H++++H
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFEC----KVCR-HA---FVRRDLLQRHIRTVH 59

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 19/113 (16%)

Query: 108 ISVHLSPCTQDEQASGDSSDAPQISETPVDVAVEAP----AQSPTFARDSAVYRCSYCPS 163
           ++  LSP T    A+G++S AP+ +          P    A+SP   R    Y C  C  
Sbjct: 155 VTAALSPATAP--AAGETS-APRPASAMSSATTSRPTGKRARSPIEQRRR--YVCKTCVK 209

Query: 164 NFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
            F   G+L RH + H   K+  CP+     R      FSR D     ++THL+
Sbjct: 210 GFTTSGHLARHNRIHTGEKNHVCPHPGCGQR------FSRHDNCVQHYKTHLR 256

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           ++C  C   F   G+LTRH K H   K+ +CP+    C       FSR D     ++THL
Sbjct: 268 HQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPH--RGCNL----WFSRNDNSLQHYQTHL 321

Query: 212 K 212
           K
Sbjct: 322 K 322

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 35.4 bits (80), Expect = 0.14,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 151 RDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFR 208
           R    Y C +  C   FK R  + RHLK H  +K F+C   S   RC SS E +    +R
Sbjct: 865 RGKNSYECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCS---RCFSSKE-TLIQHYR 920

Query: 209 TH 210
           TH
Sbjct: 921 TH 922

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CSYC   F    +  RH + H   K F C    + CR HS   F R+D  + H++++H
Sbjct: 12  YICSYCGKPFSRSEHKARHERSHTGVKPFEC----KVCR-HS---FVRRDLLQRHIRTVH 63

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 35.0 bits (79), Expect = 0.20,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 8/58 (13%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           CSYC   F    +  RH + H   K + C             EF R+D  + H++++H
Sbjct: 11  CSYCNRAFSRSEHKARHERSHTGTKPYECKVCLR--------EFVRRDLLQRHIRTVH 60

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 15/88 (17%)

Query: 127 DAPQISETPVDV--AVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           D P +   P ++   VE P      AR    + C YC   F    +L  H++ H+ YK F
Sbjct: 514 DTPSLIPPPSELVGGVEKPK-----ARGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPF 568

Query: 185 RCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           +C Y  +         F++    RTH +
Sbjct: 569 QCEYCGK--------RFTQGGNLRTHTR 588

>TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8.130
           YPR022C
          Length = 1077

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 150 ARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTF 207
           A  S  ++C +  C  +F  + +L+RH   H P + F+C Y   +     +  F RKD  
Sbjct: 39  ASTSGRFKCPHPACDKSFTRQEHLSRHKLNHWPKEIFKCSYVFPNTGLACNRTFVRKDLL 98

Query: 208 RTHLK 212
             H+K
Sbjct: 99  ARHVK 103

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y C +C   F    + TRH + H   K F C   S     HS   F R+D  + H++++H
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCS-----HS---FVRRDLLQRHIRTVH 59

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 10/61 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           +RC  C   F   G+L RH + H   K+ RC +     R      FSR D     +RTHL
Sbjct: 193 HRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQR------FSRHDNCLQHYRTHL 246

Query: 212 K 212
           K
Sbjct: 247 K 247

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 54/145 (37%), Gaps = 31/145 (21%)

Query: 139 AVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSE------D 192
            VE P    T    S  ++C YC   F    +L  H++ H+ YK ++C Y  +      +
Sbjct: 501 GVEKPK---TLHEGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGN 557

Query: 193 CRCHS---SGE-----------FSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACY 238
            R H    +GE           FSRK     HL +   V P           +  C   +
Sbjct: 558 LRTHQRLHTGEKPYECELCDKKFSRKGNLAAHLLTHQKVKPFIC-------KLDNCNRSF 610

Query: 239 EQFNNNK-DWLKYHIDAGRCTEFKL 262
            Q  N K    ++H+D  +    KL
Sbjct: 611 TQLGNMKAHQNRFHLDTLKMLTTKL 635

>NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {ON}
           Anc_4.214
          Length = 1169

 Score = 35.0 bits (79), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 11/74 (14%)

Query: 142 APAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEF 201
           +P ++  F++    + CS+C   F    +  RH + H  +K ++C        C  S  F
Sbjct: 76  SPPKTGIFSKR---FICSFCAKAFSRSEHKIRHERSHTGFKPYKC------LLCDHS--F 124

Query: 202 SRKDTFRTHLKSIH 215
            R D    HLK++H
Sbjct: 125 VRSDLTIRHLKTVH 138

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 35.0 bits (79), Expect = 0.24,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           ++ CS C   F  + +LTRH + H   K    PY    C+     +FSR+D    H + I
Sbjct: 43  LFVCSICTRAFARQEHLTRHERSHTKEK----PYCCGLCQ----RKFSRRDLLLRHAQKI 94

Query: 215 H 215
           H
Sbjct: 95  H 95

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 34.7 bits (78), Expect = 0.25,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           ++ C +C   F  + +LTRH + H   K F C        C  +  F+R+D    H + I
Sbjct: 151 LFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNL------CFKN--FTRRDLLIRHAQKI 202

Query: 215 H 215
           H
Sbjct: 203 H 203

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 10/63 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K   CPY  E C       F+R D     ++THL
Sbjct: 402 YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPY--EGC----GQRFNRHDNCLQHYKTHL 455

Query: 212 KSI 214
           K +
Sbjct: 456 KRL 458

>Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)
          Length = 627

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPV 220
           C +  + R ++T HL+ H+P K F C   S+        +F R    + HLK IH     
Sbjct: 190 CSTKTEKRDHITSHLRVHVPLKPFGCSTCSK--------KFKRPQDLKKHLK-IHLEN-G 239

Query: 221 GTTKAQRNNSVGRCAACYEQFNNNKD 246
           G  K +R   +G   A  +   N KD
Sbjct: 240 GILKRKRGPKLGSKRASKKNKRNIKD 265

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
           C  C   F   G+L RH + H   K+  CPY  E C      +FSR D     +R H+K
Sbjct: 112 CRICYKGFTTSGHLARHNRIHTGEKNHECPY--EGC----DQKFSRHDNCIQHYRAHVK 164

>CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {ON}
           some similarities with uniprot|P38082 Saccharomyces
           cerevisiae YBR066c NRG2 or uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 314

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
           C  C + F   G+L+RH K H   K   CP+  E C    +  FSR D     +RTH K
Sbjct: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPH--EGC----NQSFSRHDNCLQHYRTHSK 306

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 34.7 bits (78), Expect = 0.29,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 10/89 (11%)

Query: 143 PAQSPTFARDSA-VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEF 201
           P +S T   D    Y C  C   F  + +L RH + H   K F C +     RC     F
Sbjct: 73  PKKSRTIKTDKPRPYLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCG---RC-----F 124

Query: 202 SRKDTFRTHLKSIH-FVYPVGTTKAQRNN 229
           +R+D    H   +H  +  + +T+A+ NN
Sbjct: 125 ARRDLVLRHQHKLHPTLISMESTEAKINN 153

>NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8.130
          Length = 1207

 Score = 34.7 bits (78), Expect = 0.30,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 2/73 (2%)

Query: 142 APAQSPTFARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSG 199
           AP Q       +  Y C +  C  +F  + +L+RH   H P + F CP+   +     + 
Sbjct: 28  APVQKSAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNK 87

Query: 200 EFSRKDTFRTHLK 212
            F RKD    H K
Sbjct: 88  TFVRKDLLIRHQK 100

>YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}
           NRG2Transcriptional repressor that mediates glucose
           repression and negatively regulates filamentous growth;
           has similarity to Nrg1p
          Length = 220

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 10/80 (12%)

Query: 135 PVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCR 194
           P    ++  +     A     + C  C + F   G+L+RH + H   K+  CP+  E C 
Sbjct: 132 PTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPH--EGC- 188

Query: 195 CHSSGEFSRKDT----FRTH 210
                 FSR D     +RTH
Sbjct: 189 ---GQRFSRHDNCNQHYRTH 205

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           ++C  C   F+    L  H   H  +K + CPY +    CH S  F+ K     H K +H
Sbjct: 208 FKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYEN----CHKS--FNAKSNMFRHYK-LH 260

Query: 216 FVYPVG 221
           F  P G
Sbjct: 261 FKLPSG 266

>Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 40/100 (40%), Gaps = 12/100 (12%)

Query: 117 QDEQASGDSSDA--PQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRH 174
           ++E  +   SD   P     P    ++      T A     + C  C + F   G+L+RH
Sbjct: 112 KEENIADGRSDIRDPNKVNHPTKAVMKLKPTKTTTAGQRTRHFCKICSTGFTTSGHLSRH 171

Query: 175 LKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTH 210
            + H   K+  CP+  E C       FSR D     +RTH
Sbjct: 172 NRIHTGEKNHICPH--EGC----GQRFSRHDNCNQHYRTH 205

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 9/95 (9%)

Query: 120 QASGDSSDAPQISETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKK-H 178
           Q  G+S   P ++           + S  F+ ++  ++C  C   F+   +L RH++  H
Sbjct: 729 QLKGNSQSPPLLNGQKATTTTAKRSVSYNFSDENKTFKCETCGKAFRRSEHLKRHIRSVH 788

Query: 179 MPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
              + F CP   +        +FSR D    H+K+
Sbjct: 789 SSERPFACPTCDK--------KFSRSDNLAQHIKT 815

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 13/81 (16%)

Query: 138 VAVEAPAQSPTFARDSAVYRCSY---CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCR 194
           VA   P +S +  R +  ++C+    C  +F    +L RH++KH   K F+CP   +   
Sbjct: 25  VAASTPKRSKSARRKT--FKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCPACLK--- 79

Query: 195 CHSSGEFSRKDTFRTHLKSIH 215
                 FSR D  + H +S+H
Sbjct: 80  -----FFSRVDNLKQHRESVH 95

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    +  RH + H   K F+C    + C+ HS   F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQC----QVCK-HS---FVRRDLLQRHIRTVH 59

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 10/67 (14%)

Query: 149 FARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT 206
             R  + Y C +  C   F  R  + RHLK H  YK F+C        C  S  FS +DT
Sbjct: 698 LPRGKSEYHCHWKGCCRKFTQRQKMVRHLKVHSGYKPFKCQV------CLKS--FSSEDT 749

Query: 207 FRTHLKS 213
              H+++
Sbjct: 750 LNQHMRT 756

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 11/69 (15%)

Query: 149 FARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT 206
             +  + Y C +  C   F  R  L RHLK H  YK ++CP      +C     FS +DT
Sbjct: 560 LTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCPQCQ---KC-----FSTEDT 611

Query: 207 FRTHLKSIH 215
              H K +H
Sbjct: 612 LNQH-KRVH 619

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 33.9 bits (76), Expect = 0.47,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           ++ CS C   F  + +LTRH + H   K    PY    C+     +FSR+D    H   I
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEK----PYCCGICQ----RKFSRRDLLLRHAHKI 168

Query: 215 H 215
           H
Sbjct: 169 H 169

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 34/85 (40%), Gaps = 14/85 (16%)

Query: 150 ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRT 209
           + D   Y C  C   FK    L+ H+  H  YK ++CP+      C  S  F+ K     
Sbjct: 272 STDKVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPF----SNCQKS--FNAKSNMLR 325

Query: 210 HLKSIHF-------VYPVGTTKAQR 227
           H K +HF       V P G    Q+
Sbjct: 326 HYK-LHFKLSSGVYVLPSGEITLQK 349

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 8/76 (10%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    +  RH + H   K F+C    + C+ HS   F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQC----QICK-HS---FVRRDLLQRHIRTVH 59

Query: 216 FVYPVGTTKAQRNNSV 231
             + + +  +  ++ V
Sbjct: 60  RSFLLSSCASMTDSKV 75

>TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.486
           YDR253C
          Length = 128

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 8/74 (10%)

Query: 141 EAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGE 200
           E   +S   + D   Y CS C   F+    L RH + H+P     C    +         
Sbjct: 33  ETKGESEKSSSDEKKYSCSKCKLEFRRTSDLRRHERTHLPVLPNICSQCGKG-------- 84

Query: 201 FSRKDTFRTHLKSI 214
           F+RKD  + H  ++
Sbjct: 85  FARKDALKRHSNTL 98

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 12/79 (15%)

Query: 138 VAVEAPAQSPTFARDSAV-YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRC 195
           +A +   + PT   D+   Y C YC   FK + +L RH++  H+  K    PY      C
Sbjct: 330 LAPKIRGRKPTLIPDNTKHYSCEYCERRFKRQEHLKRHIRSLHLGAK----PY-----TC 380

Query: 196 HS-SGEFSRKDTFRTHLKS 213
           H  + +FSR D    H K+
Sbjct: 381 HICARKFSRSDNLNQHTKT 399

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 29/70 (41%), Gaps = 7/70 (10%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           D   Y C+ C   FK    L  H+  H   K +RCP+ S  C    S  F+ K     H 
Sbjct: 266 DKIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHIS--C----SKAFNAKSNMLRHY 319

Query: 212 KSIHFVYPVG 221
           K +HF    G
Sbjct: 320 K-LHFKLNTG 328

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 14/87 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    +  RH + H   K F+C    + C+ HS   F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKMRHERSHAGVKPFQC----QICK-HS---FVRRDLLQRHIRTVH 59

Query: 216 FVYPVGT------TKAQRNNSVGRCAA 236
             + + +      +KA+   +VG  A 
Sbjct: 60  RTFLLSSCASMVESKAELPVTVGVGAV 86

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 11/63 (17%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSG-EFSRKDTFRTH 210
           S  + C +C   FK + +L RH++  HM  K F          CH  G +FSR D    H
Sbjct: 343 SKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPF---------DCHICGKKFSRSDNLNQH 393

Query: 211 LKS 213
           +K+
Sbjct: 394 IKT 396

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 18/97 (18%)

Query: 120 QASGDSSDAPQISETPVDVAVEAPAQSPTFARDSAV-YRCSYCPSNFKVRGYLTRHLKKH 178
           Q +G+SS A ++   P+      P +S T   D    + CS C   F  + +L RH + H
Sbjct: 4   QGAGNSSVAAKM---PI------PKKSRTIKTDRPRPFLCSICTRGFARQEHLKRHQRAH 54

Query: 179 MPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
              K F C +     RC     F+R+D    H + +H
Sbjct: 55  TNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 83

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 33.5 bits (75), Expect = 0.59,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 33/87 (37%), Gaps = 9/87 (10%)

Query: 130 QISETPVDVAVEAPAQS-PTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPY 188
           Q  + P+   V  P +S P        + CS C   F    +L RH   H   K F C +
Sbjct: 9   QAQKLPIPGTVPIPKKSRPIKTNKPRPFLCSICTRGFVRHEHLKRHKISHTNEKPFLCIF 68

Query: 189 WSEDCRCHSSGEFSRKDTFRTHLKSIH 215
                RC     F+RKD    H   +H
Sbjct: 69  CG---RC-----FARKDLVLRHQYKLH 87

>YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON}
           Putative protein of unknown function; contains a zinc
           finger motif similar to that of Adr1p
          Length = 804

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS+C   F    +  RH + H   K F+C    + C+ HS   F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQC----QVCK-HS---FVRRDLLQRHIRTVH 59

Query: 216 FVYPVGT 222
             + + +
Sbjct: 60  RTFLLSS 66

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 10/70 (14%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTH 210
           DS  Y C  C   FK   +L RH +  H+  + F C        CH    FSR D    H
Sbjct: 219 DSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFEC------SVCH--KRFSRNDNLNQH 270

Query: 211 LKSIHFVYPV 220
           ++ IH   P+
Sbjct: 271 VR-IHEQQPI 279

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 8/67 (11%)

Query: 144 AQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSR 203
            + P  A     + C YC   F    +L  H++ H+ YK F+C Y  +         F++
Sbjct: 496 VEKPKSAHGIKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGK--------RFTQ 547

Query: 204 KDTFRTH 210
               RTH
Sbjct: 548 GGNLRTH 554

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 15/76 (19%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS- 213
           ++C  C   F+   +L RH++  H   + F C Y  +        +FSR D    HLK+ 
Sbjct: 698 FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDK--------KFSRSDNLSQHLKTH 749

Query: 214 -----IHFVYPVGTTK 224
                I  V P+ T K
Sbjct: 750 RKHGDIKDVLPMPTMK 765

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 7/72 (9%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y C  C   F    +  RHLK H   K ++C Y   +C    S +FSR D    H K +H
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYL--NC----SKKFSRSDELNRHSK-VH 71

Query: 216 FVYPVGTTKAQR 227
                G+ K ++
Sbjct: 72  HSRANGSIKRKK 83

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 10/88 (11%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK--- 212
           ++C  C   F    +  RH++ H   K   CP       C+ S  FSR D  + H+K   
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILG----CNKS--FSRTDELKRHMKVHP 69

Query: 213 -SIHFVYPVGTTKAQRNNSVGRCAACYE 239
            S H ++   TT    +NS     +  +
Sbjct: 70  ASTHNLHSTSTTSLNISNSTMSMTSLLQ 97

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           S  + C +C   FK + +L RH++  HM  K    PY  E C      +FSR D    H+
Sbjct: 351 SKQFGCEFCDRRFKRQEHLKRHVRSLHMGEK----PYGCEIC----GKKFSRSDNLNQHI 402

Query: 212 KS 213
           K+
Sbjct: 403 KT 404

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           ++C YC   F    +L  H++ H+ YK F C +  +         F++    RTH++
Sbjct: 523 FQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGK--------RFTQGGNLRTHIR 571

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 144 AQSPTFARDSAV-YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEF 201
            + P+ A D+   + C YC   FK + +L RH++  HM  K    PY  + C      +F
Sbjct: 447 GRKPSPALDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEK----PYGCDIC----GKKF 498

Query: 202 SRKDTFRTHLKS 213
           SR D    H+K+
Sbjct: 499 SRSDNLNQHIKT 510

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSG-EFSRKDTFRTH 210
           S  + C YC   FK + +L RH++  H+  K    PY      CH  G +FSR D    H
Sbjct: 415 SKPFGCEYCDRRFKRQEHLKRHIRSLHICEK----PYG-----CHLCGKKFSRSDNLSQH 465

Query: 211 LKS 213
           LK+
Sbjct: 466 LKT 468

>TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {ON}
           Anc_1.326 YJL056C
          Length = 755

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 12/61 (19%)

Query: 156 YRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDC-RCHSSGEFSRKDTFRTHLK 212
           Y C +  C   F  R  L RHLK H  YK ++C    +DC +C     FS +DT   H +
Sbjct: 617 YHCHWHGCDKRFAQRQKLVRHLKVHSGYKPYKC----QDCGKC-----FSSEDTLTQHKR 667

Query: 213 S 213
           +
Sbjct: 668 T 668

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
           C  C   F   G+L+RH K H   K + CP+  E C       FSR D      +THL+
Sbjct: 160 CKVCTMAFTTSGHLSRHNKIHTGEKKYVCPF--EGC----GQRFSRHDNCVQHHKTHLR 212

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 33.1 bits (74), Expect = 0.86,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           + CS C   F  + +L RH + H   K F C +     RC     F+R+D    H   +H
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCG---RC-----FARRDLVLRHQHKLH 105

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 154 AVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           + Y+C +  C   F  +  L RHLK H  YK FRC   +E  +C     F+ +D    HL
Sbjct: 660 SSYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRC---AECGKC-----FNTQDILTQHL 711

Query: 212 K 212
           +
Sbjct: 712 R 712

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 39/95 (41%), Gaps = 20/95 (21%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           +RC+ C   F  +  LT+HL+ H   + F+C    +         +S   + R H+++  
Sbjct: 692 FRCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPK--------SYSTSSSLRIHIRTHT 743

Query: 216 FVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKY 250
              P+             C  C ++FN + +  K+
Sbjct: 744 GEKPLS------------CPICNKRFNESSNLAKH 766

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPY 188
            ++C  CP +F  + +L RHL  H   K F+C Y
Sbjct: 82  AFQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 115

>NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON}
           Anc_1.326
          Length = 773

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 156 YRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTH 210
           Y C +  C   F  R  L RH++ H  YK F+C      C+ H S E + K   RTH
Sbjct: 637 YECHWANCHKIFSQRQRLVRHMRVHSGYKPFQCSI----CKKHFSNEETLKQHERTH 689

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 9/62 (14%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           S  + C +C   FK + +L RH++  HM  K F C    +        +FSR D    H+
Sbjct: 337 SKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGK--------KFSRSDNLNQHV 388

Query: 212 KS 213
           K+
Sbjct: 389 KT 390

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----F 207
           D   +RC  C   F    +  RH++ H   K ++C   S++C    +  FSR D     F
Sbjct: 13  DRRPFRCEICSRGFHRLEHKKRHVRTHTGEKPYKCS--SKNC----TKSFSRSDELKRHF 66

Query: 208 RTHLKSI 214
           RTH +++
Sbjct: 67  RTHTRTV 73

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 33.1 bits (74), Expect = 0.92,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y C  C   F  + +L RH + H   K F C +     RC     F+R+D    H + +H
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCG---RC-----FARRDLILRHQRRLH 156

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSG-EFSRKDTFRTHLKS 213
           + C YC   FK + +L RH++  HM  K F          CH  G +FSR D    H+K+
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPF---------GCHICGKKFSRSDNLNQHIKT 553

>AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL230W and YMR182C
           (RGM1)
          Length = 409

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPV 220
           C  +F    +L RH++K    K  +C    E C    +  FSR D  + H +S+H +  +
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQC----EVC----NRFFSRIDNLKQHRESVHSIPTI 79

Query: 221 GTTKAQRNN 229
            TT+++R +
Sbjct: 80  STTRSKRQS 88

>KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.256
           YPL230W
          Length = 322

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 150 ARDSAVYRCSY---CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT 206
           AR +  + CS    C  +F    +L RH +KH   K F+C      CR +    FSR D 
Sbjct: 54  ARKTKPFVCSGFGDCNMSFTRAEHLARHTRKHTGEKPFQC----YICRKY----FSRVDN 105

Query: 207 FRTHLKSIH 215
            + H  S+H
Sbjct: 106 LKQHRDSVH 114

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 9/63 (14%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTH 210
           D   ++C  C   F+   +L RH++  H   + F C Y  +        +FSR D    H
Sbjct: 616 DEKPFKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDK--------KFSRSDNLSQH 667

Query: 211 LKS 213
           LK+
Sbjct: 668 LKT 670

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           + CSYC   F     L++HLK H  + DF
Sbjct: 649 FHCSYCDKKFSRSDNLSQHLKTHKKHGDF 677

>TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.281
           YBR066C
          Length = 175

 Score = 32.0 bits (71), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHLK 212
           C  C   F   G+L RH + H   K+  CP   E C    +  FSR D     +RTHL+
Sbjct: 121 CKVCSKGFTTSGHLARHNRIHTGEKNHFCPL--EGC----NQRFSRHDNCIQHYRTHLR 173

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y C  CP +F+   +L RH   H     F+C  W     C S  E  R+D    H+K  H
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKC-VW-----CKS--EHKRRDNMFKHMKLKH 301

Query: 216 F 216
            
Sbjct: 302 M 302

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 7/66 (10%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           Y CS C   FK    L+ H+  H   K F CP+   +C    +  F+ K     H K +H
Sbjct: 305 YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFT--NC----TKSFNAKSNMLRHYK-LH 357

Query: 216 FVYPVG 221
           F    G
Sbjct: 358 FKLSSG 363

>Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {ON}
           YPR186C (REAL)
          Length = 407

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPY 188
           ++C  CP +F  + +L RHL  H   K F+C Y
Sbjct: 80  FQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 112

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 8/65 (12%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           D+  ++CSYC      R  L RH   H   K F CP    D R      F +    R H+
Sbjct: 104 DTKPFQCSYCGKGVTTRQQLKRHEVTHT--KSFVCPEKGCDLR------FYKHPQLRAHI 155

Query: 212 KSIHF 216
            S+H 
Sbjct: 156 LSVHL 160

>KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {ON}
           Anc_4.189 YGR044C
          Length = 452

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPY 188
           YRC++CP  F        HL K+   ++F+CP+
Sbjct: 303 YRCAHCPIMFSTVFEYASHLDKYEIRREFKCPF 335

>CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {ON}
           weakly similar to uniprot|P33400 Saccharomyces
           cerevisiae YHL027w RIM101 meiotic regulatory protein
          Length = 584

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFV-YP 219
           C S  + R ++T HL+ H+P K F C        C  S  F R    + HLK IH     
Sbjct: 196 CTSKTEKRDHMTSHLRVHVPLKPFAC------STC--SKRFKRPQDLKKHLK-IHLSDLG 246

Query: 220 VGTTKAQRNNSVG 232
           +   K +R   VG
Sbjct: 247 IDAPKKKRGPKVG 259

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 53/128 (41%), Gaps = 13/128 (10%)

Query: 145 QSPTFARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCP-----YWSEDCRCHS 197
           +S    R  + Y+C +  C   F  R  L RHLK H  YK ++C      + SE+     
Sbjct: 725 ESVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQH 784

Query: 198 SGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGR---CAACYEQFNNNKDW---LKYH 251
           +   S +  ++ H+    F          R ++  +   C  C ++FN + +    +K H
Sbjct: 785 TRTHSGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH 844

Query: 252 IDAGRCTE 259
               +CT+
Sbjct: 845 KKKYKCTD 852

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 10/62 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C       G+L RH + H   K++ C +  E C      +FSR D     ++THL
Sbjct: 256 YICKVCSKGLTTSGHLARHYRIHTGEKNYSCLH--EGC----DQKFSRHDNCKQHYKTHL 309

Query: 212 KS 213
           K+
Sbjct: 310 KN 311

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 41/95 (43%), Gaps = 15/95 (15%)

Query: 140 VEAPAQSP-TFARDS--AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCH 196
           V A  Q P TFA D+    +RC +C   F    +  RH++ H   K   C +       H
Sbjct: 2   VVAMNQDPSTFAADNDERPFRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFP------H 55

Query: 197 SSGEFSRKDTF----RTHLKSIH--FVYPVGTTKA 225
               FSR+D      RTHL S +     P  TTKA
Sbjct: 56  CKKGFSRRDELKRHIRTHLGSSYRRIRKPTKTTKA 90

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           C  +F    +L RH++KH   K F+CP   +         FSR D  + H +S+H
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLK--------FFSRVDNLKQHRESVH 98

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 9/80 (11%)

Query: 137 DVAVEAPAQSPTFARDSAV-YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRC 195
           D  V  P +S T   D    + C  C   F  + +L RH + H   K F C +     RC
Sbjct: 60  DGIVPIPKKSRTIKTDKPRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCG---RC 116

Query: 196 HSSGEFSRKDTFRTHLKSIH 215
                F+R+D    H + +H
Sbjct: 117 -----FARRDLVLRHQQKLH 131

>KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 331

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 9/74 (12%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPV 220
           C   F  + +L RH++KH   + F+C              FSR D  + H++S+H V  +
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHLCLRF--------FSRLDNLKQHVESVHSVS-M 78

Query: 221 GTTKAQRNNSVGRC 234
            T++ + + S   C
Sbjct: 79  ATSQLKNSKSTAPC 92

>YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}
           RIM101Transcriptional repressor involved in response to
           pH and in cell wall construction; required for alkaline
           pH-stimulated haploid invasive growth and sporulation;
           activated by proteolytic processing; similar to A.
           nidulans PacC
          Length = 625

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 9/56 (16%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHF 216
           C +  + R ++T HL+ H+P K F C   S+        +F R    + HLK IH 
Sbjct: 189 CTTKTEKRDHITSHLRVHVPLKPFGCSTCSK--------KFKRPQDLKKHLK-IHL 235

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           S  + C +C   FK + +L RH++  HM  K F C   +++        FSR D    H+
Sbjct: 385 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQHV 436

Query: 212 KS 213
           K+
Sbjct: 437 KT 438

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           S  + C +C   FK + +L RH++  HM  K F C   +++        FSR D    H+
Sbjct: 386 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQHV 437

Query: 212 KS 213
           K+
Sbjct: 438 KT 439

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 17/112 (15%)

Query: 110 VHLSPCTQDEQASGDSSDAPQISETPVDVAVEA----PAQSPTFARDSAV-YRCSYCPSN 164
           V ++  +     SG + ++ ++  TP   A++     P +S T   D    + C  C   
Sbjct: 24  VQMTTASITPSNSGSALNSNEV--TPTSSAIQGIMPIPRKSRTIKTDKPRPFLCPICTRG 81

Query: 165 FKVRGYLTRHLKKHMPYKDFRCPYWSEDC-RCHSSGEFSRKDTFRTHLKSIH 215
           F  + +L RH + H   K F C +    C RC     F+R+D    H + +H
Sbjct: 82  FARQEHLKRHQRSHTNEKPFLCAF----CGRC-----FARRDLVLRHQQKLH 124

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           + C +C   FK + +L RH++  HM  K F C   +++        FSR D    H+K+
Sbjct: 395 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQHVKT 445

>Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTH 210
           C  C + F   G+L+RH + H   K+  CP+  E C       FSR D     +RTH
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPH--EGC----GQRFSRHDNCNQHYRTH 205

>Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)
          Length = 629

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 159 SYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHF 216
           S C +  + R ++T HL+ H+P K F C   S+        +F R    + HLK IH 
Sbjct: 187 SDCTTKTEKRDHITSHLRVHVPLKPFGCSTCSK--------KFKRPQDLKKHLK-IHL 235

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 32.3 bits (72), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 150 ARDSAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFR 208
           +++  VY C  C   F    +LTRH K  H   K F CP      +C     F R+D   
Sbjct: 775 SKNGKVYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCP------KC--GKRFKRRDHVL 826

Query: 209 THL 211
            HL
Sbjct: 827 QHL 829

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 9/62 (14%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           S  + C +C   FK + +L RH++  HM  K F C    +        +FSR D    H+
Sbjct: 255 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDK--------KFSRSDNLNQHI 306

Query: 212 KS 213
           K+
Sbjct: 307 KT 308

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           Y+C  C   F     L  HL  H   + FRCP+ S  C    S  F+ K     HLK+
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFAS--C----SKTFNVKSNMVRHLKT 179

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 20/99 (20%)

Query: 163 SNFKVRGY------------LTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTH 210
           +NFK  GY            L RH++KH   K F+C    + C       FSR D  + H
Sbjct: 17  NNFKCTGYGDCHMAFTRAEHLARHIRKHTGEKPFQC----DVCL----KRFSRVDNLKQH 68

Query: 211 LKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLK 249
            +S+H       +K     + GR     +   NN+++ K
Sbjct: 69  RESVHATVVNAASKNVPLVAKGRVEKPKKIILNNENFKK 107

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 32.3 bits (72), Expect = 1.5,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 45/116 (38%), Gaps = 20/116 (17%)

Query: 119 EQASGDSSDAPQISETPVDVAVEAPAQSPTFARDS-------AVYRCSYCPSNFKVRGYL 171
           EQ SGD      I  +  +      AQ+P F  D         VY C  C   F    +L
Sbjct: 724 EQPSGDGV---LIGNSSSNNNNNTNAQAPKFTSDEIIMSETGKVYVCLECKRQFTSGHHL 780

Query: 172 TRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL-KSIHFVYPVGTTKA 225
           TRH K  H   K   CP      +C    +F R+D    HL K I  V   G++ A
Sbjct: 781 TRHKKSVHSGEKPHSCP------KC--GKKFKRRDHVLQHLNKKIPCVPEEGSSNA 828

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211
           Y C  C   F   G+L RH + H   K  +C +   + R      FSR D     +RTH 
Sbjct: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQR------FSRHDNYIQHYRTHF 337

Query: 212 KS 213
           K+
Sbjct: 338 KN 339

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
            + C  C   F  + +L RHL+ H   K F+C    +D        F+R+D    H   +
Sbjct: 48  TFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKD--------FTRRDLLIRHSNKL 99

Query: 215 H 215
           H
Sbjct: 100 H 100

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 11/63 (17%)

Query: 156 YRC---SYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           YRC     C  +F    +L RH++KH   K F+C      C       FSR D  R H  
Sbjct: 19  YRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQC----NICL----KFFSRIDNLRQHQS 70

Query: 213 SIH 215
           S+H
Sbjct: 71  SVH 73

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 32.3 bits (72), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           ++CS C   F+   +L RH +  H   + F C + ++         FSR D    HLK+
Sbjct: 915 FKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTK--------RFSRSDNLSQHLKT 965

>TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4.21
           YHL027W
          Length = 541

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFV 217
           C +  + R ++T HL+ H+P K F C     +C    + +F R    + HLK IH  
Sbjct: 161 CQTKTEKRDHITSHLRVHIPLKPFNC----SNC----NKKFKRPQDLKKHLK-IHIT 208

>CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa]
           {ON} some similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044c
          Length = 547

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 44/106 (41%), Gaps = 11/106 (10%)

Query: 154 AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
            +YRC++CPS F        HL ++   +  +CP+  ++C     G   R+   R H   
Sbjct: 404 GLYRCAHCPSTFNNIFEYASHLDEYEVERKHKCPF--KNCAWRILG-LPRRSDLRRHCAI 460

Query: 214 IHFVYPVGTTKAQRNNS-----VGRCAA--CYEQFNNNKDWLKYHI 252
            H     G  K   N +     V RC    C ++F   KD  K HI
Sbjct: 461 QHKYELYGQLKKDLNLTEDAYPVLRCPVMFCQKEF-YRKDAYKRHI 505

>Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTH 210
           C  C + F   G+L+RH + H   K+  CP+  E C       FSR D     +RTH
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPH--EGC----GQRFSRHDNCNQHYRTH 205

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           ++C  C   F    +  RH++ H   K  RC + S    C  S  FSR D  + HL++
Sbjct: 17  FKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGS----CGKS--FSRSDELKRHLRT 68

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 43/111 (38%), Gaps = 17/111 (15%)

Query: 114 PCTQDEQASGDSSDAPQISETPVDVAVEA--------PAQSPTFARDSA-VYRCSYCPSN 164
           P  +D  A+  +   P +S  P  ++V          P +S T   D    + C  C   
Sbjct: 10  PIKRDLSATDHADRPPALSAPPCVISVAGDELQVLPIPKKSRTIKTDKPRPFLCHICTRG 69

Query: 165 FKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           F  + +L RH + H   K F C +     RC     F+R+D    H   +H
Sbjct: 70  FVRQEHLKRHQRAHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 112

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           ++C  C   F+   +L RH++  H   + F C Y  +        +FSR D    HLK+
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDK--------KFSRSDNLSQHLKT 554

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           S  + C +C   FK + +L RH++  HM  K F C   +++        FSR D    H+
Sbjct: 385 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQHV 436

Query: 212 KS 213
           K+
Sbjct: 437 KT 438

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 6/62 (9%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           D   +RC  C   F    +  RH++ H   K  +C + S    C  S  FSR D  + HL
Sbjct: 13  DQRPFRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQS----CPKS--FSRGDELKRHL 66

Query: 212 KS 213
           ++
Sbjct: 67  RT 68

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 144 AQSPTFARD-SAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHS-SGE 200
            + P+   D S  + C +C   FK + +L RH++  HM  K    PY      CH  + +
Sbjct: 251 GRKPSLVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEK----PY-----ECHICNKK 301

Query: 201 FSRKDTFRTHLKS 213
           FSR D    H+K+
Sbjct: 302 FSRSDNLNQHIKT 314

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKS 213
           ++C  C   F+   +L RH++  H   + F C Y  +        +FSR D    HLK+
Sbjct: 442 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDK--------KFSRSDNLSQHLKT 492

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           + CSYC   F     L++HLK H  + DF
Sbjct: 471 FHCSYCDKKFSRSDNLSQHLKTHKKHGDF 499

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 32.0 bits (71), Expect = 1.8,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 53/128 (41%), Gaps = 26/128 (20%)

Query: 156 YRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRK--------D 205
           Y+C +  C   F  R  + RHLK H  YK  +CP  +   +C S+ E  ++         
Sbjct: 708 YQCHWHGCSKKFTQRQKMVRHLKVHSGYKPCKCPVCN---KCFSNLETLKQHQRTHTGEK 764

Query: 206 TFRTHLKSIHFVYPVGTTKAQRNNSVG----RCAACYEQFNNNKDWLKYHIDAGRCTEFK 261
            F+ HL    F     + K       G    +C  C + FN + + L  HI     T FK
Sbjct: 765 PFQCHLCDKRFTI-ASSLKIHIRTHTGEKPLKCKICGKAFNESSN-LSKHIK----THFK 818

Query: 262 L---RQDE 266
           L   +QD+
Sbjct: 819 LISTKQDK 826

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 149 FARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT 206
             R  + Y+C +  C   F  R  L RHLK H  YK ++C       RC SS E   + T
Sbjct: 730 LTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCK---RCFSSEETLVQHT 786

Query: 207 FRTH 210
            RTH
Sbjct: 787 -RTH 789

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 8/65 (12%)

Query: 152 DSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHL 211
           D+  ++CSYC      R  L RH   H   K F CP    D R      F +    R H+
Sbjct: 104 DTKPFQCSYCGKGVTTRQQLKRHEVTHT--KSFVCPEDGCDLR------FYKHPQLRAHI 155

Query: 212 KSIHF 216
            S+H 
Sbjct: 156 LSVHL 160

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 149 FARDSAVYRCSY--CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT 206
             R  + Y+C +  C   F  R  L RHLK H  YK ++C       RC SS E   + T
Sbjct: 734 LTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCK---RCFSSEETLVQHT 790

Query: 207 FRTH 210
            RTH
Sbjct: 791 -RTH 793

>AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR253C (MET32) and
           YPL038W (MET31)
          Length = 227

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 31/82 (37%), Gaps = 8/82 (9%)

Query: 133 ETPVDVAVEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSED 192
           +T    A+E          D   + C+ C   F+  G L RH K H+P     C    + 
Sbjct: 124 KTSPGAALEVSGGPEETVNDGKRFHCTKCELVFRRSGDLRRHEKVHLPILPNICSLCGKG 183

Query: 193 CRCHSSGEFSRKDTFRTHLKSI 214
                   F+RKD  + H  ++
Sbjct: 184 --------FARKDALKRHFGTL 197

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 32.0 bits (71), Expect = 1.9,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 32/81 (39%), Gaps = 9/81 (11%)

Query: 136 VDVAVEAPAQSPTFARDSA-VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCR 194
           +D  +  P +S     D    + CS C   F  + +L RH   H   K F C +     R
Sbjct: 13  MDAPIPIPIKSRPIKTDKPRPFLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCG---R 69

Query: 195 CHSSGEFSRKDTFRTHLKSIH 215
           C     F+RKD    H   +H
Sbjct: 70  C-----FARKDLVLRHQYKLH 85

>NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {ON}
           Anc_4.214
          Length = 879

 Score = 32.0 bits (71), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 8/58 (13%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215
           CS+C   F    +  RH + H   K ++C   +  C       F R D    H+K++H
Sbjct: 17  CSFCAKGFSRAEHKIRHERSHTGLKPYKCKVCTH-C-------FVRSDLALRHIKTVH 66

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 32.0 bits (71), Expect = 2.0,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214
           ++ C  C   F  + +L RH + H   K + C   S+        +F+R+D    H + +
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSK--------KFTRRDLLIRHAQKV 166

Query: 215 H 215
           H
Sbjct: 167 H 167

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 32.0 bits (71), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 8/58 (13%)

Query: 153 SAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTH 210
           S  + C YC   F    +L  H++ H+ YK F+C +  +         F++    RTH
Sbjct: 597 SKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGK--------RFTQGGNLRTH 646

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 11/71 (15%)

Query: 146 SPTFARDSAV--YRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSSGEFS 202
           +P  A D  V  ++C  C   F+   +L RH++  H   + F C +  +        +FS
Sbjct: 515 TPMNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEK--------KFS 566

Query: 203 RKDTFRTHLKS 213
           R D    HLK+
Sbjct: 567 RSDNLSQHLKT 577

>NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON}
           Anc_3.518
          Length = 288

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 40/106 (37%), Gaps = 16/106 (15%)

Query: 148 TFARDS--AVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKD 205
           TFA D+    +RC  C   F    +  RH++ H   K   C +       H    FSR D
Sbjct: 7   TFAPDNFQRPFRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTF------AHCGKSFSRGD 60

Query: 206 TFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYH 251
             + H++ IH   P    +        + AA  +   NN   L  H
Sbjct: 61  ELKRHIR-IHLGLPSRRIR-------KKAAAKPQDIENNIPQLNIH 98

>Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON}
           (53205..55598) [2394 nt, 798 aa]
          Length = 797

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 10/55 (18%)

Query: 158 CSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK 212
           C  C   F     L +H K H  YK ++C        C SS  F+ KD F THLK
Sbjct: 735 CKVCGKKFSSSSNLNKHYKTH--YKKYKCQ------GCLSS--FTDKDKFETHLK 779

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 140 VEAPAQSPTFARDSAVYRCSYCPSNFKVRGYLTRHLKK-HMPYKDFRCPYWSEDCRCHSS 198
           V+  + SP        ++C+ C   FK   +L RH++  H   + + C +  ++      
Sbjct: 292 VKRNSISPQIIYSDKPFKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKN------ 345

Query: 199 GEFSRKDTFRTHLKS 213
             FSR D    HLK+
Sbjct: 346 --FSRSDNLSQHLKT 358

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDF 184
           Y C +C  NF     L++HLK H  + DF
Sbjct: 337 YHCQFCEKNFSRSDNLSQHLKTHKRHGDF 365

>Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON}
           (79397..80281) [885 nt, 295 aa]
          Length = 294

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 10/72 (13%)

Query: 161 CPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYP- 219
           C   F     L RH +KH   K F+C      C       FSR D  + H++S+H ++P 
Sbjct: 33  CSMEFTRSENLVRHRRKHTGEKPFQC----HVCL----KFFSRIDNLKQHIESVHGIHPA 84

Query: 220 -VGTTKAQRNNS 230
            V  TK    NS
Sbjct: 85  IVKRTKISAVNS 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,945,015
Number of extensions: 1419029
Number of successful extensions: 4125
Number of sequences better than 10.0: 404
Number of HSP's gapped: 4056
Number of HSP's successfully gapped: 440
Length of query: 274
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 166
Effective length of database: 41,097,471
Effective search space: 6822180186
Effective search space used: 6822180186
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)