Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR530W8.773ON45945924090.0
Ecym_14748.773ON45442615880.0
SAKL0B05412g8.773ON45142615640.0
NCAS0C008108.773ON45144515350.0
NDAI0K008408.773ON45942715340.0
YMR238W (DFG5)8.773ON45842415100.0
Suva_13.4228.773ON45842415040.0
Skud_13.4078.773ON45842414720.0
Smik_13.4468.773ON45842414650.0
CAGL0M05049g8.773ON45342614440.0
KAFR0B034908.773ON45142614420.0
TBLA0B033208.773ON45042614110.0
Kwal_55.202668.773ON45742914120.0
KNAG0J007008.773ON46342614060.0
KLLA0F24926g8.773ON45142414030.0
TDEL0B033608.773ON43642813860.0
Kpol_1030.208.773ON45142613840.0
ZYRO0F12210g8.773ON45342813780.0
TPHA0J016008.773ON46146113750.0
KLTH0E04048g8.773ON45442713640.0
ACL200WsingletonON46342413590.0
ACL201WsingletonON44842413500.0
NCAS0A08740singletonON43438812921e-176
ACL202WsingletonON45038212381e-168
TBLA0C03850singletonON56740211981e-160
NCAS0A08730singletonON63136711991e-159
NDAI0C006802.570ON45242011171e-149
SAKL0D13574g2.570ON45142011161e-149
YKL046C (DCW1)2.570ON44942611141e-149
Skud_11.1832.570ON44942611071e-148
Suva_11.1802.570ON45042011021e-147
Smik_11.2022.570ON44942611011e-147
NCAS0H029002.570ON45342610861e-145
KLTH0D08008g2.570ON44841710811e-144
TPHA0I024702.570ON45242510521e-139
KLLA0E07723g2.570ON45042110491e-139
Kwal_26.82252.570ON44942710441e-138
KAFR0I017402.570ON44842610401e-138
KAFR0A021702.570ON44941410391e-138
NDAI0B015102.570ON44741810361e-137
TBLA0H02590singletonON45042110201e-135
NCAS0A127502.570ON44742010191e-134
CAGL0L01727g2.570ON44641710161e-134
TDEL0B065802.570ON44742610151e-134
TBLA0H02580singletonON44941610141e-134
Ecym_45772.570ON45045010121e-133
KNAG0A071802.570ON46337910041e-132
TBLA0H026002.570ON4494179611e-126
ABR060W2.570ON4514309601e-126
Kpol_1056.42.570ON4504209421e-123
ZYRO0E06380g2.570ON4534199331e-121
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR530W
         (459 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   932   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   616   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   607   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   595   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   595   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   586   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   583   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   571   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   568   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   560   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   560   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   548   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   548   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   546   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   545   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   538   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   537   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   535   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   534   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   530   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   528   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   524   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            502   e-176
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   481   e-168
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              466   e-160
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            466   e-159
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   434   e-149
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   434   e-149
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   433   e-149
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   431   e-148
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   429   e-147
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   428   e-147
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    422   e-145
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   421   e-144
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   409   e-139
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   408   e-139
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   406   e-138
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   405   e-138
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   404   e-138
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   403   e-137
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   397   e-135
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   397   e-134
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   395   e-134
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   395   e-134
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   395   e-134
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   394   e-133
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            391   e-132
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   374   e-126
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   374   e-126
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   367   e-123
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   363   e-121

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/459 (97%), Positives = 447/459 (97%)

Query: 1   MYLSAGMTGLLVGLFLLMQGMXXXXXXXXXXXXEDVCHFTNEIQKGIMDYYWGSKYGGIV 60
           MYLSAGMTGLLVGLFLLMQGM            EDVCHFTNEIQKGIMDYYWGSKYGGIV
Sbjct: 1   MYLSAGMTGLLVGLFLLMQGMLSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIV 60

Query: 61  GMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGN 120
           GMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGN
Sbjct: 61  GMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGN 120

Query: 121 DDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQW 180
           DDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQW
Sbjct: 121 DDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQW 180

Query: 181 NNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGA 240
           NNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGA
Sbjct: 181 NNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGA 240

Query: 241 HIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMY 300
           HIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMY
Sbjct: 241 HIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMY 300

Query: 301 ERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHG 360
           ERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHG
Sbjct: 301 ERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHG 360

Query: 361 YTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDS 420
           YTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDS
Sbjct: 361 YTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDS 420

Query: 421 QPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
           QPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF
Sbjct: 421 QPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/426 (69%), Positives = 341/426 (80%), Gaps = 1/426 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +C  T +IQ+GIMDYYWGS  GGIVGMF  PYYWWEAG VF GMLENWYLCDN EY S
Sbjct: 30  DSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYLCDNMEYNS 89

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            L ESMIAQTG  +DYIP+NQS TEGNDDQG+W LFIMGAVERNF D +   +PGWLTM 
Sbjct: 90  TLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGNVPGWLTMA 149

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M ARWD+++CGGGLRWQIF WN GY YKNTIANGCLFQLAARLGRYTGN TYLD
Sbjct: 150 QAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRYTGNSTYLD 209

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           +A++ F WLVDVK++VL+D+A VFDGAHI +NC DIKGIEW+YNHG+IL G AYMYNAT 
Sbjct: 210 IANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILGGCAYMYNATN 269

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           G P WE+ + +IL GA  F+FR+ IMYERACQD   C+NDQRSFKSIFSRMLA+TSV+AP
Sbjct: 270 GDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSFKSIFSRMLAVTSVLAP 329

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
           FTR TID L+ ASA AA+ SC  G  G TCGL+W  G++DG YGLGEQASALE+IQN+LI
Sbjct: 330 FTRETIDPLLEASAAAAAASCSGGKDGETCGLDWTTGSWDGYYGLGEQASALEVIQNLLI 389

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
           HTKAPPLT + GG S G+P AGL       +L    NI  KDR+ A+LITA+ LGL++G 
Sbjct: 390 HTKAPPLTKNAGGTSNGDPGAGLG-TPMDNVLHSRLNIGSKDRIKAALITAVCLGLLVGT 448

Query: 454 ALWMIF 459
           ALWM+ 
Sbjct: 449 ALWMVI 454

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/426 (66%), Positives = 346/426 (81%), Gaps = 1/426 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +C+ T+ IQKG++DYY G+KYGG VGMFQPPYYWW+AGE FGGML+N YLCDN+ Y+ 
Sbjct: 27  DSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYLCDNETYKD 86

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           ++ ++MIAQTG+ +DYIPANQS  EGNDDQGVW + IMGAVERNF +P KEG+PGWL MV
Sbjct: 87  LIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEGVPGWLAMV 146

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M ARWD+++CGGGLRWQIF WN+GY YKNTIANGCLFQ+AARLGRYTGN TYL+
Sbjct: 147 QAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRYTGNDTYLE 206

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VASKV+ WL DV ++VL+DKA VFDGA+I  NCS I  IEW+YNHG++L GAAYMYNAT 
Sbjct: 207 VASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGGAAYMYNATN 266

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W++ +T++L GA +F+F + IMYERACQ   TC+NDQRSFKSIFSRML +TSV+AP
Sbjct: 267 GSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRMLGLTSVLAP 326

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
           FTR TID LI ASA  A++SC  GT G+TCGL+W  G +DG YGLGEQ SALEI+QN+LI
Sbjct: 327 FTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSALEIMQNLLI 386

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
                P TAD GG S G+P+AGL+  S   +L    +IT KDRVGA++ITAI LG+M+G 
Sbjct: 387 DDIPGPFTADNGGSSVGDPNAGLN-SSSANVLENNLSITHKDRVGAAIITAIVLGVMIGG 445

Query: 454 ALWMIF 459
           ++WM+F
Sbjct: 446 SVWMVF 451

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/445 (62%), Positives = 335/445 (75%), Gaps = 1/445 (0%)

Query: 15  FLLMQGMXXXXXXXXXXXXEDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGE 74
           F+L+  +            + +C  T  IQKG++DYY G +YGG VGMFQPPYYWW  G 
Sbjct: 8   FVLLLPLLVQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWNGGV 67

Query: 75  VFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAV 134
            FGGMLEN YLC+N  +ES+L ++++AQTGD +DYIP+NQS  EGNDDQGVW L IM AV
Sbjct: 68  AFGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIMDAV 127

Query: 135 ERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGC 194
           ERNF  P K G+PGWL M Q VFN M ARWD ++CGGGLRWQIF WN+GY YKNTIAN C
Sbjct: 128 ERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIANAC 187

Query: 195 LFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEW 254
           LFQ+AARLGRYTGNQTYLDVA KVF W+VD+ YIVL DKA VFDGA I ENC+DI  +EW
Sbjct: 188 LFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDITTLEW 247

Query: 255 SYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQ 314
           +YNHG++L G AYMYNAT GS  WE+ V KILAGA +++F+D +M E ACQ YNTC+NDQ
Sbjct: 248 TYNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNTCNNDQ 307

Query: 315 RSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDG 374
           R FKSIFSRML  TSV+APFT  TID LI ASA AA+ SC  G  G+TCGL+W KG+ DG
Sbjct: 308 RCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGSNDG 367

Query: 375 VYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGK 434
            YGLGEQ +ALEI+ N+LIH +  PLTA+TGG SEG+  AGL+  +   +L     IT  
Sbjct: 368 YYGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNS-TTTNVLENKLKITQG 426

Query: 435 DRVGASLITAISLGLMLGCALWMIF 459
           DR GA+++TA+ LG+ +G A+WM+F
Sbjct: 427 DRAGAAIVTAVILGIFVGGAVWMLF 451

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/427 (64%), Positives = 336/427 (78%), Gaps = 3/427 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E +C  T+ IQ G+MDYYWG++YGG VGMFQPPYYWWEAGE FGGM+ENWYLC N  YE 
Sbjct: 35  ESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMIENWYLCQNDTYED 94

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L+ +++AQTG  +DYIPANQS  EGNDDQGVW L +MGA ERNF DP+ +G PGWL M 
Sbjct: 95  MLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMGAAERNFTDPD-DGTPGWLAMT 153

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M ARWD+ +CGGGLRWQIF WN+GY YKNTI+N CLFQLAARLGRYTGN TYL+
Sbjct: 154 QAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISNACLFQLAARLGRYTGNTTYLE 213

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA KVF WLVDV Y++L+D A VFDGA I  NC+D+  IEW+YNHG++L GAAYMYNAT 
Sbjct: 214 VAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQIEWTYNHGVVLGGAAYMYNATN 273

Query: 274 GSPEWESHVTKILAGAADFYF-RDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVA 332
           GS +WES VTK+L GA  ++F  + IM+E ACQ+YNTC+NDQRSFKSIFSRML +TSV+A
Sbjct: 274 GSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYNTCNNDQRSFKSIFSRMLGLTSVLA 333

Query: 333 PFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVL 392
           PFT  T+D LI  SA AA+KSC  GT G+TCGLNW KG++DG YGLGEQ  ALE++QN+L
Sbjct: 334 PFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHDGYYGLGEQMCALEVMQNLL 393

Query: 393 IHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLG 452
           IH +  PLT +TGG S+G+  AGL+  +   +L     IT  DR GA+++TAI LG++ G
Sbjct: 394 IHDRPAPLTGNTGGSSKGDALAGLN-STTTNVLENKMTITNGDRAGAAIVTAIILGVLTG 452

Query: 453 CALWMIF 459
            A+WM F
Sbjct: 453 GAVWMFF 459

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/424 (63%), Positives = 331/424 (78%), Gaps = 2/424 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T  IQ G++DYY G++YGG VGMFQ PYYWW AGE FGGMLENW+LC+N  Y+ +L
Sbjct: 37  ICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELL 96

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++++AQTG  +DYIP+NQ+  EGNDDQG+W + +MGAVERNF DP  +G PGWL MVQ 
Sbjct: 97  YDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDP-GDGKPGWLAMVQA 155

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           VFN M +RWD+E+CGGGLRWQIF WN+GY YKNT++N CLFQ+AARLGRYTGN TYL+VA
Sbjct: 156 VFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVA 215

Query: 216 SKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGS 275
            +VF WLVDV Y+VL D A VFDGA I  NC+DI  IEW+YNHGI+L G AYMYNAT G+
Sbjct: 216 EQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGT 275

Query: 276 PEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFT 335
            EWE+ +TKIL GA  ++F+D IMYE ACQDY TC+ DQR+FKSIFSRML +TSV+APFT
Sbjct: 276 GEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFT 335

Query: 336 RGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHT 395
           R TID+LI  SA AA+KSC  GT G+TCGLNW K T DG YGLGEQ SALE+IQN+LIH 
Sbjct: 336 RDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHD 395

Query: 396 KAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCAL 455
           +  P   D GG S+G+ +AG++  S   +L+   NI   DR GA++ITA+ L ++ G A+
Sbjct: 396 RPAPYKEDNGGTSKGDANAGMNS-STTNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAV 454

Query: 456 WMIF 459
           WM+F
Sbjct: 455 WMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/424 (62%), Positives = 332/424 (78%), Gaps = 2/424 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T  IQ G++DYY G++YGG VGMFQ PYYWW AGE FGGM+ENWYLC N  Y+ +L
Sbjct: 37  ICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLL 96

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++++AQTG  +DYIPANQ+  EGNDDQG+W + +MGAVERNF +P+  G PGWL MVQ 
Sbjct: 97  YDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNPDN-GAPGWLAMVQA 155

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           VFN M +RWD+ENCGGGLRWQIF WN+GY YKNTI+N CLFQ+AARLGRYTGN TYLDVA
Sbjct: 156 VFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVA 215

Query: 216 SKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGS 275
            +VF WLVDV Y+VL D A V+DGA I  NC+DI  IEW+YNHGI+L G AYMYNAT G+
Sbjct: 216 EQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGT 275

Query: 276 PEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFT 335
            EW++ + ++L GAA ++F+D IMYE ACQDY TC+ DQR+FKSIFSRML +TSV+APFT
Sbjct: 276 SEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFT 335

Query: 336 RGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHT 395
             TID LI  SA AA+KSC+ GT G+TCGL+W K T DG YGLGEQ SALE+IQN+LIH 
Sbjct: 336 SDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHD 395

Query: 396 KAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCAL 455
           +  P   D GG S+G+ +AG++  S  ++L+   NIT  DR GA++ITA+ L +++G A+
Sbjct: 396 RPAPYKEDNGGTSKGDANAGMNS-STTSVLQNNLNITKGDRAGAAIITAVILSVLIGGAV 454

Query: 456 WMIF 459
           WM+F
Sbjct: 455 WMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/424 (63%), Positives = 334/424 (78%), Gaps = 2/424 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T  IQ G++DYY G++YGG VGMFQ PYYWW AGE FGGMLENW+LC+N+ Y+ +L
Sbjct: 37  ICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELL 96

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++++AQTG  +DYIPANQ+  EGNDDQG+W + +MGAVERNF DP+ EG PGWL MVQ 
Sbjct: 97  YDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPD-EGKPGWLAMVQA 155

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           VFN M +RWD+E+CGGGLRWQIF WN+GY YKNT++N CLFQ+AARLGRYTGN TYLDVA
Sbjct: 156 VFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVA 215

Query: 216 SKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGS 275
            +VF WLVDV Y+VL D A VFDGA I  NC+DI  IEW+YNHGI+L G AYMYNAT G+
Sbjct: 216 EQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGT 275

Query: 276 PEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFT 335
            EWE+ +T+IL GA  ++F+D IMYE ACQDY+TC+ DQR+FKSIFSRML +TSV+APFT
Sbjct: 276 SEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFT 335

Query: 336 RGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHT 395
             TID+LI  SA AA+KSC  GT G+TCGL+W K T+DG YGLGEQ SALE+IQN+LIH 
Sbjct: 336 SDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHD 395

Query: 396 KAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCAL 455
           +  P     GG S+G+ +AG++  S   +L+   NIT   R GA++ITAI L +++G A+
Sbjct: 396 RPAPYKESNGGTSKGDANAGMNS-STTNVLQNNLNITKGGRAGAAIITAIILSVLIGGAV 454

Query: 456 WMIF 459
           WM+F
Sbjct: 455 WMLF 458

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/424 (62%), Positives = 331/424 (78%), Gaps = 2/424 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T  IQ G++DYY G++YGG VGMFQ PYYWW AGE FGGMLENW+LC+N  Y+ +L
Sbjct: 37  ICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELL 96

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++++AQTG  +DYIPANQ+  EGNDDQG+W + +MGAVERNF DP  +G PGWL MVQ 
Sbjct: 97  YDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP-SDGKPGWLAMVQA 155

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           VFN M +RWD+E+CGGGLRWQIF WN+GY YKNTI+N CLFQ+AARLGRYTGN TYLDVA
Sbjct: 156 VFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVA 215

Query: 216 SKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGS 275
            +VF WLVDV Y+VL D A VFDGA I  NC+DI  IEW+YNHGI+L G AYMYNAT G+
Sbjct: 216 EQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGT 275

Query: 276 PEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFT 335
            EWE+ +TKIL GA  ++F+D IMYE ACQDY+TC+ DQR+FKSIFSRML +TSV+AP+T
Sbjct: 276 SEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYT 335

Query: 336 RGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHT 395
             TID+LI  SA AA+KSC+ G  G+TCGLNW K T DG YGLGEQ +ALE+IQN+LIH 
Sbjct: 336 SDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHD 395

Query: 396 KAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCAL 455
           +  P     GG S+G+ +AG++  S   +L+   NI   DR GA++ITAI L +++G A+
Sbjct: 396 RPAPYKESNGGTSKGDANAGMNS-STTNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAV 454

Query: 456 WMIF 459
           WM+F
Sbjct: 455 WMLF 458

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/426 (61%), Positives = 320/426 (75%), Gaps = 2/426 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +C  T  IQ G++DYY G++YGG VGMFQPPYYWW+AG  FGGMLENW+LC N  Y+ 
Sbjct: 30  DSICAATALIQGGMLDYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKD 89

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L  +++AQTG  +DYIPANQ+T EGNDDQGVW L I+ AVERNF  P  +G PGWL M 
Sbjct: 90  LLMNALVAQTGPNYDYIPANQTTVEGNDDQGVWGLTILDAVERNFSAP-IDGKPGWLAMS 148

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q +FN M ARWD ++C GGLRWQIF WN+GY YKNTI+N CLFQ+AARLGRYTGN TYLD
Sbjct: 149 QGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLD 208

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA +VF WLV V YIVL +K  V+DGA + +NC+DI  IEW+YNHG++L G AYMYNAT 
Sbjct: 209 VAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNATN 268

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W+S +T +L GA  ++F+D IMYE ACQ Y TC+NDQR FKSIFSRML  TSV+AP
Sbjct: 269 GSSVWQSRLTSVLGGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRMLGFTSVLAP 328

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
           FT  TID L+ ASA AA+ SC+ GT G+TCGL+W   T DG YGLGEQ SALE+IQ +LI
Sbjct: 329 FTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLI 388

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
           H +  P  AD GG S G+  AGL+  +   +L+    ITG DR GA+++T I LG+++G 
Sbjct: 389 HERPAPYRADNGGTSVGDAAAGLNS-TTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGG 447

Query: 454 ALWMIF 459
           A WM+F
Sbjct: 448 AAWMMF 453

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/426 (62%), Positives = 320/426 (75%), Gaps = 3/426 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T  IQ G++DYY G +YGG VGMFQ PYYWWEAGE FGGMLENW+LC+N  ++ ++
Sbjct: 27  ICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYWWEAGEAFGGMLENWFLCENDTFKEII 86

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++++AQTG  +D++P NQ+  EGNDDQ VW L IM AVERNF DP  +G PGWL M Q 
Sbjct: 87  YDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLTIMDAVERNFTDP-TDGSPGWLYMTQA 145

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           +FN+M +RWD+ NCGGGLRWQIF WN+GY YK+TI+N CLFQLA+RLGRYTGN TYLDVA
Sbjct: 146 IFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTISNVCLFQLASRLGRYTGNDTYLDVA 205

Query: 216 SKVFQWLVDVKYI-VLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGG 274
             V+ WLVDV +I V    A V+DGA I ENC+DI  I+WSYNHGI+L GAAY YNAT G
Sbjct: 206 ESVYDWLVDVGFINVANGTAYVYDGADISENCTDITTIDWSYNHGILLGGAAYAYNATNG 265

Query: 275 SPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPF 334
           S  WES VT I+ GA   +F D IMYE ACQDY+TC+NDQRSFKSIFSRML  TSV+APF
Sbjct: 266 SSVWESRVTDIVEGAKSIFFSDGIMYESACQDYDTCNNDQRSFKSIFSRMLGFTSVLAPF 325

Query: 335 TRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIH 394
           T  TID LI +SA A + SC+ GT G+TCGLNW   T DG YGLGEQ SALE+IQN+LIH
Sbjct: 326 TASTIDPLIKSSAAACALSCDGGTDGHTCGLNWQDKTCDGNYGLGEQMSALEVIQNLLIH 385

Query: 395 TKAPPLTADTGGQSEGNPDAGLDHDSQPA-ILRGMHNITGKDRVGASLITAISLGLMLGC 453
            +  P TA TGG S G+  AGL+  +  A +L     IT KDR GA++ITA+ LG M G 
Sbjct: 386 DRPAPYTASTGGSSVGDASAGLNTTTSSADVLENNLTITSKDRAGAAIITAVILGCMAGG 445

Query: 454 ALWMIF 459
           A+WM+F
Sbjct: 446 AIWMLF 451

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/426 (60%), Positives = 321/426 (75%), Gaps = 3/426 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E +C  T+ I KG++DYYWG++YGG VGMFQPPYYWWEAGE FGGMLENWYLC N  Y  
Sbjct: 28  ESICGATSLIIKGMLDYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMLENWYLCQNDTYAD 87

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L +++ AQTG  +DYIP NQ+  EGNDDQ +W L +M AVERNF +P  EG PGWL M 
Sbjct: 88  LLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIWGLTVMDAVERNFTNP-TEG-PGWLAMG 145

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M +RWDA +CGGGLRWQIF WN+GY YKNTI+N CLFQ+AARLGRYTGN TYLD
Sbjct: 146 QAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYKNTISNACLFQMAARLGRYTGNNTYLD 205

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA+ VF WL  V Y+ +++ A V+DGA I ENC+DI   +WSYN+G +L GAAYMYNAT 
Sbjct: 206 VANDVFDWLTGVGYVNMDNAAEVYDGADISENCTDITKYQWSYNNGCMLGGAAYMYNATN 265

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  WE+ VT++L GA  ++F+D IMYE ACQ   TC+NDQRSFKS+FSRML  TSV+ P
Sbjct: 266 GSSIWETRVTQLLNGAKAYFFQDDIMYESACQTAKTCNNDQRSFKSLFSRMLGFTSVLVP 325

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            TR  ID LI ASA  A+++C  GT G+TCGLNW   T+DG YGLGEQ SALE+IQN+LI
Sbjct: 326 STRDIIDPLILASAQGAARTCNGGTDGHTCGLNWQASTHDGYYGLGEQMSALEVIQNLLI 385

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
           H +  P T+  GG SEG+ +AGL+  S+  +   +   TG D+VGA+++TA  L +++G 
Sbjct: 386 HDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSNDLDIKTG-DKVGAAILTAGVLAILVGG 444

Query: 454 ALWMIF 459
           A+WM+F
Sbjct: 445 AIWMLF 450

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/429 (59%), Positives = 325/429 (75%), Gaps = 4/429 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +C  T+ IQKG+MDYY G+++GG VGMFQ PYYWWEAGEVFGGM+ENW+LC N  YE 
Sbjct: 30  DSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAGEVFGGMMENWFLCQNDTYEK 89

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            L ++MIAQ G  +D++P+NQS  EGNDDQGVW L +M AVERNF +P ++G+PGWL MV
Sbjct: 90  TLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSAVERNFTNPTEKGVPGWLAMV 149

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M +RWD+++CGGGLRWQIF WN+GY YKNT++N CLFQLAARLGRYTGN+TYL 
Sbjct: 150 QGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNACLFQLAARLGRYTGNETYLT 209

Query: 214 VASKVFQWLVDVKYIVLED--KARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNA 271
            A  V+ WLVD+ ++   +   A V+DGA I +NC+DI  IEWSYN GI+L GAAYMYNA
Sbjct: 210 KAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVEIEWSYNQGIVLGGAAYMYNA 269

Query: 272 T-GGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSV 330
           T  G+ +WES + +I+ G+ D +FR+KIMYE  CQD   C+ DQRSFKSIFSRML++T  
Sbjct: 270 THNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQDSGKCNQDQRSFKSIFSRMLSLTRT 329

Query: 331 VAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQN 390
           +AP+T   ID L+ ASA  A+KSC  GT G+TCGLNW KG +DG YGLGEQA ALE IQ+
Sbjct: 330 LAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGWYGLGEQACALEGIQS 389

Query: 391 VLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLM 450
            L   +  P TAD GG S G+ +AGL+  S   +L    NIT KD+VGAS+ITA+ L ++
Sbjct: 390 QLYSMRPAPYTADNGGTSVGDTEAGLNKTS-TNVLHSDLNITQKDKVGASIITAVLLAVL 448

Query: 451 LGCALWMIF 459
           +G ++WMIF
Sbjct: 449 VGGSIWMIF 457

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/426 (58%), Positives = 316/426 (74%), Gaps = 1/426 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + VC  T  +  G++DYY G++YGG VGMFQPPYYWW AGE FGGM+ENW+LC N  YE+
Sbjct: 39  DPVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTYET 98

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L ++ IAQTG+ +DYIP NQ+  EGNDDQG+W L IM AVERNF  P K+G+PGWL M 
Sbjct: 99  LLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLAMS 158

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M ARWD ++CGGGLRWQIF WN+GY YKNTI+N CLF LAARLGRYTGN TYLD
Sbjct: 159 QAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTYLD 218

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA +VF W+V V Y+VL D A VFDGA+I +NC+ I   EWSYNHG++L G A+MYNAT 
Sbjct: 219 VADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNATN 278

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  WE  V +IL GA  ++FRD IM+E ACQD   C+NDQR+FK+IFSRML+ T+V+ P
Sbjct: 279 GSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKAIFSRMLSFTAVLVP 338

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            T  TID L+ +SA AA++SC  GT G+TCGLNW    +DG+YGLGEQ SALE++  +L+
Sbjct: 339 STASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMNYLLV 398

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
           H +  P TA  GG S G+  AGL+  +       + NI GKD+ GA+++T + LG + G 
Sbjct: 399 HDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSL-NIRGKDKAGAAIVTTVILGTLAGG 457

Query: 454 ALWMIF 459
           ++WM+F
Sbjct: 458 SIWMLF 463

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 315/424 (74%), Gaps = 1/424 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T  IQ+GI DYY G  YGG VGMF  PYYWWEAG VFGGM+ENWYLC N  YE +L
Sbjct: 29  ICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWYLCQNTSYEDML 88

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++++AQTG  +DY+P+NQ+  EGNDDQGVWAL +M AVERNF +P+++G PGWL MVQ 
Sbjct: 89  YDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKEDGTPGWLAMVQA 148

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           VFN+M +RWD+++C GGLRWQIF WN+GY YKNTI+NGCLFQLAARLGRYTGN TYL+VA
Sbjct: 149 VFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGRYTGNTTYLEVA 208

Query: 216 SKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGS 275
            KVF WLVD+ ++V++++A VFDGA I +NC+ I   EWSYNHG++L G AYMYNAT GS
Sbjct: 209 EKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVLGGCAYMYNATNGS 268

Query: 276 PEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFT 335
             W++   +IL GA  F+F D IMYE  CQ  N C+ DQR FK+IFSRML  TSV+APFT
Sbjct: 269 DVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIFSRMLGYTSVLAPFT 328

Query: 336 RGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHT 395
             TI  LI  SA AA+KSC  GT G+TCGLNW  G +DG YGLGEQA ALEII  +L+H 
Sbjct: 329 TDTITPLIDTSAAAAAKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQACALEIINQLLVHD 388

Query: 396 KAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCAL 455
              PLT  TGG S G+  AGL+  S   +L+   NIT  D+ GA +IT I LG+++   +
Sbjct: 389 LPAPLTESTGGSSSGDASAGLNV-STTNVLQKNINITAGDKAGAGIITTIVLGVLVLGTV 447

Query: 456 WMIF 459
           WM+ 
Sbjct: 448 WMVL 451

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/428 (58%), Positives = 323/428 (75%), Gaps = 4/428 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +C+ T  IQKG++DYY G++ GG VGMFQ PYYWW+AGE FGGM++NWY C+N  +ES
Sbjct: 11  DSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYFCENTTFES 70

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           ++ + M+AQTG  +DY+P NQ+  EGNDDQGVW L +MGAVERNF +P   G PGWL M 
Sbjct: 71  LIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNP-TNGAPGWLAMA 129

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q +FN++ +RWD  NCGGGLRWQIF WN GY YKNTI+N CLFQ+AARLGRYTGN TYL+
Sbjct: 130 QAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRYTGNDTYLE 189

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA  VF WLVDV Y+VL+D   VFDGA I  NC+ I  +EWSYNHG++L G A+MYNAT 
Sbjct: 190 VAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGLAFMYNATN 249

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQ--DYNTCDNDQRSFKSIFSRMLAITSVV 331
           GS EWE+ VT+IL GA  ++F+D IMYE  CQ    +TC++DQRSFK+IFSRML +TSV+
Sbjct: 250 GSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSRMLGLTSVL 309

Query: 332 APFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNV 391
            P T+  +D+L+  SA AA+ SC  GT G+TCGLNW+K   DG YGLGEQ SALE++Q +
Sbjct: 310 VPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMSALEVMQQL 369

Query: 392 LIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLML 451
           LIH KA P T  TGG S G+ +AGL+  S   +L+   +I  KDR GA++ITA+ L +++
Sbjct: 370 LIHQKAAPFTEQTGGSSAGDANAGLNT-SSANVLQNQLDIQTKDRAGAAIITAVILMVLV 428

Query: 452 GCALWMIF 459
           G ++WM+F
Sbjct: 429 GGSIWMLF 436

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/426 (58%), Positives = 320/426 (75%), Gaps = 3/426 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +C  T+ IQ G++DYY G++YGG VGMFQPPYYWWEAGE FGGM+ENW+LC N  Y  
Sbjct: 29  DSICAATSLIQGGMLDYYEGTRYGGTVGMFQPPYYWWEAGEAFGGMIENWFLCQNDTYHD 88

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           ++ ++++AQTG  +DY+PANQ+  E    + V+   +M A ERNF  P  +G P WL M 
Sbjct: 89  IIYDALLAQTGSNYDYVPANQTFVEVMMIK-VFGGTVMDAAERNFTAPS-DGKPDWLAMA 146

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M ARWD+ NCGGGLRWQI+ WN+GY YKNT++N CLFQ+AARLGRYTGN TYL+
Sbjct: 147 QAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYKNTVSNACLFQIAARLGRYTGNDTYLE 206

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA KVF WLVDV ++VL D+A VFDGA+I  NCS +  +EWSYNHGI+L G AYMYNAT 
Sbjct: 207 VAEKVFDWLVDVNFVVLNDEANVFDGANITSNCSAVVKLEWSYNHGIVLGGLAYMYNATN 266

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           G+ +WES +TK+L GA   +F++ IMYE+ACQD+NTC+ DQRSFKSIFSRML +TSV+AP
Sbjct: 267 GTSKWESGLTKVLNGAKSIFFKNNIMYEQACQDHNTCNTDQRSFKSIFSRMLGLTSVLAP 326

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
           +T  TI  LI ASA  A+KSC+ GT G+TCGLNW+ GT DG YGLGEQ  ALEI+ N+LI
Sbjct: 327 YTSDTITPLIQASAEGAAKSCDGGTDGHTCGLNWNLGTNDGKYGLGEQMCALEIMSNLLI 386

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
             +  P T   GG S G+P AGL+  S  ++L    +I  KDR GA+++TA+ L ++LG 
Sbjct: 387 LNRPAPYTMHNGGTSVGDPSAGLNATST-SVLSNNLDIKQKDRAGAAIVTAVILFVLLGG 445

Query: 454 ALWMIF 459
           ++WM+F
Sbjct: 446 SVWMLF 451

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/428 (57%), Positives = 318/428 (74%), Gaps = 4/428 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + VC  T  IQ+G++DYY G KYGG +GMFQPPYYWW+AGE FGGM++NW+ C N  +E 
Sbjct: 28  DSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWHFCKNNTFEE 87

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           ++RE+M+ Q G  +DY+P NQ+  EGNDDQGVW L +M AVERNF DP  +G PGWL M 
Sbjct: 88  LIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDP-GDGKPGWLAMA 146

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN++  RWD ++C GG+RWQIF WN+GY YKNTI+NGC FQLAARLGRYT NQTYL+
Sbjct: 147 QAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRYTNNQTYLE 206

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA KVF WL DV ++VL+DK  VFDGA   +NC+ +  +EW+YNHGIIL G+AYMYNAT 
Sbjct: 207 VAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGSAYMYNATN 266

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQ--DYNTCDNDQRSFKSIFSRMLAITSVV 331
           GS +WE  V +IL GA+D++F+D +MYE  CQ  D + C+NDQRSFKSIFSRML +TSV+
Sbjct: 267 GSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSRMLGLTSVL 326

Query: 332 APFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNV 391
            P     +D+L+ ASA  A+KSC  G  G+TCGLNW KG++D  YGLGEQ SALE+IQN 
Sbjct: 327 VPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMSALEVIQNT 386

Query: 392 LIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLML 451
           LIH   PP    TGG S+G+  AGL+  +   +L+    I  KDR GA++IT + L +++
Sbjct: 387 LIHNSDPPYRESTGGSSKGDSAAGLNT-TTTNVLQKKLKIQSKDRAGAAIITGVVLMVVV 445

Query: 452 GCALWMIF 459
           G ++WM+F
Sbjct: 446 GGSVWMLF 453

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/461 (55%), Positives = 330/461 (71%), Gaps = 15/461 (3%)

Query: 11  LVGLFLLMQGMXXXXXXXXXXXXEDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWW 70
           L  L L+ Q +            + VC  T  IQKG++DYY G++YGG VGMFQPPYYWW
Sbjct: 4   LTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWW 63

Query: 71  EAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFI 130
           EAGE FGGMLENWYLC N  +ES++ +++I Q G  +DYIP+NQ+  EGNDDQGVW L +
Sbjct: 64  EAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTV 123

Query: 131 MGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTI 190
           +GAVERN   P+++G+PGWL + Q VFN M ARWD   CGGGLRWQI+ WN+GY YKNTI
Sbjct: 124 LGAVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTI 181

Query: 191 ANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIK 250
           +N CLFQ+AARLGRYTGN TYL+VA KVF W+VDV+YIVL+D A V+DGA  + NCSDI 
Sbjct: 182 SNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIV 241

Query: 251 GIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTC 310
             EWSYNHG++L G AYMYNAT G+ +WE+ +T++L+GA  ++F++ IMYE ACQ+  TC
Sbjct: 242 QYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTC 301

Query: 311 DNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKG 370
           + DQRSFKSIFSRML  T V+AP+T  T+D LI  SA AA+ SC+ GT G TCGL+W   
Sbjct: 302 NTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDS 361

Query: 371 TYDGVYGLGEQASALEIIQNVLI------------HTKAPPLTADTGGQSEGNPDAGLDH 418
           T DG YGLGEQ SALEII  +L+             + + P T+ +GG S G+  AGL+ 
Sbjct: 362 TNDGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNT 421

Query: 419 DSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
            S   +L+   +I  KD+ GA++ TA+ L +++G ++WM+F
Sbjct: 422 TSTN-VLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/427 (58%), Positives = 319/427 (74%), Gaps = 4/427 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T+ IQ GIMDYY G++ GG VGMFQ PYYWWEAGEVFGGMLENW+LC N  Y  ++
Sbjct: 29  ICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFLCQNDTYHDII 88

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++MI Q G  +D++P+NQS  EGNDDQGVW L +M A ERNF +P ++G+PGWL M Q 
Sbjct: 89  YDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDGVPGWLAMAQG 148

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           VFN M  RWD+E+CGGG+RWQIF WN+GY YKNT++N C+FQLAARLGRYTGN TYL  A
Sbjct: 149 VFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRYTGNDTYLTKA 208

Query: 216 SKVFQWLVDVKYIVLED--KARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNAT- 272
             V+ WLVDV ++VL +   A V+DGA+I +NC+DI   EWSYN GI+L GAAYMYNAT 
Sbjct: 209 ETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLGGAAYMYNATQ 268

Query: 273 GGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVA 332
             +  W+S + +I+ G+ +F+F+DK+MYE  CQD  TC+ DQRSFKSIFSRML++T  +A
Sbjct: 269 NDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFSRMLSLTRSLA 328

Query: 333 PFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVL 392
           P+T  TID L+ ASA  A+KSC  GT G+TCGLNW  G +DG YGLGEQA ALE IQ+++
Sbjct: 329 PYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQACALEGIQSLM 388

Query: 393 IHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLG 452
              +  P T+D GG S G+ +A L+  S   +L+    IT KD+VGAS+ITA+ L +++G
Sbjct: 389 YSKRPAPYTSDNGGSSVGDTEAALNSTS-TNVLQSDIKITHKDKVGASIITAVILAVLVG 447

Query: 453 CALWMIF 459
            ++WMIF
Sbjct: 448 GSIWMIF 454

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/424 (58%), Positives = 302/424 (71%), Gaps = 1/424 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E +C  T  IQ GI+DYY G + GG VG FQ PYYWW AGE FGGM+ENWYLC+N EY+ 
Sbjct: 39  ESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYYWWMAGEAFGGMVENWYLCNNTEYQD 98

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L ++M++Q G+  DY+P++Q   EGNDDQG+W L +MGA ERNF D   E  PGWL + 
Sbjct: 99  LLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGLLVMGAAERNFPDAPPERAPGWLALA 158

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M ARWD ENCGGGLRWQIF WNNGY YKNTI+N CLFQ+AARL R+TGN TY D
Sbjct: 159 QAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNTISNACLFQIAARLARFTGNSTYQD 218

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA  VF WLVD K + LE+ A+V DGAHI E C D   +EW+YNHG++LAG AYMYN T 
Sbjct: 219 VAETVFDWLVDSKLVQLENDAKVLDGAHISERCEDHSKLEWTYNHGVVLAGCAYMYNITN 278

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W   + K+L G+   +F + I+YERACQD   C++DQRSF+SIFSRMLA+TSV+AP
Sbjct: 279 GSAVWGDRLNKVLNGSL-LFFPNGILYERACQDVQKCNDDQRSFRSIFSRMLALTSVLAP 337

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            T+  I+  I  SA AA+KSC  G  G+TCG+ W   T+DG YGLGEQ SALEIIQN LI
Sbjct: 338 HTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQLSALEIIQNTLI 397

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
           HTK PP TA+ G +S+G+P AGL  +S   I      I  KDRVGA  +T + L   +  
Sbjct: 398 HTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLSTRQIGLKDRVGAGFMTVVLLIPFITG 457

Query: 454 ALWM 457
           ++WM
Sbjct: 458 SIWM 461

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/424 (58%), Positives = 299/424 (70%), Gaps = 1/424 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E +C  T  IQ GI+DYY G+K GG  G    PYYWW AGE FGGM+ENWYLC+N EY+ 
Sbjct: 24  ESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMAGEAFGGMVENWYLCNNTEYQD 83

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L ++M++Q G+  DY+P++Q   EGNDDQG+W L +MGA ERNF D   E  PGWL + 
Sbjct: 84  LLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMGAAERNFPDAPPERAPGWLALA 143

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M ARWD ENCGGGLRWQIF WN GY YKNTI+N CLFQ+AARL R+TGN TY D
Sbjct: 144 QAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISNACLFQIAARLARFTGNSTYQD 203

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
           VA  VF WLVDVK + LE+ ARV DGAHI E C D   +EW+YNHG++L G AYMYN T 
Sbjct: 204 VAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQLEWTYNHGVVLGGCAYMYNITN 263

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W   + K+L G+   +F + I+YERACQD N C++DQRSF+SIFSRMLA+TSV+AP
Sbjct: 264 GSAVWGDRLNKVLNGSL-LFFENGILYERACQDVNKCNDDQRSFRSIFSRMLALTSVLAP 322

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            T+  I+  I  SA AA+KSC  G  G+TCG+ W   T+DG YGLGEQ SALEIIQN LI
Sbjct: 323 HTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQLSALEIIQNTLI 382

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
           HTK PP TA+ G +S+G+P AGL   S  +I      I  KDRVGA   T + L   +  
Sbjct: 383 HTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQIRLKDRVGAGFATVVFLLPFITG 442

Query: 454 ALWM 457
           ++WM
Sbjct: 443 SIWM 446

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  502 bits (1292), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/388 (61%), Positives = 286/388 (73%), Gaps = 9/388 (2%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C  T+ I KGI+DYY G+++ G VGMFQ PYYWW+AG  FGGMLENWYLC N  +ES+L
Sbjct: 37  ICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWYLCQNDTFESLL 96

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            ++M+ Q G  +DY+P NQ+  E NDDQGVW L IMGAVERNF DP+ + +PGWL M Q+
Sbjct: 97  TDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGKDVPGWLAMAQS 156

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           +FN+M +RWD  +CGGGLRWQI+ WN GY YKNTI+  CLFQ+AARLGRYTGN TYL VA
Sbjct: 157 IFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGRYTGNSTYLKVA 216

Query: 216 SKVFQWLVDVKYIVLEDKA-RVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGG 274
            K FQW+VD+ YI L   + RVFDGAHI  NCSDI  +EWSYNHGI+L G AYMYNAT  
Sbjct: 217 DKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIVLGGCAYMYNAT-K 275

Query: 275 SPEWESHVTKILAGAADFYFRDKIMYERACQ--DYNTCDNDQRSFKSIFSRMLAITSVVA 332
           SPEW  +  KIL GA  ++F++K M E ACQ  D   C+NDQR+FKSIFSRML +TSV+A
Sbjct: 276 SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSIFSRMLGLTSVMA 335

Query: 333 PFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVL 392
           PFT   ID LI  SA AA+ SC  G    TCGLNW +G  DG YGLGEQ SALE+IQN+L
Sbjct: 336 PFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGEQLSALEVIQNLL 395

Query: 393 IHTKAPPLTADT-----GGQSEGNPDAG 415
           IH + PP  A T     GG S+G+P AG
Sbjct: 396 IHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  481 bits (1238), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 279/382 (73%), Gaps = 1/382 (0%)

Query: 36  VCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVL 95
           +C+ T  IQ+GI+DYY G + GG VG FQ PYYWW AG+VFGGM+ENWYLCDN EY+ +L
Sbjct: 25  ICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDVFGGMVENWYLCDNTEYKDLL 84

Query: 96  RESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQT 155
            E+M++Q G+  DY+P +Q   EGNDDQG+W L +M A ER+F D   +  PGWL + Q 
Sbjct: 85  TEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAERDFPDAPPDQAPGWLALAQA 144

Query: 156 VFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVA 215
           VFN M ARWD +NC GGL WQI+ WN GY YKNTI+NG LFQ+AARL R+TGN TY  VA
Sbjct: 145 VFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYLFQIAARLARFTGNSTYGRVA 204

Query: 216 SKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGS 275
             VF WLVD K + L++ A V DGAH++ NC+D    EW+YN+G++L G AYMYN T GS
Sbjct: 205 ETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWTYNYGVVLGGCAYMYNFTNGS 264

Query: 276 PEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFT 335
           P W + + ++L GA   +F + IMYER CQD + C+NDQR FKSIF+RMLA+TSV+AP T
Sbjct: 265 PVWANRLNRVLNGAL-LFFENGIMYERTCQDVDRCNNDQRFFKSIFTRMLALTSVLAPHT 323

Query: 336 RGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHT 395
           +  I+  I  SA AA+KSC  G+ G+TCGL W   T+DG  GLGEQ  ALEIIQN LIHT
Sbjct: 324 KARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLGEQLCALEIIQNTLIHT 383

Query: 396 KAPPLTADTGGQSEGNPDAGLD 417
           K PPLTA  G +S+G+P AGL+
Sbjct: 384 KRPPLTAKQGAKSKGDPAAGLN 405

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  466 bits (1198), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/402 (53%), Positives = 280/402 (69%), Gaps = 12/402 (2%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E +C+ T+ IQ G++DYY G++YGG VG+FQPPYYWW++GE FG +L NWYLC N  YE 
Sbjct: 25  ESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYLCQNDTYEK 84

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           ++ ++++AQ G  +D++P NQ+  EGNDDQGV+ + I+ A+ERNF  P K G P WL M 
Sbjct: 85  LIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPK-GSPSWLDMN 143

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD  +C GG+RWQI+ WNNGY YKN ++ G LF +AARL RYTGN +Y  
Sbjct: 144 QRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARYTGNASYFQ 203

Query: 214 VASKVFQWLVDVKYIVLEDK-ARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNAT 272
           VA  +F WL  V Y++ +DK   V DGA I +NC+DI  IEW+YN GII+ G AY+YNAT
Sbjct: 204 VADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDGCAYLYNAT 263

Query: 273 GGSPEWESHVTKILAGAA-DFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVV 331
            GS +WE   TK+LAGA  DF+ ++ IMYE ACQ  N C+NDQRSFK++ +R L  TSV+
Sbjct: 264 NGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLARFLGTTSVL 323

Query: 332 APFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNV 391
           AP+T  TI  +I ASA  A+KSC  G  G+TCGL+W KGT DG YG+GEQ SALEIIQN+
Sbjct: 324 APYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMSALEIIQNL 383

Query: 392 LIHTKAPPLTADTGG---------QSEGNPDAGLDHDSQPAI 424
           LI+   PPL A  GG         Q+   P  GL+  S+  +
Sbjct: 384 LINDYPPPLVAPNGGCFNETVNDTQTRLRPPRGLNVTSRTTL 425

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  466 bits (1199), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 204/367 (55%), Positives = 270/367 (73%), Gaps = 3/367 (0%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +C  T+ +QKGI+DYY G+ YGG VGMFQ PYYWW +G  FG M+ENWYLC +  YES
Sbjct: 37  KSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGCAFGSMIENWYLCQDDTYES 96

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           ++ ++++AQ GD +D++P NQ+  EGNDDQGVW L +M A ER F  P+ +G P WLTM 
Sbjct: 97  LITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAAEREF--PQVKGQPSWLTMA 154

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           + +F  M ARWD  NCGGGLRWQI+ WNNGY YKNT++  CLFQLAARLGRYTGN+TY+ 
Sbjct: 155 ENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTCLFQLAARLGRYTGNETYVK 214

Query: 214 VASKVFQWLVDVKYIVLEDK-ARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNAT 272
            A++ F WL  V +++ ++    VFDGA I  NC++IK  EWSYNHGI+L GAAYMYN T
Sbjct: 215 AANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYEWSYNHGIVLGGAAYMYNLT 274

Query: 273 GGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVA 332
            GS  WE+  +++L  A+ ++F++ IM+E  CQ  N C+NDQRSF+SIF+RML  TS++A
Sbjct: 275 DGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNNDQRSFRSIFARMLGKTSIMA 334

Query: 333 PFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVL 392
           PFT  TID L+  ++ AA+ +C  G  G+TCGLNW    +DG YGLGE+ SA+E+IQN+L
Sbjct: 335 PFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFDGNYGLGEEMSAMEVIQNLL 394

Query: 393 IHTKAPP 399
           IH +  P
Sbjct: 395 IHQRPAP 401

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  434 bits (1117), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 214/420 (50%), Positives = 277/420 (65%), Gaps = 6/420 (1%)

Query: 40  TNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESM 99
           T+ +  G+MDYY G++YG  +GMF  PYYWWEAG  +G ML+ WY  DN  Y   +  ++
Sbjct: 39  TSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGSMLDYWYYMDNDTYNDEIMAAL 98

Query: 100 IAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNK 159
           + QTGD  DY+P NQSTTEGNDDQ  W + +M A ERNF +P ++  P WL + Q VFN 
Sbjct: 99  LHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPPEDS-PQWLYLAQAVFNT 157

Query: 160 MEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVF 219
           M  RWD + CGGGLRWQIF WN+GY YKNT++NG LF +AARL RYTGNQ+Y+D A KV+
Sbjct: 158 MALRWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGALFHMAARLARYTGNQSYVDWAEKVY 217

Query: 220 QWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWE 279
            W+ +V  +       V+DG +I  NCS I   +W+YNHG+++AGAAY+YN T  +  W 
Sbjct: 218 DWMYEVGLVSNGSSMFVYDGVNIANNCSTITPYQWTYNHGLVMAGAAYLYNFT-ENEVWH 276

Query: 280 SHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTI 339
           +  TK+L  A+  +F + IMYE ACQ  N+C+ DQRSFK+ FSR L  T+ + P TR  I
Sbjct: 277 NR-TKMLVDASTVFFNNSIMYEAACQGPNSCNTDQRSFKAYFSRFLGATAQLVPETRSKI 335

Query: 340 DELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPP 399
             LI ASA AA KSC  GT G+TCGLNW  G +DG+YGLGEQ  ALE++ N     K  P
Sbjct: 336 LPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWDGMYGLGEQMCALEVMVNTRCLHKPAP 395

Query: 400 LTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
            T+  GG S G+  AG +H   P  L  +H IT   R GA +ITA+    +L CALW++F
Sbjct: 396 YTSTNGGSSVGDGAAGTEH--HPTNLAPLH-ITKGSRAGAGIITAVIGISILACALWLVF 452

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  434 bits (1116), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 207/420 (49%), Positives = 282/420 (67%), Gaps = 5/420 (1%)

Query: 40  TNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESM 99
           T  +  G+MDYY G +YG  +GMF  PYYWWEAG  +G ML+ W+  +N  Y  ++++++
Sbjct: 37  TALVAYGLMDYYTGLQYGQTIGMFSNPYYWWEAGGAWGSMLDYWWYMENDTYNDIVKQAL 96

Query: 100 IAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNK 159
           + QTGD  DY+P NQSTTEGNDDQ  W L +M A ERNF +P+ +  P WL + Q VFN 
Sbjct: 97  LYQTGDDHDYVPLNQSTTEGNDDQAFWGLAVMAAAERNFSNPDPD-QPQWLYLAQAVFNT 155

Query: 160 MEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVF 219
           M  RWDA++CGGGLRWQIF WN+GY YKN+++NG LF +AARL RYTGNQ+Y+D A KVF
Sbjct: 156 MALRWDADSCGGGLRWQIFTWNSGYDYKNSVSNGALFHIAARLARYTGNQSYVDWAEKVF 215

Query: 220 QWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWE 279
            W+ DV  I   D A V DG  I +NC+ +   +W+YNHG+I+AG+AY+YN T GS  W 
Sbjct: 216 DWMRDVGLITEGDWAFVHDGVSIDDNCTSVTPYQWTYNHGLIMAGSAYLYNFT-GSEVWH 274

Query: 280 SHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTI 339
           +   + L  ++ F+    I++E ACQ  NTC+ DQRSFK+ FSR L +T+ + P +R  I
Sbjct: 275 NRTKEFLHSSSVFFKNGSILWEAACQASNTCNTDQRSFKAYFSRFLGLTAQLVPESRSQI 334

Query: 340 DELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPP 399
            E I +SA  A++SC  G  G+TCG+NW  G++DG YGLGEQ +ALEIIQNV    +  P
Sbjct: 335 MEWIRSSAKGAAESCSGGRDGHTCGINWFNGSWDGFYGLGEQMAALEIIQNVRCLDRPAP 394

Query: 400 LTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
            T+ TGG S+G+  AG   ++ P  L  +  IT   R GA +ITA+    ++ CA+W++ 
Sbjct: 395 YTSTTGGSSQGDSAAGT--ETHPTNLTPL-TITAGSRAGAGIITAVIGISIVACAVWLVL 451

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  433 bits (1114), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 218/426 (51%), Positives = 281/426 (65%), Gaps = 6/426 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + T+ I  G+MDYY G++YG  VGMF  PYYWWEAG  +G ML+ W+  DN  Y  
Sbjct: 30  ESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCMLDYWFFMDNDTYND 89

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            +  +MI Q GD  DYIP NQSTTEGNDDQ  W +  M A ERNF +P  E  P WL + 
Sbjct: 90  EIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP-PENEPQWLYLA 148

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWDA++CGGGLRWQIF WN+GY YKNT++NG LF +AARL RYTGNQTY+D
Sbjct: 149 QAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARYTGNQTYVD 208

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV++W+V V  I       V+DG  I +NC+ +   +W+YN G++LAG+AY+YN T 
Sbjct: 209 WAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGSAYLYNFT- 267

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W +  TK    A+  +F D I+YE ACQ  N+C+ DQRSFK+ F+R L +T+ + P
Sbjct: 268 GSDLWHTR-TKEFLNASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYFARFLGVTAQLVP 326

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            TR  I   +  SA AA+KSC  GT G+TCGLNW  GT+DG+YGLGEQ SALE++ N   
Sbjct: 327 ETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMSALEVMVNTRA 386

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
             K  P TA+ GG S G+  AG    +QP  L  + NIT   + GA +ITA+    ++ C
Sbjct: 387 LDKPAPYTAENGGSSVGDGAAGT--QAQPTNLAPL-NITKGSKAGAGIITAVIGISIVAC 443

Query: 454 ALWMIF 459
           ALW++F
Sbjct: 444 ALWLVF 449

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  431 bits (1107), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 214/426 (50%), Positives = 283/426 (66%), Gaps = 6/426 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + T+ I  G+MDYY G++YG  +GMF  PYYWWEAG  +G ML+ W+  DN  Y  
Sbjct: 30  ESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDYWFFMDNDTYND 89

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            +  +M+ Q+GD  DYIP NQSTTEGNDDQ  W +  M A ERNF +P  +  P WL + 
Sbjct: 90  EIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPAD-EPQWLYLA 148

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWDA++CGGGLRWQIF WN+GY YKNT++NG LF +AARL RYTGNQTY+D
Sbjct: 149 QAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARYTGNQTYVD 208

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV++W+V V  I       V+DG  I +NC+ +   +W+YN G++LAG+AY+YN T 
Sbjct: 209 WAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKVTSYQWTYNQGLLLAGSAYLYNFT- 267

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W +  TK    ++  +F+D I+YE ACQ  N+C+ DQRSFK+ F+R L +T+ + P
Sbjct: 268 GSDLWHTR-TKEFLNSSQVFFQDGIVYEAACQGPNSCNTDQRSFKAYFARFLGVTAQLVP 326

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            TR  I   +  SA AA+KSC  GT G+TCGLNW  GT+DG+YGLGEQ +ALE++ N   
Sbjct: 327 ETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMAALEVMVNTRA 386

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
             K  P TAD GG S G+  AG    +QP  L  + NIT   + GA +ITA+    ++ C
Sbjct: 387 LDKPAPYTADEGGSSAGDGAAGT--QAQPTNLAPL-NITKGSKAGAGIITAVIGISIVAC 443

Query: 454 ALWMIF 459
           ALW++F
Sbjct: 444 ALWLVF 449

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  429 bits (1102), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 213/420 (50%), Positives = 277/420 (65%), Gaps = 6/420 (1%)

Query: 40  TNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESM 99
           T+ I  G+MDYY G +YG  VGMF  PYYWWEAG  +G ML+ W+  +N  Y   +  +M
Sbjct: 37  TSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGGAWGCMLDYWFFMENDTYNDEITAAM 96

Query: 100 IAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNK 159
           I Q GD  DYIP NQSTTEGNDDQ  W +  M A ERNF +P  +  P WL + Q VFN 
Sbjct: 97  IHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPSD-EPQWLYLAQAVFNT 155

Query: 160 MEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVF 219
           M  RWDA++CGGGLRWQIF WN+GY YKNT++NG LF +AARL RYTGN+TY+D A KV+
Sbjct: 156 MALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARYTGNETYVDWAEKVY 215

Query: 220 QWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWE 279
           +W+V V  I       V+DG  I +NC+ +   +W+YN G++LAG+AY+YN T GS  W 
Sbjct: 216 EWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWH 274

Query: 280 SHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTI 339
           +  TK    A+  +F D I+YE ACQ  N+C+ DQRSFK+ F+R L +T+ + P TR  I
Sbjct: 275 TR-TKEFLNASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYFARFLGVTAQLVPETRSQI 333

Query: 340 DELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPP 399
              +  SA AA+KSC  GT G+TCGLNW  GT+DG+YGLGEQ +ALE++ N     +  P
Sbjct: 334 MSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMAALEVMVNTRALDRPSP 393

Query: 400 LTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
            TAD GG S G+  AG    +QP  L  + NIT   + GA +ITA+    ++ CALW++F
Sbjct: 394 YTADNGGSSVGDGAAGT--QAQPTNLSPL-NITKGSKAGAGIITAVIGISIVACALWLVF 450

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  428 bits (1101), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 213/426 (50%), Positives = 282/426 (66%), Gaps = 6/426 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + T+ +  G+MDYY G++YG  +GMF  PYYWWEAG  +G ML+ W+  DN  Y  
Sbjct: 30  ESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDYWFFMDNDTYND 89

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            +  +MI Q GD  DYIP NQSTTEGNDDQ  W +  M A ERNF +P ++  P WL + 
Sbjct: 90  EIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPEDD-PQWLYLA 148

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWDA++CGGGLRWQIF WN+GY YKNT++NG LF +AARL RYTGNQTY+D
Sbjct: 149 QAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARYTGNQTYVD 208

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV++W+V V  I       V+DG  I +NC+ +   +W+YN G++LAG+AY+YN T 
Sbjct: 209 WAEKVYEWMVGVDLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGSAYLYNFT- 267

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W +  TK    A+  +F D I+YE ACQ  N+C+ DQRSFK+ F+R L +T+ + P
Sbjct: 268 GSDLWHTR-TKEFLNASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYFARFLGVTAQLVP 326

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            TR  I   +  SA AA+KSC  GT G+TCGLNW  GT+DG+YGLGEQ SALE++ N   
Sbjct: 327 ETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMSALEVLVNTRA 386

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
             +  P TA+ GG S G+  AG    ++P  L  + NIT   + GA +ITA+    ++ C
Sbjct: 387 LDRPAPYTAENGGSSVGDGAAGT--QARPTNLAPL-NITKGSKAGAGIITAVIGISIVAC 443

Query: 454 ALWMIF 459
           ALW++F
Sbjct: 444 ALWLVF 449

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  422 bits (1086), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 209/426 (49%), Positives = 279/426 (65%), Gaps = 6/426 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + T+ +  G+MDYY G++YG  VGMF  PYYWW+AG  +G ML+ WY  +N  Y  
Sbjct: 34  ESLQNATSLVAYGLMDYYTGNQYGKTVGMFSDPYYWWQAGGAWGSMLDYWYYMNNDTYND 93

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            +  +++ QTGD  DY+P NQSTTEGNDDQ  W + +M A ERNF +P  E  P WL + 
Sbjct: 94  DIMAALLHQTGDDNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNP-PEDQPQWLYLA 152

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD++ CGGGLRWQIF WN+GY YKNT++NG LF +A+RL RYTGNQ+Y+D
Sbjct: 153 QAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYDYKNTVSNGALFHIASRLARYTGNQSYVD 212

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV+ W+ DV  I       V+DG +I +NC+ +   +W+YN G++L+G AY+YN TG
Sbjct: 213 WAEKVYDWMYDVHLISNGSYMYVYDGVNIGDNCTTVTPYQWTYNQGLLLSGCAYLYNFTG 272

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
              E   + TK L  AA  +F + I+YE ACQ +NTC+ DQRSFK+ FSR L  T+ + P
Sbjct: 273 --EELWHNRTKNLLTAAGVFFNNSILYEAACQGHNTCNTDQRSFKAYFSRFLGTTAQLVP 330

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            TR  I   I  SA AA++SC  GT G+TCG+NW    +DG+YGLGEQ +ALEI+ N   
Sbjct: 331 ETRNQIMHWINTSAVAAAQSCSGGTDGHTCGINWFADGWDGMYGLGEQMAALEIMVNTKA 390

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
            +KA P T+  GG S G+  AG   +  P  L  +H IT   R GA +ITA+    ++ C
Sbjct: 391 LSKAAPYTSSNGGSSVGDGAAGT--EPHPTNLAPLH-ITKGSRAGAGIITAVIGISIVTC 447

Query: 454 ALWMIF 459
           ALW++F
Sbjct: 448 ALWLVF 453

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  421 bits (1081), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/417 (48%), Positives = 271/417 (64%), Gaps = 6/417 (1%)

Query: 43  IQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQ 102
           +  G++DYY G +YG  +GMF  PYYWWEAG  +G +L+ W+   N  Y ++L E+++ Q
Sbjct: 38  VAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFWWYTQNDTYNAMLEEALLYQ 97

Query: 103 TGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEA 162
            G+  DYIP NQSTTEGNDDQ  W L +M A ERNF +P  E  P WL + Q VFN M  
Sbjct: 98  AGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNP-PETEPQWLYLAQAVFNTMAL 156

Query: 163 RWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWL 222
           RWD E+CGGGLRWQIF WN+GY YKNT++NG LF LAARL RYTGN TY+D A KVF W+
Sbjct: 157 RWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARYTGNNTYVDWAEKVFDWM 216

Query: 223 VDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHV 282
             +  +   D + V+DGA +  NCS I  + W+YN G++++G AY+YN T GS  W +  
Sbjct: 217 KGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMSGCAYLYNYT-GSETWHTRT 275

Query: 283 TKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDEL 342
            + L  ++D +F + I+YER CQ+ NTC+ DQRSFK+ FSR L +T+ + P  R  I + 
Sbjct: 276 FEFL-NSSDIFFNNSILYERTCQEANTCNTDQRSFKAYFSRFLGLTAQLVPAARNQIMDW 334

Query: 343 IYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTA 402
           I ASA  A++SC  GT G+TCGLNW    +DG +GLGEQ +ALEI+QNVL   +  P TA
Sbjct: 335 IRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMAALEIMQNVLCLDRPAPYTA 394

Query: 403 DTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
            TGG S GN  AG +     A      +IT   R  A +ITA+    ++ C +W++ 
Sbjct: 395 ATGGSSVGNGAAGTE---TSATNLSPLDITTGSRAAAGIITAVIGLSIVACTVWLVL 448

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  409 bits (1052), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 272/425 (64%), Gaps = 6/425 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + T  +  G+MDYY G +YG  +GMF  PYYWWEAG  +G ML+ W+  +N  Y  
Sbjct: 33  ESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYWWEAGGAWGCMLDYWFFMENDTYND 92

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +++++++ Q G   DY+P NQSTTEGNDDQ  W +  M A ERNF +P  E  P WL + 
Sbjct: 93  IIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIAAMMAAERNFTNP-AEDEPQWLYLA 151

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD ++CGGGLRWQIFQWN+GY YKN+++NG LF +AARL RYTGN +Y +
Sbjct: 152 QAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGALFHIAARLARYTGNDSYAE 211

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV+ W+VDV  I  +    V+DG   ++NC+ I   +W+YN G+IL+G AY+YN T 
Sbjct: 212 WAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTTITKYQWTYNQGLILSGCAYLYNYT- 270

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
           GS  W +     L+ ++ F F D I+YE ACQ+  TC+ DQRSFK+ FSR L +T+ + P
Sbjct: 271 GSELWHTRTKNFLSSSSVF-FNDTILYEAACQNQETCNTDQRSFKAYFSRFLGVTAQLVP 329

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            TR  I + I ASA  A++SC  GT G+TCG+NW  G +DG YGLGEQ +ALEI+ N   
Sbjct: 330 ETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWFYGGWDGKYGLGEQMAALEILVNTRA 389

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
             +  P T+  GG S G+  AG +     A      NIT   R GA +ITA+    ++ C
Sbjct: 390 LDRPAPYTSSNGGSSTGDGAAGTE---TSATNLSPLNITAGSRAGAGIITAVIGISIVAC 446

Query: 454 ALWMI 458
           A W++
Sbjct: 447 ACWLV 451

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  408 bits (1049), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 197/421 (46%), Positives = 275/421 (65%), Gaps = 8/421 (1%)

Query: 40  TNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESM 99
           T+ +  G+MDYY G +YG  +GMF  P YWW+AG  +G +L+ W+  +N  Y  +L +++
Sbjct: 35  TSLVAYGLMDYYTGLQYGKTIGMFASPSYWWQAGGAWGSILDYWFYMENDTYNDILTQAL 94

Query: 100 IAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNK 159
           + QTGD  DY+P NQ+ TEGNDDQ  W   +M A ERN+ +P  +  P WL + Q VFN 
Sbjct: 95  LYQTGDNHDYMPLNQTVTEGNDDQAFWGFAVMAAAERNYPNPPDD-EPQWLYLAQAVFNT 153

Query: 160 MEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVF 219
           M +RWD ++CGGGLRWQIF WN+GY YKN+++N  LF L+ARL RYTGN +Y + A K++
Sbjct: 154 MSSRWDMDSCGGGLRWQIFTWNSGYDYKNSVSNAALFHLSARLARYTGNSSYTEWAEKIY 213

Query: 220 QWLVDVKYIVLEDKAR--VFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPE 277
            W+ D++ +V E+  +  V+DGA I ENC+D    +W+YN G++L+G+AY+YN T  S  
Sbjct: 214 DWMQDIQLLVDEEPTQYYVYDGASIEENCTDTVKYQWTYNQGLMLSGSAYLYNFTE-SET 272

Query: 278 WESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRG 337
           W    TK    ++  +F + IMYE ACQ    C+NDQRSFK+ FSR L +T+ + P TR 
Sbjct: 273 WHER-TKNFLNSSGIFFNNSIMYEAACQGSGYCNNDQRSFKAYFSRFLGLTAQLVPETRD 331

Query: 338 TIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKA 397
           T+  L+ ASA  A+ SC  GT G+TCGLNW  G +DG YGLGEQ +ALE++QN+    + 
Sbjct: 332 TVLALLQASAQGAADSCSGGTDGHTCGLNWFYGGWDGKYGLGEQMAALEVMQNLRCLDRP 391

Query: 398 PPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWM 457
            P TAD GG S GNP AG +    P  L  +  I   D+ GA +ITA+    ++G  +W+
Sbjct: 392 APYTADDGGTSAGNPAAGTEQ--SPTNLAPL-TIGKGDQAGAGIITAVIGITIIGSVVWL 448

Query: 458 I 458
           I
Sbjct: 449 I 449

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  406 bits (1044), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 196/427 (45%), Positives = 276/427 (64%), Gaps = 7/427 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + T  +  G++DYY G +YG  +GMF  PYYWWEAG  +G +L+ W+   N  Y  
Sbjct: 29  ESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYWWEAGGAWGSILDYWHYTQNDTYNK 88

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L ++++ Q+G+  DYIP NQSTTEGNDDQ  W L +M A ERNF +P  +  P WL + 
Sbjct: 89  ILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPPD-QPQWLYLA 147

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD + CGGGLRWQIF WN+GY YKNT++NG LF LAARL RYTGN TY++
Sbjct: 148 QAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARYTGNDTYVE 207

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KVF W+  +K +  E++  V+DGA + +NC+ I  + W+YN G++++G+AY+YN T 
Sbjct: 208 WAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTVITKLIWTYNQGLLMSGSAYLYNYT- 266

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYN-TCDNDQRSFKSIFSRMLAITSVVA 332
           G+ +W +   + L  ++  +F + ++YERACQ    +C+ DQRSFK+ FSR + +T+ + 
Sbjct: 267 GAEKWHTRTFEFL-NSSHIFFNNSVLYERACQGVTVSCNTDQRSFKAYFSRFMGLTAQLV 325

Query: 333 PFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVL 392
           P +R  I   I ASA  A++SC  G  G+TCGLNW    +DG +GLGEQ SALEI+QN+L
Sbjct: 326 PESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFYDGWDGKWGLGEQMSALEIMQNLL 385

Query: 393 IHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLG 452
              +  P TA+TGG S GN  AG +     A       IT   R  A +ITA+    ++ 
Sbjct: 386 CLDRPAPYTAETGGSSVGNGAAGTE---TSATNLSPLAITAGSRAAAGIITAVIGLSIVA 442

Query: 453 CALWMIF 459
           C +W++ 
Sbjct: 443 CTIWLVL 449

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  405 bits (1040), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 266/426 (62%), Gaps = 6/426 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + T  +  G+MDYY G++YG  VGMF  PYYWWEAG  +G M++ WY  DN  Y  
Sbjct: 29  ESLQNATALVAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGSMIDFWYYMDNNTYND 88

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            +  +++ QTGD +DYIP NQSTTEGNDDQ  W + +M A ERNF +P  +  P WL + 
Sbjct: 89  DIMAALLHQTGDDWDYIPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPPDD-QPQWLYLA 147

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD   CGGGLRWQIF WN+GY YKNT++NG LF LAARL RYTGN +Y+D
Sbjct: 148 QAVFNTMALRWDDATCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARYTGNTSYVD 207

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV+ W+ D   I    +  V+DGA + +NC+ +   +W+YN G++L+G+AY+YN T 
Sbjct: 208 WAEKVYNWMEDTYLISNGTQMFVYDGASVTDNCTTVTKYQWTYNQGLLLSGSAYLYNFT- 266

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
            S  W    TK    A+  +F + IMYE ACQ   TC+ DQRSFK+ FSR L  T+ + P
Sbjct: 267 ESELWHER-TKGFLNASVVFFNNSIMYEAACQGPQTCNTDQRSFKAYFSRFLGATAQLVP 325

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
            TR T+   +  SA AA+ SC  GT G+TCG+NW  G +DG YGLGEQ SALEI+ N   
Sbjct: 326 ETRDTVMHWVNTSAVAAATSCSGGTDGHTCGINWFYGGWDGYYGLGEQMSALEIMVNTRA 385

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
             K  P T++ GG S G+  AG       A      N+T   +  A +ITA+    +  C
Sbjct: 386 LHKPGPYTSENGGSSMGDGAAGT---QATATNLSPLNVTPGSKAAAGIITAVIGISIFAC 442

Query: 454 ALWMIF 459
            LW+I+
Sbjct: 443 VLWLIY 448

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  404 bits (1039), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/414 (48%), Positives = 266/414 (64%), Gaps = 6/414 (1%)

Query: 46  GIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGD 105
           G+MDYY G+KYGG VGMF  PYYWWEAG  FG +L+ WY  DN  Y   +  +M+ Q G+
Sbjct: 42  GLMDYYEGTKYGGTVGMFSSPYYWWEAGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGN 101

Query: 106 KFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWD 165
            +DYIP NQSTTEGNDDQ  W +  M A ERNF +P  +  P WL + Q VFN M  RWD
Sbjct: 102 DWDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPASD-EPQWLYLAQAVFNTMALRWD 160

Query: 166 AENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDV 225
            ++CGGGLRWQIF WN+GY YKN+++NG LF LAARL RYTGN +Y+D A KV+ W+ D 
Sbjct: 161 TDSCGGGLRWQIFTWNSGYDYKNSVSNGALFHLAARLARYTGNDSYVDWAEKVYNWMEDT 220

Query: 226 KYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKI 285
            +I   +   V+DGA   +NCS +   +W+YN G+IL+GAAY+YN +  S  +   +T +
Sbjct: 221 GFITTGNTLYVYDGASTEDNCSSVTKYQWTYNQGLILSGAAYLYNYSESSLWYNRTMTAL 280

Query: 286 LAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYA 345
              ++  +  + IM E ACQ   TCD DQRSFK+ F+R L +T+ + P TR  I   + A
Sbjct: 281 --SSSGVFLNNSIMCEAACQPAGTCDTDQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNA 338

Query: 346 SATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTG 405
           SA A ++SC  GT G+TCGLNW  G++DG YGLGEQ SALE++ N     K  P  +  G
Sbjct: 339 SAYAVAESCSGGTDGHTCGLNWFLGSWDGYYGLGEQMSALEVLVNTRALDKPGPYNSTNG 398

Query: 406 GQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
           G S+G+  AG +     A      NITG  +  A++ITA+    ++ C LW+IF
Sbjct: 399 GSSQGDGAAGTE---TTATNLAPLNITGGSKAAAAIITAVIGISLIACTLWIIF 449

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  403 bits (1036), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 203/418 (48%), Positives = 268/418 (64%), Gaps = 8/418 (1%)

Query: 43  IQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQ 102
           +  G+MDYY G +YG  VGMF  PYYWWEAG  +G ML+ W+  +N  Y  ++  +++ Q
Sbjct: 37  VAYGLMDYYNGDQYGQTVGMFSNPYYWWEAGGAWGTMLDYWFFMENDTYNDLIMSALLHQ 96

Query: 103 TGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEA 162
           TG+  DYIP NQSTTEGNDDQ  W +  M A ERNF +P  E  P WL + Q VFN M  
Sbjct: 97  TGENNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP-PESSPQWLYLAQAVFNTMAL 155

Query: 163 RWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWL 222
           RWDA+NCGGGLRWQIF WN+GY YKN+++NG LF LAARL RYTGNQ+Y+D A K + W+
Sbjct: 156 RWDAQNCGGGLRWQIFVWNSGYDYKNSVSNGALFHLAARLARYTGNQSYVDWAEKTYDWM 215

Query: 223 VDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHV 282
            DV  I    +  V+DG  I  NC+ I   +WSYN G++LAGAAY+YN T GS  W +  
Sbjct: 216 SDVGLISNGTQKYVYDGTSIETNCTTITSYQWSYNQGLMLAGAAYLYNFT-GSTIWLNRT 274

Query: 283 TKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDEL 342
             +L  A   +F + IMYE ACQ   TC+NDQRSFKS  +R L +T+ +   T+  I   
Sbjct: 275 MDLL-DATSVFFNNSIMYEVACQPTGTCNNDQRSFKSYLARFLGLTAQLVTITQSRIMNW 333

Query: 343 IYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTA 402
           +  SA A + SC  GT G+TCGLNW    +DG YGLGEQ SAL+++ N  +  +  P  +
Sbjct: 334 LNTSAIAVAHSCSGGTDGHTCGLNWFDNGWDGYYGLGEQMSALDVLVNTRVLDRPAPYNS 393

Query: 403 DTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGL-MLGCALWMIF 459
             GG S G+  AG   ++ P  L  +H IT   +VGA+ ITA ++GL ++  ++W+I 
Sbjct: 394 TNGGSSIGDGAAGT--EATPTNLAPLH-ITKGSKVGAAFITA-AIGLSIVFTSIWIIL 447

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  397 bits (1020), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 268/421 (63%), Gaps = 8/421 (1%)

Query: 40  TNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESM 99
           T+ I  G+MDYY G  YG ++GMF  PYYWWEAG  +G +L+ WY   N  Y  ++ E++
Sbjct: 35  TSLIAYGMMDYYNGHDYGQVIGMFAKPYYWWEAGGAWGCLLDYWYYMQNDTYNDLITEAL 94

Query: 100 IAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNK 159
           + QTGD+ DY+P NQSTTEGNDDQ  W +  + A ERNF +P  +  P WL + Q VFN 
Sbjct: 95  LYQTGDRNDYVPLNQSTTEGNDDQAFWGIAAITAAERNFTNPPPD-KPQWLYLAQAVFNT 153

Query: 160 MEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVF 219
           M  RWD   C GGLRWQIF WN+GY+YKN+++NG LF +AARL RYTGNQ+Y++ A K++
Sbjct: 154 MALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARLARYTGNQSYVEWADKIY 213

Query: 220 QWLVDVKYIV--LEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPE 277
            W+     I    E    V+DGA+I  NC+DI   +W+YN G++LAG AY+YN T    +
Sbjct: 214 DWMFGTGIISDEYETYKFVYDGANIETNCTDITRYQWTYNQGLVLAGCAYLYNHT-QDEK 272

Query: 278 WESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRG 337
           W     + L G+  F FRD ++YE ACQ    C+NDQRSFK+ F+R L +T+ + P TR 
Sbjct: 273 WLIRTEQFLNGSVVF-FRDNVIYEAACQPNKNCNNDQRSFKAYFARFLGVTAQLIPSTRD 331

Query: 338 TIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKA 397
           TI   I  SA AA+++C  GT G+TCG++W    +DG YGLGEQ +ALE + N       
Sbjct: 332 TIMRWINTSAYAAAQACSGGTDGHTCGMDWVWKGWDGYYGLGEQMAALEFMVNTRALDMP 391

Query: 398 PPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWM 457
           PP T+  GG S G+  AG + D  P  L  +H IT   + GAS+IT I    +L  A+W+
Sbjct: 392 PPYTSFNGGSSTGSGAAGTERD--PTNLSPLH-ITAGSKAGASIITCIVSISILTGAMWL 448

Query: 458 I 458
           +
Sbjct: 449 V 449

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  397 bits (1019), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 197/420 (46%), Positives = 269/420 (64%), Gaps = 6/420 (1%)

Query: 40  TNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESM 99
           T+ +  G+MDYY G +YG  VGMF  PYYWWEAG  +G ML+ WY   N  Y  ++  ++
Sbjct: 34  TSLVAYGLMDYYTGDQYGQTVGMFSDPYYWWEAGGAWGTMLDYWYFMQNDTYNDIITAAL 93

Query: 100 IAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNK 159
           + Q G   +YIP NQSTTEGNDDQ  W + +M A ERNF +P  E  P WL + Q VFN 
Sbjct: 94  LHQVGTDNNYIPLNQSTTEGNDDQAFWGITVMTAAERNFTNP-PEDQPQWLYLAQAVFNT 152

Query: 160 MEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVF 219
           M  RWDA++CGGGLRWQIF WN+GY YKN+++NG LF +AARL RYTGNQ+Y+D A +V+
Sbjct: 153 MALRWDADSCGGGLRWQIFVWNSGYDYKNSVSNGALFHMAARLARYTGNQSYVDWAERVY 212

Query: 220 QWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWE 279
            W+ DV  I       V+DGA   +NC+ +   +W+YN G++L+GAAY+YN T GS  W 
Sbjct: 213 DWMSDVGLISNGSYKFVYDGASTTDNCTVLTTYQWTYNQGLLLSGAAYLYNYT-GSDTWL 271

Query: 280 SHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTI 339
               ++L  A+  +F + I+YE ACQ   TC+NDQRSFK+ F R L  T+ +   T+ TI
Sbjct: 272 LRTNQLL-NASSVFFNNSILYEAACQKSGTCNNDQRSFKAYFLRFLGQTAQLVSETQPTI 330

Query: 340 DELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPP 399
            + + ASA AA++SC  GT G+TCGLNW  G +DG+YGLGEQ SALE + N  +     P
Sbjct: 331 MKWLNASAYAAAQSCSGGTDGHTCGLNWFSGGWDGMYGLGEQMSALEALVNTRVLHLPGP 390

Query: 400 LTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
             +  GG S GN  AG + ++    L  +H IT   +  A++IT++    ++   +W+I 
Sbjct: 391 YNSTDGGSSIGNSAAGTEQEATN--LAPLH-ITDGSKAAAAIITSVVGISIVAAGVWLII 447

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  395 bits (1016), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 203/417 (48%), Positives = 269/417 (64%), Gaps = 6/417 (1%)

Query: 43  IQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQ 102
           +  G+MDYY G +YG  VGMF  PYYWW+AG  +G ML+ WY   N  Y   +  +++ Q
Sbjct: 36  VAYGLMDYYTGDQYGKTVGMFSDPYYWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQ 95

Query: 103 TGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEA 162
           TGD  DY+P NQSTTEGNDDQ  W + +M A ER F +P  +  P WL + Q VFN M  
Sbjct: 96  TGDNNDYVPLNQSTTEGNDDQAFWGIAVMQAAERKFPNPPDD-KPQWLYLTQAVFNTMAL 154

Query: 163 RWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWL 222
           RWD+E CGGGLRWQIF WN+GY YKNT++NG LF +AARL RYTGNQ+Y+D A +V+ W+
Sbjct: 155 RWDSETCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARYTGNQSYVDWAERVYDWM 214

Query: 223 VDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHV 282
            DV  I       V+DG  I++NC+ +   +W+YN G++L+G+AY++N T GS  W    
Sbjct: 215 EDVHLIDNGTYRYVYDGVSINDNCTTVTKYQWTYNQGLMLSGSAYLFNMT-GSDLWHERT 273

Query: 283 TKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDEL 342
              L  A+  +F + I+YE ACQ  NTC+ DQRSFK+ F+R L  T+ + P TR  I   
Sbjct: 274 HAFL-NASRVFFNNSILYEAACQGPNTCNTDQRSFKAYFARFLGSTAELVPETRQQIMTW 332

Query: 343 IYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTA 402
           +  SA AA+KSC  GT G+TCGLNW +  +DG+YGLGEQ +ALE++ N     +APP  A
Sbjct: 333 LNTSALAAAKSCSGGTDGHTCGLNWFRDDWDGMYGLGEQMAALEVMVNTQALKRAPPYNA 392

Query: 403 DTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459
             GG S G+  AG      P  L  +H ITG  R GA +ITAI    ++ CALW+++
Sbjct: 393 TNGGNSTGDGAAGT--KPHPTNLAPLH-ITGGSRAGAGIITAIIGISIIACALWLVY 446

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  395 bits (1015), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 266/426 (62%), Gaps = 6/426 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           E + + ++ +  G+MDYY G +YG  +GMF  PYYWWEAG  +G ML+ W+   N  Y  
Sbjct: 28  ESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPYYWWEAGGAWGCMLDYWWYMQNDTYND 87

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           ++ ++++ Q G   DY+P NQSTTEGNDDQ  W +  M A ERNF +P  +  P WL + 
Sbjct: 88  IIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPSD-QPQWLYLA 146

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD  +C GGLRWQIF WN GY YKNT++NG LF LAARL RYTGNQ+Y+D
Sbjct: 147 QAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKNTVSNGALFNLAARLARYTGNQSYVD 206

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV+ W+  V  I   +   V+DG +I  NC++I G +WSYNHG++L+G AY+YN T 
Sbjct: 207 WADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCANITGYQWSYNHGLMLSGCAYLYNMT- 265

Query: 274 GSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAP 333
              +W +   + L  A+ FY  + ++YE ACQ  N C+ DQRSFK+ F+R L +T+ + P
Sbjct: 266 KDEKWGNRTFEYLNSASIFY-NNSVLYEVACQTVNKCNTDQRSFKAYFTRFLGVTAELIP 324

Query: 334 FTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLI 393
             R    + I ASA  A++SC  G  G+TCG+NW    +DG+YGLGEQ SALE + N   
Sbjct: 325 QARDQAMKWINASALGAAQSCSGGYDGHTCGINWFYDGWDGMYGLGEQMSALEALVNTQA 384

Query: 394 HTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGC 453
             + PP  +  GG S G+  AG +    P  L  + +IT   R GA +IT +    +L C
Sbjct: 385 LNRPPPYNSTNGGSSTGDGAAGTEE--SPTNLSPL-DITAGSRAGAGIITCVIGISILSC 441

Query: 454 ALWMIF 459
           ALW+I 
Sbjct: 442 ALWLIL 447

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  395 bits (1014), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 195/416 (46%), Positives = 263/416 (63%), Gaps = 7/416 (1%)

Query: 43  IQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQ 102
           +  G+MDYY G +YG  +GMF  PYYWWEAG  +G M++ WY   N  Y  ++ ++++ Q
Sbjct: 38  VAVGLMDYYNGDQYGQTIGMFSNPYYWWEAGGAWGCMIDYWYFMQNDTYNDIISQALLYQ 97

Query: 103 TGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEA 162
           TGD+ DYIP NQSTTEGNDDQ  W + +M A ERNF +P  +  P WL + Q VFN M  
Sbjct: 98  TGDRNDYIPLNQSTTEGNDDQAFWGITVMSAAERNFTNPPPD-KPQWLYLAQAVFNTMAL 156

Query: 163 RWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWL 222
           RWD   C GGLRWQIF WN+GY+YKN+++NG LF +AARL RYTGNQ+Y+D A KV+ W+
Sbjct: 157 RWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHMAARLARYTGNQSYVDWAVKVYDWM 216

Query: 223 VDVKYIVLEDKAR-VFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESH 281
                I  +   + V+DGA I  NC+DI   +W+YN G+IL+G AY+YN T  S +W + 
Sbjct: 217 EKTGLISNDTYFKFVYDGASIETNCTDITQFQWTYNQGLILSGCAYLYNHTEDS-KWLTR 275

Query: 282 VTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDE 341
             + + G+A F F + I+YE ACQ    CDNDQRSF++ F+R L +T+ + P T+  I +
Sbjct: 276 TEQFVNGSAVF-FNNSIVYEAACQGSKRCDNDQRSFRAYFARFLGVTAQLVPTTKDIIMD 334

Query: 342 LIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLT 401
            I  SA AA+++C  GT G+TCGLNW    +DG YGLGEQ  ALE + N        P T
Sbjct: 335 WINTSAYAAAQACSGGTDGHTCGLNWFNIGWDGYYGLGEQMGALEFLVNTRALDMPAPYT 394

Query: 402 ADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWM 457
           +  GG S GN  AG +   +P    G  +IT   + GA +IT +    +L C  W+
Sbjct: 395 SSNGGSSTGNGAAGTE---KPPTNLGPLHITDGSKAGAGIITCVIGLSILLCTTWL 447

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  394 bits (1012), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/450 (43%), Positives = 279/450 (62%), Gaps = 7/450 (1%)

Query: 10  LLVGLFLLMQGMXXXXXXXXXXXXEDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYW 69
           +++G+FL + G               +   T+ I  G++DYY G   G  +GMF  PYYW
Sbjct: 6   VILGVFLNLLGTDVSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYW 65

Query: 70  WEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALF 129
           WEAG  +G +++ W+  +N  Y  +++++++ Q G   DY+P NQSTTEGNDDQ  W + 
Sbjct: 66  WEAGAAWGALIDYWFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIA 125

Query: 130 IMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNT 189
           +M A E+ F +P+ +  P WL + Q VFN M  RWD+ +C GGLRWQIF WN GY YKN+
Sbjct: 126 VMSAAEKGFPNPDPD-QPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNS 184

Query: 190 IANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYI-VLEDKARVFDGAHIHENCSD 248
           ++NG LF LAARL RYTGNQ+Y D A KV+ W+  V+ I    D   V+DGA IH+NCS 
Sbjct: 185 VSNGALFHLAARLARYTGNQSYADWAEKVYDWMASVQLINQTGDWTFVYDGAFIHDNCSR 244

Query: 249 IKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYN 308
              ++WSYNHG+IL G AY+ + T GS  W +   ++L  A+ F F + ++ E ACQ+  
Sbjct: 245 PSVLQWSYNHGLILGGCAYLTDFT-GSDVWHNRTLRLLRSASIF-FPNGVVTEVACQEAG 302

Query: 309 TCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWH 368
           TC+ DQRSFK+ F R L +T+ + P +R    + I  SA  A+ SC  G  G+TCG+N+ 
Sbjct: 303 TCNTDQRSFKAYFMRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYS 362

Query: 369 KGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGM 428
           +G+YD  YGLGEQ +ALE IQN+    K  PLTA  GG S GNP AG + +     L  +
Sbjct: 363 RGSYDESYGLGEQLAALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRN--LGTLSPL 420

Query: 429 HNITGKDRVGASLITAISLGLMLGCALWMI 458
            +I+  DR GA +ITA+    ++ C +W++
Sbjct: 421 -DISNADRAGAGIITALVGFSLISCIVWLV 449

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  391 bits (1004), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 198/379 (52%), Positives = 248/379 (65%), Gaps = 5/379 (1%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + + + T+ I  G+MDYY G +YG  VGMF  PYYWWEAG  +G ML+  +  DN  Y+S
Sbjct: 37  DSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWEAGGAWGSMLDYSWFMDNDTYDS 96

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
            +  +M+ QTG+  +YIP NQSTTEGNDDQ  W +  M A ERNF +P  E  P WL + 
Sbjct: 97  QIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP-PEDKPQWLYLA 155

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD E+CGGGLRWQIF WN+GY YKNT++NG LF +A+RL RYTGNQ+Y+D
Sbjct: 156 QAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVSNGALFHMASRLARYTGNQSYVD 215

Query: 214 VASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATG 273
            A KV+ W+ DV  I       V+DG   ++NCS +   +W+YNHG++LAG+AY+YN T 
Sbjct: 216 WAEKVYDWMWDVHVISNSTYMFVYDGVDANDNCSTVTQYQWTYNHGLLLAGSAYLYNFT- 274

Query: 274 GSPEWESHVTKILAGAADFYFRDK--IMYERACQDYNTCDNDQRSFKSIFSRMLAITSVV 331
           G   W +  TK L  AA  +F     IMYE ACQ   TC+NDQRSFK+ FSR L +T+ +
Sbjct: 275 GDEVWHNR-TKKLVTAAQVFFNSTTGIMYEAACQAALTCNNDQRSFKAYFSRFLGLTAQL 333

Query: 332 APFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNV 391
            P TR  I   +  SA AA KSC  G  G+TCGLNW K  +DG+YGLGEQ SALE I N 
Sbjct: 334 VPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWFKDGWDGMYGLGEQMSALECILNT 393

Query: 392 LIHTKAPPLTADTGGQSEG 410
               K  P TA  GG S+G
Sbjct: 394 RALMKPAPYTATNGGSSKG 412

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  374 bits (961), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 267/417 (64%), Gaps = 7/417 (1%)

Query: 43  IQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQ 102
           +  G+MDYY G++YG  +GMF  PYYWWEAG  +G ML+ WY   N  Y  V+ E++  Q
Sbjct: 38  VAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLDYWYYMQNDTYNDVIYEALQYQ 97

Query: 103 TGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEA 162
           TGD  DYIP NQSTTEGNDDQ  W +  + A ERNF +P  +  P WL + Q VFN M  
Sbjct: 98  TGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNPPPD-KPQWLYLAQAVFNTMAL 156

Query: 163 RWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWL 222
           RWD++ C GGLRWQIF WN+GY+YKN+++NG LF +AARL RYTGNQ+Y+D + KV+ W+
Sbjct: 157 RWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARLARYTGNQSYVDWSEKVYDWM 216

Query: 223 VDVKYIVLEDKAR-VFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESH 281
           +    I      + V DG +I  NC+DI   +W+YN G++LAG AY+YN T    +W   
Sbjct: 217 LGTGLISNGTTYKFVHDGVNIETNCTDITPYQWTYNQGLLLAGCAYLYNFT-QDEKWLIR 275

Query: 282 VTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDE 341
             + L G+  F F + ++YE ACQ    C+NDQRSFK+ F+R L +T+ + P TR TI +
Sbjct: 276 TNQFLNGSGVF-FNNSVIYEAACQPNKNCNNDQRSFKAYFARFLGVTAQLLPSTRDTIMQ 334

Query: 342 LIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLT 401
            I  SA AA+++C  GT G+TCG++W+   +DG YGLGEQ +ALE + N       PP T
Sbjct: 335 WIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQMAALEFMVNTRALDLPPPYT 394

Query: 402 ADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMI 458
           +  GG S G+  AG +   +P  L G  NIT   + GA +IT +    +L C++W++
Sbjct: 395 SSNGGSSTGSGAAGTEQ--KPTNL-GPLNITAGSKAGAGIITCVVGISILACSMWLV 448

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  374 bits (960), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 190/430 (44%), Positives = 263/430 (61%), Gaps = 12/430 (2%)

Query: 34  EDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYES 93
           + +   T+ +  G+MDYY G  YG  VG F  PYYWWEAG  +G +L+ WY  +N  Y  
Sbjct: 30  QSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYYMENSTYND 89

Query: 94  VLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMV 153
           +L +S++ Q G+   Y P N++TTEGNDDQ  W + +M A ER   +P  +  P  L + 
Sbjct: 90  LLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPAD-QPQRLALA 148

Query: 154 QTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLD 213
           Q VFN M  RWD E C GGLRWQIF+WN+GY YKN+++NG LF +AARL RYTGN TYL+
Sbjct: 149 QAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYTGNATYLE 208

Query: 214 VASKVFQWL--VDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNA 271
            A +V+ W+  V +  IV  +   V+DG  I++NC+++  ++W+YNHG+I+AG A++YN 
Sbjct: 209 WAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAGCAFIYNH 268

Query: 272 TGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVV 331
           T     W     + L  +A  +  +  +YE  CQ  + C+ DQRSFK+ FSR L +T+ +
Sbjct: 269 TQ-DELWHQRTLRFL-DSARIFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSRFLGLTAQL 326

Query: 332 APFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNV 391
            P +R TI   I ASA  A+ SC  G  G+TCGLNW    +DG +GLGEQ +ALEIIQN+
Sbjct: 327 VPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAALEIIQNL 386

Query: 392 LIHTKAPPLTADTGGQSEGNPDAGLDHDSQ--PAILRGMHNITGKDRVGASLITAISLGL 449
               +  P TA  GG S G+P AG    ++  P +     +I   DR GA +ITA+    
Sbjct: 387 RCLERPAPYTAMNGGTSPGDPAAGTKTKAENLPPL-----DIKAGDRAGAGIITALIGSS 441

Query: 450 MLGCALWMIF 459
            L C LW+I 
Sbjct: 442 FLACTLWLII 451

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  367 bits (942), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 193/420 (45%), Positives = 266/420 (63%), Gaps = 7/420 (1%)

Query: 40  TNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESM 99
           T+ +  G+MDYY G +YG  +GMF  PYYWWEAG  +G M++ WY   N  Y  ++ +++
Sbjct: 36  TSLVAYGLMDYYNGLQYGQTIGMFSNPYYWWEAGGAWGTMIDYWYYMQNDTYNDIIMQAL 95

Query: 100 IAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNK 159
             QTG   DY+P NQSTTEGNDDQ  W + +M A ERNF +P  +  P WL + Q VFN 
Sbjct: 96  QYQTGVNNDYVPLNQSTTEGNDDQAFWGIAVMSAAERNFTNPPAD-RPQWLYLAQAVFNT 154

Query: 160 MEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVF 219
           M  RWD + C GGLRWQIF WN+GY YKN+++NG LF + ARL R+TGN +Y++ A KV+
Sbjct: 155 MALRWDDQTCNGGLRWQIFVWNSGYDYKNSVSNGALFHIGARLARFTGNDSYVEWAEKVY 214

Query: 220 QWLVDVKYIVLEDK-ARVFDGAHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEW 278
            W+  V  I  + K A V+DG +I +NC+ +  ++W+YNHG+IL+G AY+YN TG + +W
Sbjct: 215 DWMESVNLIEDDGKGAFVYDGVNIGDNCTKVTNLQWTYNHGLILSGCAYLYNYTGDA-KW 273

Query: 279 ESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGT 338
            +   + L  A  F+ R  +M+E ACQ  +TC  DQR+FK+ FSR L +T+ + P T+ T
Sbjct: 274 YNRTERFLEYAYVFFNR-TVMFEAACQGVHTCTTDQRTFKAYFSRFLGMTAQLVPDTQHT 332

Query: 339 IDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAP 398
           I   + ASA  A++SC  G  G+TCG+NW  G +DG YGLGEQ  ALE++ N        
Sbjct: 333 IMTYMNASAYGAAQSCSGGYDGHTCGINWFYGGWDGYYGLGEQMCALEVMINTRALHVPG 392

Query: 399 PLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMI 458
           P  +  GG S G+  AG +    P  L  + NIT   R GA +ITAI    ++ C LW+I
Sbjct: 393 PYNSTNGGSSTGDGAAGTEQ--HPTNLSPL-NITSGSRAGAGIITAIIGISIIACGLWLI 449

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  363 bits (933), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 257/419 (61%), Gaps = 8/419 (1%)

Query: 43  IQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQ 102
           + KG+MDYY G +YG  +GMF  PYYWWEAG  +  +++ W+   N  Y   + E+++ Q
Sbjct: 39  VAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGAWNTLIDYWFYMKNDTYNDKVTEALLYQ 98

Query: 103 TGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEA 162
           +GD  DY+P NQST EGNDDQ  W + ++ A ER F +P  +  P WL + Q VFN M  
Sbjct: 99  SGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAERKFPNPPDD-QPQWLYLGQAVFNTMAL 157

Query: 163 RWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWL 222
           RWD   CGGGLRWQIF WN GY YKNT++NG LF +AARL  +TGN +Y+D A +V+ W+
Sbjct: 158 RWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALFHIAARLAYFTGNSSYVDWAERVYDWM 217

Query: 223 VDVKYIVLE--DKARVFDGAHIHENCS-DIKGIEWSYNHGIILAGAAYMYNATGGSPEWE 279
            DVK I  E  D   V+DG  +  NCS  +  I W+YNHG++L+G AY+Y  T G   W 
Sbjct: 218 HDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYNHGLVLSGCAYLYKET-GDKIWY 276

Query: 280 SHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTI 339
           +     L  AA  ++ D I+YE +CQ   TC+ DQRSFKS +S  LA T+ + P  R  I
Sbjct: 277 NRSKAFLETAAKLFYNDSILYEYSCQQSKTCNVDQRSFKSYYSTFLAATAQLIPDFREQI 336

Query: 340 DELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPP 399
            +++ A+A AA+++C  G  G+TCG+NW++  +DG YGLGEQ +ALE +       K  P
Sbjct: 337 MKVVNATAYAAAQACVGGYDGHTCGINWNQKGWDGQYGLGEQMAALEALVVTQAMNKPAP 396

Query: 400 LTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMI 458
             +  GG S G+  AG    + P  L+ +H IT   R GA +IT +    ++   LW++
Sbjct: 397 YNSTNGGNSTGDGAAGT--QTAPTNLKPLH-ITAGSRAGAGIITCVVGFSIIASFLWLV 452

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,973,930
Number of extensions: 2103236
Number of successful extensions: 4015
Number of sequences better than 10.0: 53
Number of HSP's gapped: 3963
Number of HSP's successfully gapped: 53
Length of query: 459
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 346
Effective length of database: 40,524,141
Effective search space: 14021352786
Effective search space used: 14021352786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)