Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR449W8.852ON29929915910.0
SAKL0D01122g8.852ON3111903195e-34
KLTH0C03652g8.852ON2762061811e-14
TDEL0B002108.852ON333661705e-13
ZYRO0C14916g8.852ON3282081698e-13
Kpol_237.38.852ON3511811671e-12
CAGL0B02409g8.852ON3611961652e-12
Kwal_27.102108.852ON2781831591e-11
KLLA0C06292g8.852ON2561621562e-11
KAFR0A028808.852ON4301781521e-10
Skud_13.228.852ON3561291484e-10
TBLA0D033108.852ON502821406e-09
YML119W8.852ON3571321396e-09
Smik_13.158.852ON3571431361e-08
NCAS0B002508.852ON3161321352e-08
NDAI0E002408.852ON519781362e-08
Suva_13.248.852ON3601311307e-08
KNAG0G034908.852ON3171461298e-08
TPHA0I003408.852ON3952331291e-07
KLTH0C02618g1.509ON902107820.11
KAFR0E028108.469ON56878721.5
Kpol_1031.668.472ON1389128694.3
Ecym_54242.162ON77587685.1
Smik_10.2175.259ON140079686.0
TPHA0B024605.268ON49277676.4
KAFR0G014503.123ON322120659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR449W
         (299 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic h...   617   0.0  
SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved...   127   5e-34
KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {O...    74   1e-14
TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}...    70   5e-13
ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa] ...    70   8e-13
Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON} co...    69   1e-12
CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {...    68   2e-12
Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {O...    66   1e-11
KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {O...    65   2e-11
KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {O...    63   1e-10
Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W (...    62   4e-10
TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {O...    59   6e-09
YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative pro...    58   6e-09
Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W (...    57   1e-08
NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852 ...    57   2e-08
NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852...    57   2e-08
Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W (...    55   7e-08
KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON...    54   8e-08
TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}...    54   1e-07
KLTH0C02618g Chr3 complement(235286..237994) [2709 bp, 902 aa] {...    36   0.11 
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...    32   1.5  
Kpol_1031.66 s1031 (166000..170169) [4170 bp, 1389 aa] {ON} (166...    31   4.3  
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    31   5.1  
Smik_10.217 Chr10 complement(358607..362809) [4203 bp, 1400 aa] ...    31   6.0  
TPHA0B02460 Chr2 (563569..565047) [1479 bp, 492 aa] {ON} Anc_5.2...    30   6.4  
KAFR0G01450 Chr7 (321501..322469) [969 bp, 322 aa] {ON} Anc_3.12...    30   9.9  

>AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML119W
          Length = 299

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/299 (100%), Positives = 299/299 (100%)

Query: 1   MSFRNNYNSYPVQDAQYSGQYYMQPFHSNGRVSLSNRTNNSNGQQKTTEYRAKGKYARSP 60
           MSFRNNYNSYPVQDAQYSGQYYMQPFHSNGRVSLSNRTNNSNGQQKTTEYRAKGKYARSP
Sbjct: 1   MSFRNNYNSYPVQDAQYSGQYYMQPFHSNGRVSLSNRTNNSNGQQKTTEYRAKGKYARSP 60

Query: 61  VIVANSYVMVNPKSGGQTVQHKQNSHHGNHGRTQVIEIPTAESISAPLHENRALKLRYMA 120
           VIVANSYVMVNPKSGGQTVQHKQNSHHGNHGRTQVIEIPTAESISAPLHENRALKLRYMA
Sbjct: 61  VIVANSYVMVNPKSGGQTVQHKQNSHHGNHGRTQVIEIPTAESISAPLHENRALKLRYMA 120

Query: 121 GPVRPEGIKVPKNPVINLSKKKAPETYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAY 180
           GPVRPEGIKVPKNPVINLSKKKAPETYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAY
Sbjct: 121 GPVRPEGIKVPKNPVINLSKKKAPETYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAY 180

Query: 181 HRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRSLASSNYSTVFQDRVDYLIVP 240
           HRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRSLASSNYSTVFQDRVDYLIVP
Sbjct: 181 HRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRSLASSNYSTVFQDRVDYLIVP 240

Query: 241 TNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEEDDNNKHYDFHSRNILPRDITSGVY 299
           TNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEEDDNNKHYDFHSRNILPRDITSGVY
Sbjct: 241 TNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEEDDNNKHYDFHSRNILPRDITSGVY 299

>SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved
           hypothetical protein
          Length = 311

 Score =  127 bits (319), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 121/190 (63%), Gaps = 15/190 (7%)

Query: 117 RYMAGPVRPEGIKVPKNPVINLSKKKAPETYYKIAEPLLNVAHDSSKSNTQRLAKLIAQR 176
           RYMA PV+ +      N V+N ++K+    YYK+ EP+L+ A          +AK+I  +
Sbjct: 130 RYMAAPVKIDYEACRTNVVVNETQKRKSIAYYKLCEPMLSEASRRKP----MIAKIIDAK 185

Query: 177 RSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERY--QVEKPVVKRRSLASSNYSTVFQDRV 234
           R++Y+  QPI+LG+   Y V SL+Q  + + +Y   ++KP   RR+LASS  + V  +++
Sbjct: 186 RNSYNERQPIKLGANTEYQVVSLEQFPDTVSKYINDLKKP--NRRTLASS--TRVANNKI 241

Query: 235 DYLIV----PTNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEEDDNNKHYD-FHSRNI 289
           D LI      T  NDSIDLSFDGKA++KSD LR++DSFS+  D++DD+    + F + NI
Sbjct: 242 DQLIAQESYSTCQNDSIDLSFDGKALDKSDILRIVDSFSVGFDDDDDDEGEPNIFSTTNI 301

Query: 290 LPRDITSGVY 299
           LPR++TSGV+
Sbjct: 302 LPREMTSGVF 311

>KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {ON}
           conserved hypothetical protein
          Length = 276

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 100/206 (48%), Gaps = 19/206 (9%)

Query: 92  RTQVIEIPTAESISAPLHENRALKLRYMAGPVRPEGIKVPKNPVINLSKKKAPETYYKIA 151
           R + +++   + I  P   +   K RY+  P + +  +     +I  S + A   YY++A
Sbjct: 81  RQRWVDVKIIDDIKCPTSNSE--KPRYLTVPGKFDVKRGRSGLIIGSSSRVA---YYRLA 135

Query: 152 EPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERY-- 209
           E    V      +  + L  +I   +  + R QPI +     Y V++L +L   +  Y  
Sbjct: 136 E----VPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLKELPNAVHEYAD 191

Query: 210 QVEKPVVKRRSLASSNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFS 269
           +V    +K  S A+       Q+  +        N+S+DLSFDGKA+NKSD  +M+DSFS
Sbjct: 192 RVSGFTLKN-SKANPLARLALQESAE-------VNESVDLSFDGKAMNKSDIFKMVDSFS 243

Query: 270 LALDEEDDNNKHYDFHSRNILPRDIT 295
           L  D++ D ++   FH  +ILP +IT
Sbjct: 244 LFPDDDTDEDEAPHFHMGSILPPEIT 269

>TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}
           Anc_8.852 YML119W
          Length = 333

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 237 LIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALDE---EDDNNKHYDFHSRNILPRD 293
           L+  ++ NDS DLSFDGKA+++SD  RM+DSFS+A  +   E+DNN   + HS+N+LP +
Sbjct: 268 LLAGSSLNDSFDLSFDGKALDRSDIFRMVDSFSVAQSDDEPEEDNNNSSNLHSKNVLPAE 327

Query: 294 ITSGVY 299
           +TS  +
Sbjct: 328 MTSSAF 333

>ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa]
           {ON} some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 328

 Score = 69.7 bits (169), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 98/208 (47%), Gaps = 36/208 (17%)

Query: 107 PLHENRALKLRYMAGPVRPEGIKVPKN---PVINLSKKKAPETY-----YKIAEPLLNVA 158
           P+ +      RY + PV  +  +       P+IN + K   ++Y     YK++ PLL V 
Sbjct: 142 PVKQENNFTNRYFSDPVDLDSARSDDGRLKPIINTASKNG-KSYPGNKIYKLSIPLL-VC 199

Query: 159 HDSSKSNTQRLAKLIAQRRSAYHRMQPIRL-GSMDGYDVTSLDQLGEIIERYQVEK---- 213
            D+ ++   ++ ++    RS YH  QP+ L G M        D     IE  Q  +    
Sbjct: 200 QDTHRALKNQIERVY---RSKYHSYQPLSLFGDMSIRYYRLEDLQSRFIEFLQKPRKPQP 256

Query: 214 PVVKRRSLASSNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALD 273
           P+   RSL  +                   NDS +LSFDGKA+++SD  RM+DSFS+AL 
Sbjct: 257 PLQVARSLNGTGA----------------LNDSFELSFDGKALDRSDIFRMVDSFSVALS 300

Query: 274 EED--DNNKHYDFHSRNILPRDITSGVY 299
           ++D  D +   +   RNILP ++T  V+
Sbjct: 301 DDDAEDESSFVNSSGRNILPAEMTGTVF 328

>Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON}
           complement(3052..4107) [1056 nt, 352 aa]
          Length = 351

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 101/181 (55%), Gaps = 18/181 (9%)

Query: 121 GPVRPEGIKVPKNPVINLSKKKAPETYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAY 180
           G ++P    +PKN  + L++KK     YK+ +P++       K++ + + +LI Q  + Y
Sbjct: 181 GKLKPLINTLPKN--VQLNRKKN----YKLNKPVM-----QEKTSYKVVVELIDQVYNKY 229

Query: 181 H-RMQPIRLGSMDGYDVTSLDQ-LGEIIERYQVEKPVVKRRSLASSNYSTVFQDRVDYLI 238
           + ++QP R  S D  D+ S++  + ++ ER +      KR      + + +   R   L+
Sbjct: 230 YNKLQPYRSISDDNIDLGSIENAIEKLCERLENSTATNKRTPNNVHDIAKISNSRT--LL 287

Query: 239 VPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEEDDNNKHYDF---HSRNILPRDIT 295
             T  NDS +LSFDGKA+++SD LRM+DSFS+A  ++DD N + +F    S   LP +IT
Sbjct: 288 TSTIGNDSFELSFDGKALDRSDILRMVDSFSVAFSDDDDENDNGEFIASLSNKFLPAEIT 347

Query: 296 S 296
           S
Sbjct: 348 S 348

>CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119w
          Length = 361

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 94/196 (47%), Gaps = 29/196 (14%)

Query: 109 HENRALKLRYMAGPVRPEGIKVPKNPVINLS------KKKAPETYYKIAEPLLNVAHDSS 162
           +E   LK RY  GPV+       +   +N+S      K+K P   YK+A PL      S 
Sbjct: 183 YETPNLKNRYF-GPVQKVEDNTDRKANVNISYKNSKSKQKKPPVVYKLATPLA-----SK 236

Query: 163 KSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRSLA 222
             N    + L+      Y+++QPI+   +    + +   L +I   + ++    K++S  
Sbjct: 237 DVNALDNSFLLQPDTPRYYKIQPIKF--LHSEPIENFAGLQDI-STHLLDNNTPKKKSHI 293

Query: 223 SSNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEEDDNNKHY 282
           S         RV     P   NDS DLSFDGKA+++SD  RM+DSFS+A  +++DN +  
Sbjct: 294 S---------RVQ--PPPAATNDSFDLSFDGKALDRSDIFRMVDSFSIAFSDDEDNEESS 342

Query: 283 DFHSRN---ILPRDIT 295
               RN   ILP D+T
Sbjct: 343 FISRRNNNDILPADMT 358

>Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {ON}
           YML119W - Hypothetical ORF [contig 39] FULL
          Length = 278

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 88/183 (48%), Gaps = 18/183 (9%)

Query: 90  HGRTQVIEIPTAESISAPLHENRALKLRYMAGPVRPEGIKVPKNPVINLSKKKAPETYYK 149
           + R + IE  T   +  P+   +A   RY+A P + +  +   + V     +K    +YK
Sbjct: 79  NSRPRWIEAKTISDVEKPVA--KAGNQRYLASPCKIDYKRGKSSSVAEFVPQKV--VHYK 134

Query: 150 IAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERY 209
           + E    +   S    TQ +  +I  ++  Y + QPI       Y V +L +L   ++++
Sbjct: 135 LEE----LPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALGELSGAVKKF 190

Query: 210 QVEKPV--VKRRSLASSNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDS 267
             E+    + R S A+       QD       P +AND+ DLSFDGKA+N+SD  +++DS
Sbjct: 191 -TERSTRRIIRASKANPLTRLTMQD-------PGDANDTADLSFDGKAMNRSDIFKIVDS 242

Query: 268 FSL 270
           FSL
Sbjct: 243 FSL 245

>KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 256

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 88/162 (54%), Gaps = 22/162 (13%)

Query: 148 YKIAEPLLNVAHDSSKSNTQ---RLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGE 204
           YKI  P+      SSKS+ +    + KLI +    +   +  +L + + +  T+LD L  
Sbjct: 107 YKIDVPI------SSKSDMEISPVITKLINE---THESAEAFKLCNDNRFGYTTLDALPA 157

Query: 205 IIERYQVEKPVVKRRSLASSNYSTVFQDRVDYLIVPTN----ANDSIDLSFDGKAINKSD 260
           ++ +Y  +   V+R  L     +    +RVD L+   N    ANDSI+LSFDGKA+NK+D
Sbjct: 158 VLSKYISQNMSVQR--LPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFDGKAMNKND 215

Query: 261 FLRMMDSFSLALDEEDDNNKHYDF---HSRNILPRDITSGVY 299
             R++DSFS+A D+++      D      RNIL R++T GV+
Sbjct: 216 IFRIVDSFSVAFDDDEYGEDGDDEYVKQPRNILTREVT-GVF 256

>KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {ON}
           Anc_8.852 YML119W
          Length = 430

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 88/178 (49%), Gaps = 32/178 (17%)

Query: 148 YKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLG-EII 206
           YK++ P+L     S K  +    K+ +         QP+ +     + +  L++   E+I
Sbjct: 253 YKLSTPIL----SSIKYGSTLSKKIDSHYNDQNISAQPLFIAGNKNFKIDELNEASVELI 308

Query: 207 ERY--QVEKPVVKRRSLASSNY-STVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLR 263
           ++Y  Q++K    R  + +S+  S+  Q +   LI  +N NDS DLSFDGKA++++D  R
Sbjct: 309 DKYLSQLDKSSTGRTLIKNSSLNSSKMQRQRRPLINVSNYNDSFDLSFDGKALDRNDIFR 368

Query: 264 MMDSFSLALDEEDD----------------NNKHYD--------FHSRNILPRDITSG 297
           M+DSFS+A+ + +                 NN HY+         +S NILP +ITS 
Sbjct: 369 MVDSFSIAVSDNESSDIIANSSDISYTQTGNNIHYNNEKDNYTTTNSNNILPAEITSS 426

>Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W
           (REAL)
          Length = 356

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 72/129 (55%), Gaps = 16/129 (12%)

Query: 179 AYHRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRSLASSNYSTV-------FQ 231
           +YH +QPI+L +     +  L  L E+   + V  P  K++S   +N   V        +
Sbjct: 228 SYHSLQPIQLSTDRKTRI--LKSLDELCGEHLVLLP--KQQSQPQNNIKPVKNLPNINTK 283

Query: 232 DRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEEDDNNKHYDFHSRN--- 288
            R    I  T AN+S +LSFDGKA+++SD  RM+DSFS+A+ +ED+++   +F  RN   
Sbjct: 284 QRTSTSIG-TTANESFELSFDGKAMDRSDIFRMVDSFSIAISDEDEDDDEDNFQQRNKSN 342

Query: 289 -ILPRDITS 296
            ILP +I S
Sbjct: 343 RILPAEILS 351

>TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {ON}
           Anc_8.852 YML119W
          Length = 502

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 47/82 (57%), Gaps = 27/82 (32%)

Query: 245 DSIDLSFDGKAINKSDFLRMMDSFSLAL-DEEDDN----------------------NK- 280
           +S DLSFDGKA+++SD LRM+DSFS+A  DEE+DN                      NK 
Sbjct: 421 NSFDLSFDGKALDRSDILRMVDSFSVAFSDEENDNEINIDKNKDKEKEKDPNTTTTMNKK 480

Query: 281 ---HYDFHSRNILPRDITSGVY 299
               ++ HSRNILP ++TS  +
Sbjct: 481 SMLRFNPHSRNILPAEMTSSAF 502

>YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative
           protein of unknown function; YML119W is not an essential
           gene; potential Cdc28p substrate
          Length = 357

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 78/132 (59%), Gaps = 23/132 (17%)

Query: 180 YHRMQPIRLGSMDGYDVT-SLDQL------GEIIERYQVE---KPVVKRRSLASSNYSTV 229
           YH +QPI+L +     ++ SLD+L        + ++ Q++   KPV   ++L +SN    
Sbjct: 229 YHFLQPIQLSTNSKTRISKSLDELCGVQLTSTLRQQKQLQGNSKPV---KNLPNSNA--- 282

Query: 230 FQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALD-EEDDNNKHYDFHSRN 288
            + R     V TNAN+S +LSFDGKA+++SD  RM+DSFS+A+  E++++ +   F  R+
Sbjct: 283 -KQRAG-ASVSTNANESFELSFDGKAMDRSDIFRMVDSFSIAISDEDEEDEEEDSFQQRS 340

Query: 289 ----ILPRDITS 296
               ILP +I S
Sbjct: 341 ANNRILPAEILS 352

>Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W
           (REAL)
          Length = 357

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 68/143 (47%), Gaps = 32/143 (22%)

Query: 146 TYYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVT-SLDQLGE 204
           T YK++ P+     D SK     L  L  ++   YH  QPI+L       ++ +LD+L E
Sbjct: 196 TTYKLSSPVYETIDDISKKVIILLISLKFEKN--YHFWQPIQLSVNKKTRISKTLDELCE 253

Query: 205 IIERYQVEKPVVKRRSLASS-NYSTVFQDRVDYLIVPTN--------------ANDSIDL 249
                           LAS+    +  Q+ V  L  P+N              AN+S +L
Sbjct: 254 --------------EQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFEL 299

Query: 250 SFDGKAINKSDFLRMMDSFSLAL 272
           SFDGKA+++SD  RM+DSFS+A+
Sbjct: 300 SFDGKAMDRSDIFRMVDSFSIAI 322

>NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852
           YML119W
          Length = 316

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 27/132 (20%)

Query: 166 TQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKR--RSLAS 223
           T+++  +I Q  +++         ++D  +   L  + + +E  +++ P  K+  RSL +
Sbjct: 202 TKKMNSIIKQHLNSF---------NIDDTNTKDLKLINKKLESLKLQSPSQKKSHRSLMN 252

Query: 224 SNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLAL-DEEDDNNKHY 282
             +             P    +S +LSFDGKA++KSD LR++DSF++A  DEE D N++ 
Sbjct: 253 LTHQ------------PATMENSFELSFDGKALDKSDILRIVDSFTMAFSDEEIDTNEN- 299

Query: 283 DFHSRNILPRDI 294
              + NILP D+
Sbjct: 300 --ENNNILPADL 309

>NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852
           YML119W
          Length = 519

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 16/78 (20%)

Query: 234 VDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALDEE---------DDNNKHYDF 284
           ++ +   +N NDS DLSFDGKA+++SD  RM+DSF++AL ++         D NNK   F
Sbjct: 421 INVITANSNPNDSFDLSFDGKAMDRSDIFRMVDSFTMALSDDERELSGIILDTNNKAKKF 480

Query: 285 HSR-------NILPRDIT 295
             +       NILP +IT
Sbjct: 481 DLQLKDNININILPAEIT 498

>Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W
           (REAL)
          Length = 360

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 69/131 (52%), Gaps = 15/131 (11%)

Query: 179 AYHRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRSLASSNY-------STVFQ 231
           +YH +QPI+L +     V+    + E+        P  K +    SN        +T  +
Sbjct: 229 SYHFLQPIQLSTNKKTRVS--KSIEELCRDLLSPPPPSKSQHQLQSNIKPMKNAQNTNTK 286

Query: 232 DRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLALD-EEDDNNKHYDFHSRN-- 288
            R   +   TNAN+S +LSFDGKA+++SD  RM+DSFS+A+  ++DD++    F  RN  
Sbjct: 287 QRTS-INAGTNANESFELSFDGKAMDRSDIFRMVDSFSIAISDDDDDDDDEDSFQQRNRN 345

Query: 289 --ILPRDITSG 297
             ILP +I S 
Sbjct: 346 SRILPAEILSN 356

>KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON}
           Anc_8.852 YML119W
          Length = 317

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 74/146 (50%), Gaps = 7/146 (4%)

Query: 154 LLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRL--GSMDGYDVTSLDQLGEIIERYQV 211
           LL      +K  T  L  L   + S+  R +P+ L  G    Y ++ L  + E+++    
Sbjct: 171 LLRPLERHTKQRTTALNSLFVSKTSSI-RGEPLLLFAGKRPVYTLSDLQNM-ELVKGADR 228

Query: 212 EKPVVKRRSLASSNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRMMDSFSLA 271
               V+ R +   N  T  +  VD +      NDS DLSFDGKA+++SD  RM+DSFS+A
Sbjct: 229 PTETVEPRQVEEKNV-TGSKRPVDQVASGGGHNDSFDLSFDGKAMDRSDIFRMVDSFSIA 287

Query: 272 LDEEDDNNKHYDFHS--RNILPRDIT 295
            DE+DD +         RNILP +IT
Sbjct: 288 PDEDDDEDPSPTGRQVPRNILPAEIT 313

>TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}
           Anc_8.852 YML119W
          Length = 395

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 99/233 (42%), Gaps = 50/233 (21%)

Query: 109 HENRALKLRYMAGPV-----RPEGIKVPKNPVINLSKKKAPET---YYKIAEPLLNVAHD 160
           H N  +  +Y + PV     +    K+   PVINL  KK  ++    YK++ P+     D
Sbjct: 171 HSNDDICNKYFSEPVDLNYYKDSDGKIK--PVINLVSKKTQQSIKKVYKLSVPI--NYKD 226

Query: 161 SSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRS 220
           ++ S    L +   + R  Y + Q  +  + D   V     L  I+E+ +       + +
Sbjct: 227 TTYSGVSSLIE--TEYRPLYSKDQSFKFYNKDS--VLLFKTLDAIVEKIKASNRKETKEN 282

Query: 221 LASSNYSTVFQDRVDYLIVPTNA--------------NDSIDLSFDGKAINKSDFLRMMD 266
            A++    +  ++   ++   N               NDS +LSFDGKA+++SD LRM+D
Sbjct: 283 DANTTLEKIKLNKSSRVLKSINERSFINNTGLKLTSNNDSFELSFDGKALDRSDILRMVD 342

Query: 267 SFSLA------------------LDEE--DDNNKHYDFHSRNILPRDITSGVY 299
           SFS+A                   DEE     NK+    +  ILP +IT G +
Sbjct: 343 SFSVAFSDDDGDNDDYNEQAESTFDEEFGSKENKYLRTLTNKILPAEITGGGF 395

>KLTH0C02618g Chr3 complement(235286..237994) [2709 bp, 902 aa] {ON}
           weakly similar to uniprot|P36044 Saccharomyces
           cerevisiae YKL201C MNN4 Putative positive regulator of
           mannosylphosphate transferase (Mnn6p) involved in
           mannosylphosphorylation of N-linked oligosaccharides
           expression increases in late-logarithmic and stationary
           growth phases
          Length = 902

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 12/107 (11%)

Query: 126 EGIKVPKNPVINLSKKKAPETYYKIAE----PLLNVAHDSSKSNTQRLAKLIAQ--RRSA 179
           EGI+V  +P+ +LS +     Y  IAE     LL++ H+S K +T RL +L  Q    +A
Sbjct: 730 EGIEVVNSPLNSLSIEDVGLLYKNIAELREVELLSLLHNSRKQSTYRLKELELQYANGTA 789

Query: 180 YHRMQPI-RLGSMDGYDVTSLDQLGEIIERYQVEKPVVKRRSLASSN 225
           + R++ + RL    G D+  L +    I+  Q E    K R+LA+ N
Sbjct: 790 HQRIEELRRLEEQLGSDLCPLTK-DPYIQHLQRE----KWRALATPN 831

>KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {ON}
           Anc_8.469 YDR243C
          Length = 568

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 225 NYSTVFQDRVDYLIVPTNANDSIDLSFDGK--------AINKSDFLRMMDSFSLALDEED 276
           NY  +   +   L+   N ND ++ ++ GK        A+N  D+   ++ F++ +  + 
Sbjct: 98  NYKPIVSVKASELLQKENKNDVVETAYIGKPWREKTYDAMNDRDWKIFLEDFNITMKTKV 157

Query: 277 DNNKHYDFHSRNILPRDI 294
             +   ++H  N++P+DI
Sbjct: 158 TTHPLRNWHELNLIPKDI 175

>Kpol_1031.66 s1031 (166000..170169) [4170 bp, 1389 aa] {ON}
           (166000..170169) [4170 nt, 1390 aa]
          Length = 1389

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 28/128 (21%)

Query: 191 MDGYDVTSLDQLGEIIERYQVEKPV-------------VKRRSLASSNYSTVFQDRVDYL 237
           + GYD+  + Q+GE I+     KP+                RSL SSN        ++ L
Sbjct: 765 LSGYDINHISQIGEKID---ANKPIFLFAPELGTVNLKALSRSLESSNLGET-NTALNTL 820

Query: 238 IVPTNANDSIDLSFDGKAINKSDFLRMMDSFSL--------ALDEEDDNNKHY-DFHSRN 288
           +V  +A+ S+D+S D K +   D L ++ +  L        +L  E  N+ H  ++  + 
Sbjct: 821 LV-ISADVSLDISLD-KCLELLDVLSVLGTKLLTNLSSNPKSLRNEQLNSSHCEEYDVKT 878

Query: 289 ILPRDITS 296
            L RD TS
Sbjct: 879 FLARDFTS 886

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 11/87 (12%)

Query: 153 PLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGS----MDGYDVTSLDQLGEIIER 208
           P L+   DS  S+   +   + QRR  Y  +QP    S    +    + +   LG +   
Sbjct: 654 PSLDSEDDSKNSSAGPVNAGVQQRRQPYQGVQPGSTASPADHLPDPTIVAARALGSL--- 710

Query: 209 YQVEKPVVKRRSLASSNYSTVFQDRVD 235
               KP+ K++SL+  NYS    D  D
Sbjct: 711 ----KPIAKKKSLSDLNYSLEIDDPKD 733

>Smik_10.217 Chr10 complement(358607..362809) [4203 bp, 1400 aa] {ON}
            YJL042W (REAL)
          Length = 1400

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 13/79 (16%)

Query: 227  STVFQDRVDYLIVPTNANDSIDLSF-------------DGKAINKSDFLRMMDSFSLALD 273
            S++    +DY+ +P N  + I L               D K I  + F  + D  S+ L 
Sbjct: 1015 SSLMTLDIDYVYMPENIKEKISLYALRNIQGELKRVHDDDKDIKDTQFSSLQDQLSVLLT 1074

Query: 274  EEDDNNKHYDFHSRNILPR 292
            E+ DN++HY+    N + +
Sbjct: 1075 EKADNSEHYNKMVENFMAK 1093

>TPHA0B02460 Chr2 (563569..565047) [1479 bp, 492 aa] {ON} Anc_5.268
           YHR024C
          Length = 492

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 37/77 (48%)

Query: 110 ENRALKLRYMAGPVRPEGIKVPKNPVINLSKKKAPETYYKIAEPLLNVAHDSSKSNTQRL 169
           E++ ++L  M   ++ +G K+P   +I + +   PE   ++AE +      +    T + 
Sbjct: 392 ESKLVELEDMGRQIQAQGKKIPLTEIIRMIEALTPEDIRRVAETVFTGKVKNIGEGTGKA 451

Query: 170 AKLIAQRRSAYHRMQPI 186
             +I  +R A+  ++ +
Sbjct: 452 TVVIKGKREAFGDVESV 468

>KAFR0G01450 Chr7 (321501..322469) [969 bp, 322 aa] {ON} Anc_3.123
           YBR141C
          Length = 322

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 16/120 (13%)

Query: 156 NVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEIIERYQVEKPV 215
           N   DSSK   Q + +LI + +   +RM+ + +GS+   +  S   + E + R  +    
Sbjct: 125 NRGGDSSKILVQWIRELIDEGKLERNRMKALEIGSLSKMNKISTSGIFEPVVRIDLNN-- 182

Query: 216 VKRRSLASSNYSTVFQDRVDYLIVPTNANDSID-------LSFDGKAINKSDFLRMMDSF 268
                 ++ N   + QD +   I PT  N   D       L+F  +AI++   LR    F
Sbjct: 183 ------SNDNEGIIRQDFMKRPI-PTGENGKFDLISCSLVLNFVAQAIDRGRMLRRFKDF 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,479,341
Number of extensions: 1555910
Number of successful extensions: 4693
Number of sequences better than 10.0: 75
Number of HSP's gapped: 4851
Number of HSP's successfully gapped: 75
Length of query: 299
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 190
Effective length of database: 40,982,805
Effective search space: 7786732950
Effective search space used: 7786732950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)