Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR448W8.853ON81781742840.0
SAKL0D01078g8.853ON93682418050.0
KLLA0C06314g8.853ON98382217480.0
Kwal_27.102138.853ON93681815760.0
KLTH0C03674g8.853ON94882315070.0
ZYRO0C14938g8.853ON96682715030.0
Skud_13.4608.853ON96983614990.0
Smik_13.5038.853ON96983214890.0
Suva_13.4778.853ON96983214890.0
YMR287C (DSS1)8.853ON96983114800.0
TDEL0B002208.853ON93582614460.0
KNAG0E011408.853ON92981714270.0
CAGL0M07051g8.853ON92381813571e-174
KAFR0L019708.853ON93281713301e-170
Kpol_237.48.853ON91682113101e-167
NCAS0C003008.853ON94082613021e-165
NDAI0K003208.853ON96283011821e-147
TPHA0I003508.853ON94382611501e-143
TBLA0B029208.853ON102989411451e-141
TBLA0D050701.367ON9973791308e-07
Kpol_1043.421.367ON9883651219e-06
TPHA0A023201.367ON10153451182e-05
Ecym_27151.367ON9883551173e-05
SAKL0D10186g1.367ON9883521164e-05
ZYRO0G01166g1.367ON9933561164e-05
Skud_15.1371.367ON10303521156e-05
Kwal_34.162451.367ON9863711146e-05
KLLA0A10835g1.367ON10083721121e-04
KLTH0H13420g1.367ON9863681121e-04
CAGL0H04411g1.367ON10073721102e-04
KNAG0C019501.367ON9963581083e-04
Suva_15.1471.367ON10013521084e-04
YOL021C (DIS3)1.367ON10013541084e-04
Smik_15.1451.367ON10013531066e-04
TDEL0D023801.367ON9973521057e-04
AEL031C1.367ON9973691040.001
KAFR0C045301.367ON10003661010.002
NCAS0D005901.367ON998354930.021
NDAI0H035601.367ON1012353920.028
KLLA0D12650gsingletonON65180762.1
NDAI0C040505.307ON126039726.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR448W
         (817 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...  1654   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   699   0.0  
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   677   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   611   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   585   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   583   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...   582   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...   578   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...   578   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...   574   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   561   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   554   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   527   e-174
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   516   e-170
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   509   e-167
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   506   e-165
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   459   e-147
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   447   e-143
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   445   e-141
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    55   8e-07
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    51   9e-06
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    50   2e-05
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    50   3e-05
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    49   4e-05
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    49   4e-05
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    49   6e-05
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    49   6e-05
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    48   1e-04
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    48   1e-04
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    47   2e-04
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    46   3e-04
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    46   4e-04
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    46   4e-04
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    45   6e-04
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    45   7e-04
AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON} S...    45   0.001
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    44   0.002
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    40   0.021
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    40   0.028
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    34   2.1  
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    32   6.0  

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score = 1654 bits (4284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 802/817 (98%), Positives = 802/817 (98%)

Query: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRL 60
           MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPT               VCYATKSDVRL
Sbjct: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRL 60

Query: 61  RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120
           RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA
Sbjct: 61  RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120

Query: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIG 180
           QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIG
Sbjct: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIG 180

Query: 181 QGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLP 240
           QGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLP
Sbjct: 181 QGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLP 240

Query: 241 LRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSN 300
           LRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSN
Sbjct: 241 LRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSN 300

Query: 301 AALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTAL 360
           AALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTAL
Sbjct: 301 AALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTAL 360

Query: 361 EQKVYDLASPPLDQEEPGPRKEFSGVCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAY 420
           EQKVYDLASPPLDQEEPGPRKEFSGVCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAY
Sbjct: 361 EQKVYDLASPPLDQEEPGPRKEFSGVCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAY 420

Query: 421 PYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTI 480
           PYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTI
Sbjct: 421 PYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTI 480

Query: 481 TISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASDLRLLYKV 540
           TISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASDLRLLYKV
Sbjct: 481 TISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASDLRLLYKV 540

Query: 541 AESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMIMAN 600
           AESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMIMAN
Sbjct: 541 AESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMIMAN 600

Query: 601 SLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAAFLTNS 660
           SLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAAFLTNS
Sbjct: 601 SLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAAFLTNS 660

Query: 661 HYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNWHIL 720
           HYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNWHIL
Sbjct: 661 HYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNWHIL 720

Query: 721 ARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYSSGK 780
           ARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYSSGK
Sbjct: 721 ARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYSSGK 780

Query: 781 LKIPSGANNPAVGSTVANCFITRLDSLDGTLRFEMKS 817
           LKIPSGANNPAVGSTVANCFITRLDSLDGTLRFEMKS
Sbjct: 781 LKIPSGANNPAVGSTVANCFITRLDSLDGTLRFEMKS 817

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/824 (42%), Positives = 530/824 (64%), Gaps = 13/824 (1%)

Query: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRL 60
           + P DL  T L+IGDL +L + P +L +CV+ PT               + +A ++ + L
Sbjct: 114 LSPSDLMNTPLKIGDLVLLRSNPTQLSMCVDLPTDIMDPRYTFASMDGGLQFAARTMIML 173

Query: 61  RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120
           R+P  HK+ L  L+  E  H Y P+G VKN+ + TY+LP+  R+L  +    EI+++A  
Sbjct: 174 RIPSCHKQELDGLVQLERKHSYEPIGVVKNSPTHTYVLPILARQLITSYVPFEITKKAWN 233

Query: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNS----PGEASEKVAKLLAE 176
           Q+P V  KLELLHR LQ   GPWQ+S+F L +LV  L+L  +     G   + ++ L  +
Sbjct: 234 QVPIVSKKLELLHRFLQRSTGPWQISIFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQK 293

Query: 177 LNIGQGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSV 236
           + +    YC   + NL +  P ++D + +L+TYW +++QQ  Q+WG I  HR + +P+SV
Sbjct: 294 VGLDSNLYC-LGEQNLHVNPPNKIDASYFLSTYWSLVKQQELQIWGGIQTHRGILTPISV 352

Query: 237 TVLPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGN 296
           TVLPL  + L+Y+ ++  +K+D+Y  LDEFA LVN+  YK   + +  ++Q+L++Y AGN
Sbjct: 353 TVLPLNSEHLYYENVVSTLKQDNYRMLDEFAELVNKKNYKPIQNRFPQLIQILKNYAAGN 412

Query: 297 INSNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNP 356
            N+N A+I LV+++FR+L  YKE + TR +  +LL Q+ P+   NPL  N  L LP+++ 
Sbjct: 413 FNNNGAMITLVSKIFRKLHTYKERDTTRDMCHELLTQISPDKLINPLLLNKDLGLPMASQ 472

Query: 357 RTALEQKVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLH 415
           R+ALEQ VYD++ PPL +++   R +F  +  YCIDS  AHEIDDG+SIE L   +YRLH
Sbjct: 473 RSALEQVVYDISKPPLTEDDSYVRHDFGDMPVYCIDSETAHEIDDGISIETLSEKKYRLH 532

Query: 416 VHIAYPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDK 475
           +HIA P S F KS  P     D V+DIAF+R+FTTYLPD+V PM+P+SY RA+DLG+   
Sbjct: 533 IHIADPASSFAKSTDPEAR--DDVLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGN 590

Query: 476 PTKTITISVDVDLSK-KLRVVDEATLQIALGTTRTSKRVTYDYVDDLLE-SKRQDAEASD 533
            TKT++ S+D+   +  LR++D+ T ++ LG      RVTY+ VD LL+  ++Q  EASD
Sbjct: 591 KTKTLSFSIDIYFHQGTLRLLDD-TFKMRLGLVSRFPRVTYEKVDILLQYPEKQPKEASD 649

Query: 534 LRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLV 592
           L+L+Y+VA+SLR +R   + AI+FG+  N GL+ L+P+E G+L  +   D   +KS  LV
Sbjct: 650 LKLMYEVAKSLRAKRVKNQDAIIFGEGFNKGLVKLSPDETGELTKISFEDQVESKSTVLV 709

Query: 593 SELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVK 652
           SE+MI+AN+L G YF +N IPGV+R   EL LK  A  +Y  ++   +     +  D+  
Sbjct: 710 SEMMILANTLTGGYFKKNKIPGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINT 769

Query: 653 VAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQI 712
           +++ L +S Y+  P +H M+G  EYLT+TSPLRR PDMINH+Q+HRHLR LP CFSQ+++
Sbjct: 770 ISSLLNSSFYTGKPKKHEMIGASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEV 829

Query: 713 DALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIP 772
           D + WHI +RDV LK+A++ S+ +WTL +LK++L  + D R+ ++VTS+P  G V C  P
Sbjct: 830 DGITWHIQSRDVVLKNAARMSATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFP 889

Query: 773 GIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815
            +  + G L + P     PA+G  +  C +T+LD LDG +  E+
Sbjct: 890 NLNAARGTLNLDPKHTPYPAIGDLIHKCKLTKLDCLDGVIELEI 933

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/822 (41%), Positives = 508/822 (61%), Gaps = 10/822 (1%)

Query: 3   PGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRV 62
           P  +  +TL  GD+CVL   P +L+VCV+ P+               V YA K+ V LR 
Sbjct: 157 PSAIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRF 216

Query: 63  PGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQL 122
           P +       +L RE  HGY+PVG+VKN+   T+++P   RR+  +     I+  AV QL
Sbjct: 217 PTIFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQL 276

Query: 123 PEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQG 182
           P +  KLEL+HR+LQS   PWQ+ + KLV++ + LEL N+     + +A    +  +   
Sbjct: 277 PIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNN---IEKSIATAFMKSGLSSD 333

Query: 183 SYCSAADINLRMAA--PKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLP 240
           +  S A+ +  +++  P +V+ +  LA YW +L QQG QMWG+++ HR +F P +VTVLP
Sbjct: 334 ALYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVLP 393

Query: 241 LRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSN 300
           L  Q L Y  ++  +++     ++  A L+N+        ++  ++ LLRDY AGN+  N
Sbjct: 394 LTKQHLHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNLEHN 453

Query: 301 AALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTAL 360
             +  L++ LFR+LD YKE  ++R + F LL ++ P  P NPL  NH+L+LP++N R  L
Sbjct: 454 DTITSLISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNNERVKL 513

Query: 361 EQKVYDLASPPLDQEEPGPRKEFSG-VCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIA 419
           EQK+YDLA PP  +     R E+   +CYCIDSPDAHEIDD VSI+ L G++YR+++H+A
Sbjct: 514 EQKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKYRIYIHVA 573

Query: 420 YPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKT 479
            P SLF ++   G     PV+DIA++RAFTTYLPD VFPM+P +Y R+SDLGQ+ KPTK 
Sbjct: 574 DPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDLGQFGKPTKA 633

Query: 480 ITISVDVDLSK-KLRVVDEATLQIALGTTRTSKRVTYDYVDDLLE---SKRQDAEASDLR 535
           +T SVD   SK K   + + +L++ L     S R+TY+ VD+LL+   +K +  +  DL+
Sbjct: 634 VTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTTKPKSGKHEDLK 693

Query: 536 LLYKVAESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTKSNTLVSEL 595
            L+ +A++LR +R V   A++F +   G++SL+P+++ +L+ V   D   TKS  LVSEL
Sbjct: 694 TLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSELVEVSFKDQIETKSTILVSEL 753

Query: 596 MIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAA 655
           MI+ANSL   YF EN IPG+YRG   L +  +A++    ++   ++   +S +D+ K+ +
Sbjct: 754 MILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQENKIISKADIAKMKS 813

Query: 656 FLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDAL 715
           FLT+S YSS P  H M+GT  YLTITSPLRR PD++NH+QLHR L+ LP  + Q Q+D +
Sbjct: 814 FLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHRTLKGLPLLYKQSQLDGM 873

Query: 716 NWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIF 775
            WHIL RDV LK+AS  +  +WTL +LK ++       W L +TSL  NG+ HC I    
Sbjct: 874 VWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKLQITSLTDNGYAHCVILDKA 933

Query: 776 YSSGKLKIPSGANNPAVGSTVANCFITRLDSLDGTLRFEMKS 817
           ++ G+LKI    N P VG  +++C I+ +  LDG L+FE  S
Sbjct: 934 FAVGQLKINLNKNPPLVGDQISDCEISNIQCLDGILQFEPTS 975

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/818 (40%), Positives = 498/818 (60%), Gaps = 9/818 (1%)

Query: 3   PGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRV 62
           P +L  + L+IGDL +L + P +L  CVE PT               + YA +S + LR+
Sbjct: 122 PKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRI 181

Query: 63  PGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQL 122
           P  H+R   +L+  E  +  A +GTVK++  +T++LP+  R+L+ +    +I++QA +++
Sbjct: 182 PSFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRM 241

Query: 123 PEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQG 182
             +  KLELLHR LQ   GPWQ+S+FKL  +   L+L       +E   K L +     G
Sbjct: 242 AILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNG 301

Query: 183 SYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLR 242
           S  S    +  +   + VD A YLAT+W + QQQ + +WG    H+A+ +PLSVTVLPL 
Sbjct: 302 SPNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLA 361

Query: 243 DQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAA 302
            + L+Y+ +L+D+K+D++  + +FA LVN G +  A S      Q+L+DY AGN ++N A
Sbjct: 362 SRHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGA 421

Query: 303 LIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTALEQ 362
           +  +V++LFR +D +K  ++TR +  +L+ +L      NPL  +  L LP S+  TALE+
Sbjct: 422 MATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTLNPLLLSDDLALPSSSANTALEE 481

Query: 363 KVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYP 421
           K+Y++A P   ++ P  R +FS +  YCIDS  AHEIDDG+SIE L  + + LH+HIA P
Sbjct: 482 KIYEMAQPSTKEDIPA-RFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADP 540

Query: 422 YSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTIT 481
            SLF +    G    D V +IA+RR FTTYLPDLV PM+P+S+  A  LG  +  +KT++
Sbjct: 541 VSLFTED--GGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVS 598

Query: 482 ISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKR-QDAEASDLRLLYKV 540
            SV++ +      +DE + ++ LG      +VTYD VD +L+    +  EA +LR LY++
Sbjct: 599 FSVNIKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQI 658

Query: 541 AESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMIMA 599
           +  L+ +R   + AI+FG+  N GL+ L   E G+L  +   D   T S  LVSE+MI+A
Sbjct: 659 SLLLQSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILA 718

Query: 600 NSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSS-SDLVKVAAFLT 658
           N+LAGRYF  N IPGV+R   ELLLK  A   Y SL RAM Q  S+ +  D+ K+++ L 
Sbjct: 719 NTLAGRYFQVNKIPGVFRCYKELLLKSGARESYESL-RAMTQSTSLPAVEDIAKLSSLLN 777

Query: 659 NSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNWH 718
           +S Y+ TP RH+M+G   YLT+TSPLRR PD+INH+Q+ +HL   P  FS+  ID + WH
Sbjct: 778 SSFYTGTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWH 837

Query: 719 ILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYSS 778
           + +RD+ ++ A++ S+ FWTL +LK    + PD++  ++VTS+P  GFV C +P +  + 
Sbjct: 838 LQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAAR 897

Query: 779 GKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815
           G LK+ P  + + A+G  + NC IT+LD LD  +  +M
Sbjct: 898 GILKLKPEVSADVAIGDLMHNCVITKLDCLDAVMELKM 935

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/823 (39%), Positives = 485/823 (58%), Gaps = 15/823 (1%)

Query: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRL 60
           M P  L  ++L+IGDL +L + P +L +CVE PT               + +  ++ + L
Sbjct: 134 MHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILL 193

Query: 61  RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120
           R+P  HK   +YL+  E       +G VK++  +T++L +  R+L+ +    EI++ A  
Sbjct: 194 RIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWN 253

Query: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEK-VAKLLAELNI 179
           ++     KLELLHR LQ   GPWQ+S+FKL +LV  L++      ++   +  +L E   
Sbjct: 254 RMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGSYIEGILKE--- 310

Query: 180 GQGSYCSAADI-NLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTV 238
             G +  A  I +    + K +D + +LATYW ++QQQ   +WG I  HRA+ +P+SVTV
Sbjct: 311 -AGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTV 369

Query: 239 LPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNIN 298
           LPL    L+Y  +L+++K+D+YAAL+ FA L+N G+   A   Y  + +LLRDY AGN +
Sbjct: 370 LPLTSHHLYYKEVLKELKKDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFH 429

Query: 299 SNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRT 358
           +N  +I +V++LFR+LD Y+  ++TR +  + L +L  E+  NP   ++++  P ++ R 
Sbjct: 430 NNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERA 489

Query: 359 ALEQKVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVH 417
            LEQK+YDLA P    ++   R +F  +  YCIDS  AHEIDDG+SIE    + Y LH+H
Sbjct: 490 VLEQKIYDLALPN-QNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIH 548

Query: 418 IAYPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPT 477
           IA P SLF  S   G    + + +IA +R FT+YLPD V PM+PKSY++A DLG+    +
Sbjct: 549 IADPVSLFSNS-QEGSFSKE-IWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIAS 606

Query: 478 KTITISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDA--EASDLR 535
           KT++ SVD+   K    + E T  + LG      RVTY  VD +L    QDA  +  +LR
Sbjct: 607 KTLSFSVDIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRIL-GLEQDASQQTQELR 665

Query: 536 LLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLVSE 594
            L+K+A  LR +R   ++AI+FG+  N GL+ L P +      +   D + T S  LVSE
Sbjct: 666 TLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSE 725

Query: 595 LMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVA 654
           +MI+AN++AG++F +  IPGV+R    L LK  A   Y SL+  M  +   S+ D+ K++
Sbjct: 726 IMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLS 785

Query: 655 AFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDA 714
           + L +S YS+   +H M+G   YL +TSPLRR  D++NH QLH +L   P  FS++Q+  
Sbjct: 786 SLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSD 845

Query: 715 LNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGI 774
           L WHI +RDV L+ A++ S+ FWTL +LK Q    P +R  ++VTS+P  G V C +P +
Sbjct: 846 LAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPEL 905

Query: 775 FYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEMK 816
             + G LK+ P  ++  A+G  V NC ITRLD LD  +  EM+
Sbjct: 906 STARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMELEMQ 948

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/827 (38%), Positives = 494/827 (59%), Gaps = 29/827 (3%)

Query: 3   PGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRV 62
           P +L    LQIGDL +L     +L +C++ P+               + ++T++ V +R+
Sbjct: 155 PKELMSRPLQIGDLVLLKHQSPQLCMCIDVPSSTRDPRYTFTTVDGTIIFSTRNKVLMRI 214

Query: 63  PGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQL 122
           P  H  P   LL +E  HG+ PVG VKN  + T++LP+  R+   +    +IS++A  ++
Sbjct: 215 P--HHLPNVPLLMKEMKHGFEPVGCVKNTTTETFILPIVPRQQITSPISHQISKRAWEEM 272

Query: 123 PEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQG 182
           P  + KLELLHRHLQ   GPWQ+    LV +V +L++            +L +  N G  
Sbjct: 273 PFTLKKLELLHRHLQDARGPWQVPFMNLVSMVEKLDM------------QLASASNTG-A 319

Query: 183 SYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLR 242
           +Y              ++D A++L+ Y  +  QQ   +WG+I   RAL SP+SVTV+PLR
Sbjct: 320 AYVEDLIRTCTFEPQAKLDSAIFLSVYCAIENQQQSHLWGNIHSSRALLSPVSVTVMPLR 379

Query: 243 DQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAA 302
            Q L++  +L+++K  +Y A+ +FA LV+ GKY EA   Y  +++LL+DY AGN  ++A 
Sbjct: 380 SQHLYHRSVLQNLKVRNYEAVSKFARLVDTGKYNEAIMEYPEIVKLLQDYAAGNFYNDAT 439

Query: 303 LIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQL-CPETPHNPLHWNHQLELPLSNPRTALE 361
            I +V+++FR++  ++EE++TR I  QLL +L   +T  NPLH+N  L LP S+ R++ E
Sbjct: 440 AISVVSKIFRKIQRFQEEDITRDICHQLLKELDSSQTTRNPLHYNLDLGLPSSSLRSSSE 499

Query: 362 QKVYDLASP-PLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIA 419
           Q +Y+LA P   + ++   R +F  +  YCIDS  AHEIDDGVSIE     +  LH+HIA
Sbjct: 500 QDIYNLAHPVTFEGQDKNLRHDFGDMKVYCIDSETAHEIDDGVSIESHSDVKRTLHIHIA 559

Query: 420 YPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKT 479
            P S F++           ++ IA  ++FTTYLPDL+ PM+P SY++A+DLG+  +  KT
Sbjct: 560 DPASFFRECQEGTHGIESEILQIALNKSFTTYLPDLMSPMLPGSYSKAADLGKQGQKAKT 619

Query: 480 ITISVDVDLSKKLRV-VDEATLQIALGTTRTSKRVTYDYVDDLL----ESKRQDAEASD- 533
           IT SVD    K  +  +   + +I LG      +VTY+ VD +L    E K   A  +D 
Sbjct: 620 ITFSVDGSWIKNGQFQLQPESFRIKLGLVSNFPQVTYNTVDSMLAQASEVKNGSANLTDD 679

Query: 534 ---LRLLYKVAESLREERKVLKHAIMFG-DVQNGLISLTPNEDGKLLNVQLVDSKSTKSN 589
              L+ LY ++++LR  R   + A++FG +   G ++L+P+E+G L  V   D   T S+
Sbjct: 680 QRNLKELYAISQNLRANRINTQQAVVFGSEFNKGQVALSPDENGVLQKVSFKDQLETPSS 739

Query: 590 TLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSD 649
            LVSE+MI+AN+L+G++F +N +PGV+R    L L  +A N+Y  L+  +++  S++  D
Sbjct: 740 VLVSEMMILANTLSGQFFKDNNLPGVFRCYQPLALGPQAQNEYELLKSKIKEGKSLTFKD 799

Query: 650 LVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQ 709
           +  ++  L +S YSS   RH M+G   YLT+TSPLRR PDMINH+Q+HR L+ LP CF++
Sbjct: 800 ICMISTILNSSFYSSDGYRHEMIGAPHYLTVTSPLRRFPDMINHLQIHRLLKGLPLCFNK 859

Query: 710 EQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHC 769
           + +D   WHI +RD  LKDAS+ S+ +WTL YLK  +  + +K++ +++ S+P  GFV C
Sbjct: 860 DDVDRFVWHIQSRDSILKDASRCSNTYWTLKYLKQLVENDKNKKFSVMINSVPQVGFVRC 919

Query: 770 KIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815
            +P    +   LK+ P+  ++P +G  + NC IT++D+L+G L  E+
Sbjct: 920 VLPDYSSARATLKLKPNEISHPVIGDIIENCRITKIDALEGLLEMEL 966

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/836 (38%), Positives = 494/836 (59%), Gaps = 42/836 (5%)

Query: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRL 60
            +P  L    L +GDL +L   P +L +CV  P+               +C+ATK+ + L
Sbjct: 152 FQPVQLMERPLNVGDLVLLRVRPNELAMCVSLPSSTMDPRYTFVAIDGSMCFATKNRILL 211

Query: 61  RVPGLHKRPL--RYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQA 118
           R+P  H+ P+    L+  E  +G+ P+GT+KN  ++T +LP+A R++  +    +IS+ A
Sbjct: 212 RIP--HRLPVGVNSLIQPEERYGHLPIGTIKNFSNQTNILPIAARQIITSRYPAQISKLA 269

Query: 119 VAQLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGE--ASEKVAKLLAE 176
              LP    KL+LLHR LQ + GPWQ+  F LV LV RL+L  +  +   +  +A LL  
Sbjct: 270 WRDLPFTTKKLQLLHRSLQDYRGPWQIPFFTLVGLVQRLDLNEALDDKYGATYLANLL-- 327

Query: 177 LNIGQGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSV 236
                G++ +A ++         +  A +++TYW ++QQQ    WG+I  + AL SP+SV
Sbjct: 328 -----GTHQTADNV--------PISSATFVSTYWAIMQQQESNFWGEIHLNTALLSPISV 374

Query: 237 TVLPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGN 296
           TV+PL+ + L+Y+ ++  ++ DDY  ++ F  LVN+ KY++  + Y SV+Q+L+D+ AGN
Sbjct: 375 TVIPLKSRHLYYEQVVGKLEADDYNEINRFVKLVNERKYRDISTLYPSVIQMLKDFAAGN 434

Query: 297 INSNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNP 356
            ++N  ++ LV+++FR+++ YK+ ++TR I   L+ ++ P +  NPL  N  L LP S+ 
Sbjct: 435 FHNNGIIVTLVSKIFRKIERYKDCDITRDICQDLINEILPNSMSNPLLLNMDLALPASSK 494

Query: 357 RTALEQKVYDLAS----PPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERL-KGS 410
               +QK+YDL +       + +    R +F  +  +CIDS  AHEIDDGVSIE      
Sbjct: 495 LVRSQQKLYDLTNIEDLQRKNSDNSSERYDFGDLKVFCIDSETAHEIDDGVSIENHGTDG 554

Query: 411 RYRLHVHIAYPYSLFKKSYT-PGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASD 469
            Y LH+HIA P S+F +S     E  I  ++++A  R+FTTYLPD+V PM+PKS    SD
Sbjct: 555 LYTLHIHIADPTSMFPESTNYDSEGIITDILNVALERSFTTYLPDVVVPMLPKSICNLSD 614

Query: 470 LGQWDKPTKTITISVDVDLSKKLRVVDEATLQIALGTTRTSK-------RVTYDYVDDLL 522
           LG+  + TKTI+ SVDV +  K    D  +L+I   + +  K       +VTYD VD +L
Sbjct: 615 LGKQGQKTKTISFSVDVKVMSK---GDGESLEIMFDSFKIRKGIVSNFPKVTYDDVDRIL 671

Query: 523 ESKRQDAE--ASDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQ 579
            +   +A     DL  L  V+  LR+ R    +A++FG+  N GL++L  NE+G+L  + 
Sbjct: 672 NTPNDEASPVKKDLESLSMVSNLLRDRRIKNNNAVIFGEGFNKGLVTLNANEEGELTEIS 731

Query: 580 LVDSKSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAM 639
             D   T S  LVSE+MI+AN+L G+YF +N I GV+R   +L L   A  QY S+  + 
Sbjct: 732 FSDQVETLSTVLVSEMMILANTLTGKYFADNKICGVFRCYKQLPLDIIAQEQYDSMITST 791

Query: 640 RQKGSVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRH 699
           ++       D+VK+++ L +S Y+  P RH M+G ++YLT+TSPLRR PD+INH+Q+HRH
Sbjct: 792 KKGLFPQLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRH 851

Query: 700 LRSLPPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVT 759
           L+  P CFSQ QID L W I +R   LK A + SS +WTL YLK     +P+K +D+++T
Sbjct: 852 LQKKPLCFSQVQIDRLIWPIQSRADILKRAGRNSSTYWTLNYLKKLKKLDPEKTYDVMIT 911

Query: 760 SLPLNGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFE 814
           ++P NGFV C  P + ++ G LK+ PS  + P +G  V NC I R+D L+G L  E
Sbjct: 912 AVPQNGFVSCVFPDLSFARGTLKLHPSAKHYPMIGDIVKNCKILRIDCLEGMLELE 967

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/832 (38%), Positives = 495/832 (59%), Gaps = 34/832 (4%)

Query: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRL 60
            +P  L    L +GDL +L   P +L +CV  P+               +C+ATK+ V L
Sbjct: 152 FQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSSTMDPRYTFVAIDGTMCFATKNRVLL 211

Query: 61  RVPGLHKRPL--RYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQA 118
           R+P  HK P+    L+  E  H + P+GT+KN  ++T +LP+  R+L  +    +IS+ A
Sbjct: 212 RIP--HKLPVGVNSLIQPEGHHKHLPIGTLKNISNQTNILPIVTRQLITSRYPAQISKLA 269

Query: 119 VAQLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELN 178
              LP    KL+LLHR LQ+++GPWQ+  F LV LV +L+L N   +    +  L   +N
Sbjct: 270 WKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDL-NKALDGKYGIDYLTDLVN 328

Query: 179 IGQGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTV 238
               +Y +A ++         ++   +++TYW +LQQQ   +WG+I  + AL SP+SVT+
Sbjct: 329 ----NYHTADNV--------AINSPTFVSTYWAILQQQESNLWGEIHLNTALLSPISVTI 376

Query: 239 LPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNIN 298
           +PL+ Q L+Y  ++  ++ + Y  ++ F  LVN+ KY++  + Y SV+QLL+D+ AGN +
Sbjct: 377 VPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDISNLYPSVIQLLKDFAAGNFH 436

Query: 299 SNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRT 358
           +N  ++ L++++FR++  YK+ ++TR +   L+ ++ P +  NPL  N  L LP S+   
Sbjct: 437 NNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVPNSLSNPLLLNMDLALPSSSKLM 496

Query: 359 ALEQKVYDLAS-PPLDQEEPG---PRKEFSGV-CYCIDSPDAHEIDDGVSIERL-KGSRY 412
             +QK+Y L +   L +E  G    R +F  +  +CIDS  AHEIDDGVS+E   K   Y
Sbjct: 497 ESQQKLYYLTNIEDLQRENSGNDSDRYDFGDLRVFCIDSDTAHEIDDGVSVENHGKDGMY 556

Query: 413 RLHVHIAYPYSLFKKSYTPGEVPIDP-VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLG 471
            LH+HIA P S+F +S     V I   +++IAF+R+FTTYLPD+V PM+P++    SDLG
Sbjct: 557 TLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTTYLPDVVVPMLPQAICHLSDLG 616

Query: 472 QWDKPTKTITISVDVDLS-----KKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKR 526
           +  K TKTI+ SVDV +      K L ++ ++  +I  G      + TYD VD +L +  
Sbjct: 617 KHGKRTKTISFSVDVKVGYQGCGKSLEIMYDS-FRIRKGFVSNFPKATYDDVDKILSAPD 675

Query: 527 QDAE--ASDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDS 583
            ++    +DL  L  +++ LRE+R    +A++FG+  N G+++L  N +G+L  V   + 
Sbjct: 676 NESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQ 735

Query: 584 KSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKG 643
           + T S  LVSE+MI+AN+L GRYF EN I GV+R   +L L   A  QY S+    ++  
Sbjct: 736 EETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTKKGL 795

Query: 644 SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSL 703
                D+VK+++ L +S Y+  P RH M+G ++YLT+TSPLRR PD+INH+Q+HRHL+  
Sbjct: 796 FPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKK 855

Query: 704 PPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPL 763
           P CF+Q QID+L W I +R   LK AS+ SS +WTL YLK    ++P + +D+++TS+P 
Sbjct: 856 PLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITSVPQ 915

Query: 764 NGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFE 814
           NGF  C  P + ++ G LK+ P     P +G  V +C I+++D L+G L  E
Sbjct: 916 NGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKISKIDCLEGMLELE 967

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/832 (38%), Positives = 486/832 (58%), Gaps = 34/832 (4%)

Query: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRL 60
            +P  L    L +GDL +L + P +L +CV  P+               + +ATK+ V L
Sbjct: 152 FQPAQLMKNPLNVGDLVLLKSRPNELAMCVSLPSSTMDPRYTFASIDGSMSFATKNRVLL 211

Query: 61  RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120
           R+P      +  L+  E  H + P+GTVKN  ++T +LP+  R++  +    +IS+ A  
Sbjct: 212 RIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSNQTSILPIVARQMITSKSPAQISKLAWK 271

Query: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIG 180
            LP    KL+LLHR LQ+++GPWQ+  F LV LV +L+L N   +    V  L   +N  
Sbjct: 272 HLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDL-NKALDNKNGVNYLADLVN-- 328

Query: 181 QGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLP 240
             SY SA  + +  A         +++TYW ++QQQ   +WG I  + AL SP SVT++P
Sbjct: 329 --SYKSADSVPMNSAT--------FVSTYWAIVQQQESNLWGKIHLNTALLSPTSVTIIP 378

Query: 241 LRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSN 300
           L+ + L+Y  ++  ++ D+Y  +D F  LVN+ KY++  S Y SV+QLL+D+ AGN ++N
Sbjct: 379 LKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERKYRDISSLYPSVIQLLKDFAAGNFHNN 438

Query: 301 AALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRTAL 360
             ++ L++++FR+++ YK  ++TR I   L+ ++ P    NPL  N  L LP S+     
Sbjct: 439 GIIVTLISKIFRKIELYKGSDITRDICQDLVNEILPNKMINPLLLNMDLALPASSKLGQS 498

Query: 361 EQKVYDLASPPLDQEEP----GPRKEFSGV-CYCIDSPDAHEIDDGVSIER-LKGSRYRL 414
           +QK+Y+L +    Q +     G R +F  +  +CIDS  AHEIDDGVSIE   K   Y L
Sbjct: 499 QQKLYELTNIENMQRKNSNINGDRYDFGDLKVFCIDSETAHEIDDGVSIENHKKDGLYTL 558

Query: 415 HVHIAYPYSLFKKSYTPGEVPIDP-VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQW 473
           H+HIA P SLF +S       I   V+++A +R+FTTYLPDLV PM+P+S    SDLG+ 
Sbjct: 559 HIHIADPASLFPESTDIESQGITTDVLNVALKRSFTTYLPDLVVPMLPESICDLSDLGKQ 618

Query: 474 DKPTKTITISVDVDL-----SKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQD 528
            + T+T++ SVDV +      K + ++  + L+I  G      + TY+ VD +L     D
Sbjct: 619 GQKTRTLSFSVDVKVLPKSTGKPIEIIYNS-LKIRKGIVSNFPKATYNDVDRILSI--TD 675

Query: 529 AEA----SDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDS 583
           +EA     DL  L  +++ LRE R    +A++FG+  N GL++L  N++G+L  V   D 
Sbjct: 676 SEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQ 735

Query: 584 KSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKG 643
             T S  LVSE+MI+AN+L GR+F EN I GV+R   +L L   A  QY SL  + ++  
Sbjct: 736 AETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYKQLPLDAIAQQQYNSLITSAKKGV 795

Query: 644 SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSL 703
                D+ K+++ L +S Y+  P RH M+G  +YLT+TSPLRR PD+INH+Q+HRHL+  
Sbjct: 796 FPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKK 855

Query: 704 PPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPL 763
           P CFSQ QID L W I +R   LK AS+ SS +WTL YLK  + + P+K +D+++TS+P 
Sbjct: 856 PLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQ 915

Query: 764 NGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFE 814
           NGF  C  P + ++ G LK+ PS  + P +G TV  C I ++D L+G L  E
Sbjct: 916 NGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTCKILKIDCLEGILELE 967

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/831 (38%), Positives = 495/831 (59%), Gaps = 32/831 (3%)

Query: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRL 60
            +P  L  + L +GD  +L   P +L +CV  P+               +C+ATK+ V L
Sbjct: 152 FQPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLL 211

Query: 61  RVPGLHKRP--LRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQA 118
           R+P  HK P  +  L+  E+ H + P+GTVKN  ++T +LP+  R+L  +    +IS+ A
Sbjct: 212 RIP--HKLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLA 269

Query: 119 VAQLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELN 178
              LP    KL+LLHR LQ+++GPWQ+  F LV LV +L+L N   +    +  L + +N
Sbjct: 270 WKDLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDL-NKALDDKNGINYLTSLVN 328

Query: 179 IGQGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTV 238
               +Y +  DI         ++   +++TYW ++QQQ   +WG+I  + AL SP+SVT+
Sbjct: 329 ----NYHTVNDI--------PINSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTI 376

Query: 239 LPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNIN 298
           +PL+ Q L+Y  ++  ++ + Y  +++F  LVN+ KY++  + Y SV+QLL+D+ AGN +
Sbjct: 377 IPLKSQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFH 436

Query: 299 SNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRT 358
           +N  ++ L++++FR+++ YK+ ++TR I   L+ ++ P +  NPL  N  L LP S+   
Sbjct: 437 NNGIIVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLV 496

Query: 359 ALEQKVYDLAS-PPLDQEEPGP---RKEFSGV-CYCIDSPDAHEIDDGVSIERL-KGSRY 412
             +QK+YDL +   L  ++ G    R +F  +  +CIDS  AHEIDDGVS++   +   Y
Sbjct: 497 KWQQKLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLY 556

Query: 413 RLHVHIAYPYSLFKKSYTPGEVPIDP-VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLG 471
            L++HIA P S+F +S       I   ++++A +R+FTTYLPD V PM+P+S    SDLG
Sbjct: 557 TLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLG 616

Query: 472 QWDKPTKTITISVDVDLSKKLR----VVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQ 527
           +  + TKTI+ SVDV ++ K       +   + +I  G      + TY+ VD +L +   
Sbjct: 617 KQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNS 676

Query: 528 DAE--ASDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSK 584
           +A     DL  L  +++ LRE+R    +A++FG+  N GL+ L  + +G+L  V   D +
Sbjct: 677 EASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQE 736

Query: 585 STKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGS 644
            T S  LVSE+MI+AN+L GRYF EN I GV+R   +L L   A  QY S+  + ++   
Sbjct: 737 ETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIF 796

Query: 645 VSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLP 704
               D+VK+++ L +S Y+  P RH M+G ++YLT+TSPLRR PD+INH+Q+HRHL+  P
Sbjct: 797 PKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKP 856

Query: 705 PCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLN 764
            CF+Q QID+L W I +R   LK AS+ SS +WTL YLK     EP++ +D++VTS+P N
Sbjct: 857 LCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQN 916

Query: 765 GFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFE 814
           GF  C  P + ++ G LK+ PS  + P +G  V NC I+++D L+G L  E
Sbjct: 917 GFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/826 (37%), Positives = 470/826 (56%), Gaps = 40/826 (4%)

Query: 6   LAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVPGL 65
           L    L +GDL +L + P +L +C++ P+               + + ++S V +R+P  
Sbjct: 134 LMAKPLDVGDLVLLKSHPSELSMCIDVPSSTKDPRYCFTTVDGSLKFGSRSLVLMRIP-- 191

Query: 66  HKRP-----LRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120
           H  P     +  LL REA HG+ P+GT+KN  + T +LPV  R+L  +     IS+ A  
Sbjct: 192 HSLPQELSKMAALLVREAKHGFEPIGTIKNQANETLVLPVIARQLVTSCVTQRISKSAWD 251

Query: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLEL----PNSPGEASEKVAKLLAE 176
           QLP  + KLELLHR LQ   GP  +  F LV ++  L++     N  GE           
Sbjct: 252 QLPVTIKKLELLHRRLQDSTGPVPVPFFDLVMMIQSLDITKAISNRDGEP---------- 301

Query: 177 LNIGQGSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSV 236
                  Y      N R  +   +D +  LATYW +  QQ + ++GDI    AL SP+SV
Sbjct: 302 -------YIRDVIENSRTGSTSTIDSSCALATYWAIEAQQKNHLFGDIQISGALLSPVSV 354

Query: 237 TVLPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGN 296
            +LP   Q LFY  L   +K +   A+ EF+ L N+GKY E  + +  ++Q+L+ Y AGN
Sbjct: 355 LILPFASQHLFYSELKEQLKSNGQEAIQEFSKLANKGKYTELTTRFPHIIQVLKGYAAGN 414

Query: 297 INSNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPE-TPHNPLHWNHQLELPLSN 355
           ++++  ++ L+  +FR++D +K+ ++TR    +LL +  P+ T  NP++ N  L LP S+
Sbjct: 415 LHNDEGIVSLIAAIFRKIDEFKDNDITRDACEKLLSRTLPQGTVENPIYANFTLGLPDSS 474

Query: 356 PRTALEQKVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRL 414
            R+  +Q+VYDL+ P   Q     R +F  +  YCIDS +AHEIDDG+SIE     +Y L
Sbjct: 475 ARSRTQQQVYDLSKPASAQSTEN-RHDFKHLRVYCIDSEEAHEIDDGISIEDCGNGKYTL 533

Query: 415 HVHIAYPYSLFKKSYTPGEVPI-DPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQW 473
           H+HIA P SLF +S +  +  I D V+ +A  R FTTYLPD+V PM+P+++T   DLG  
Sbjct: 534 HIHIADPASLFPESESSEQSGINDEVLKVAAERCFTTYLPDVVSPMLPQTFTTVCDLGHQ 593

Query: 474 DKPTKTITISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEA-- 531
            K TKTIT SVDV +      +   + +I LG      +VTY+ VD  L   +   E   
Sbjct: 594 GKKTKTITFSVDVLVKDGAIKIFFDSYKIRLGLVSNFPKVTYETVDRYLSEPKNVNEEIL 653

Query: 532 SDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNT 590
            DL+L++K+AE LRE R     AI+FG   N GL++++P +      +   D K +KS  
Sbjct: 654 YDLKLMHKIAEILREARIQKDGAIVFGSGFNQGLVAVSPVDQ----EISFFDQKESKSTL 709

Query: 591 LVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDL 650
           LVSE MI+ANSLAGR+F E  IPG++R    L L+ +A  +Y  +++++++    ++ D+
Sbjct: 710 LVSEFMILANSLAGRFFAEKEIPGIFRTYQPLTLRGQADQEYERMKKSVKKGILPTTKDI 769

Query: 651 VKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQE 710
             +++ L +S Y   P  HAM+G  +YLT+TSPLRR PD+INH+Q+HR LR+LP CF+++
Sbjct: 770 NMLSSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRRFPDIINHLQIHRVLRNLPLCFTED 829

Query: 711 QIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCK 770
            +  + WHI  RD ALK AS   + +WTL Y+K+ +   P +R+D+ +TS+P      C 
Sbjct: 830 ALSKMLWHIQLRDAALKKASAHQASYWTLKYIKNLIRDTPHQRFDVTITSVPQLNVARCV 889

Query: 771 IPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815
           +     + G LK+ PS  N P VG TV  C ++++D LD  L  E+
Sbjct: 890 LANFPSARGVLKLKPSATNIPTVGDTVKGCKVSKIDCLDSLLELEL 935

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/817 (37%), Positives = 461/817 (56%), Gaps = 25/817 (3%)

Query: 4   GDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVP 63
            +   + LQ+GDL + +  P +L +CV  P                + + TKS V LR+P
Sbjct: 132 SEFISSVLQMGDLVLTTPYPNELAMCVGLPESAEDPRYTFVTVSGKMFFGTKSFVHLRIP 191

Query: 64  GLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLP 123
                 +RYL+ +E  H + PVGT+K     TY+LP   R+L  +   ++I++ A  +LP
Sbjct: 192 YRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYILPYLARQLVTSELPSQINKLAWQKLP 251

Query: 124 EVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQGS 183
            ++ +LELL R+L+ + G WQ+   +LVD V RLE    PGE  E +  L    ++G   
Sbjct: 252 SIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRLEEKGGPGEF-EYIKSLFERPSLG--- 307

Query: 184 YCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRD 243
                       + + +  A YLATYW + +QQ   +WG I  ++A  +P+S +V+P   
Sbjct: 308 ------------SRRSIHAATYLATYWAIKEQQNFNIWGKIHVNKAFLAPISTSVVPAAS 355

Query: 244 QTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAAL 303
              F+D L+ D KR     +++   L+N   Y+     Y   LQLL D+ AGN ++N  +
Sbjct: 356 LRSFHDELINDPKR---KHVNKITDLINTKDYELVRERYPEFLQLLSDFTAGNFDNNCEV 412

Query: 304 IYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPET-PHNPLHWNHQLELPLSNPRTALEQ 362
           + L++++FR LD Y+E  VTR   F LL ++  +    NP+  N  L L  S+ R+AL++
Sbjct: 413 VTLISQIFRMLDVYRECNVTRDTCFDLLKEISEDNFCENPILSNSDLALAQSSERSALQK 472

Query: 363 KVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYP 421
            VY +  P +  +    R +F  +  YCIDS  AHEIDDGVSIE+     Y LHVHIA P
Sbjct: 473 CVYSVVQPDIQLDTKTKRHDFLDMPVYCIDSETAHEIDDGVSIEKNGKGSYTLHVHIADP 532

Query: 422 YSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTIT 481
            S F +SYT     +  V+ IAF ++FTTYLPD+V  M+P+S+ RA+DLG+ DK T+TIT
Sbjct: 533 ASFFPESYTES-TKLSDVLKIAFDKSFTTYLPDVVEAMLPESFCRAADLGKQDKKTRTIT 591

Query: 482 ISVDVDLSKKLRV-VDEATLQIALGTTRTSKRVTYDYVDDLL-ESKRQDAEASDLRLLYK 539
            SV V + +   + +   T +  LG      +VTY+ VD +L +S        DL  LYK
Sbjct: 592 FSVRVKMDEHGGLHIQSDTFRARLGLVSNFPKVTYNIVDSVLNDSSSNSPLRQDLLTLYK 651

Query: 540 VAESLREERKVLKHAIMFGD-VQNGLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMIM 598
           +A  LR  R  L  A++FG+   NG + L  +   K+ ++   ++  T S  LVSELMI+
Sbjct: 652 IASGLRHNRVKLNGAVVFGEGFNNGQVRLIRDSANKVKDITFENNNETPSTVLVSELMIL 711

Query: 599 ANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAAFLT 658
           AN+L+G +F EN IPG++R   EL L  +A + Y S+Q  +++  + +  D+ K+ + + 
Sbjct: 712 ANTLSGNFFRENKIPGIFRCYNELKLDGKALSDYRSIQDNVQRGKNPTLKDIAKITSLMN 771

Query: 659 NSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNWH 718
           +S YS  P  H M+G ++YLT+TSPLRR PD+INH+QLH+HL + P  FSQ+ ID + W 
Sbjct: 772 SSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDLINHIQLHKHLANKPLTFSQQAIDQMIWQ 831

Query: 719 ILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYSS 778
           + +R   LK  S   S +WTL YLK ++  +   R+D++VTS P +G V+C  P   Y+ 
Sbjct: 832 VQSRADILKSISTTVSAYWTLTYLKKRIEKDSSARFDVMVTSFPQDGMVNCLFPNHSYAR 891

Query: 779 GKLKIPSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815
           GKLK+      P +G  V +C IT +D LD  L+  M
Sbjct: 892 GKLKLKVDRLPPQIGDIVKDCQITSIDCLDSNLQLVM 928

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  527 bits (1357), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 308/818 (37%), Positives = 459/818 (56%), Gaps = 28/818 (3%)

Query: 3   PGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRV 62
           P +L  T+L +GD+ +L     +L +CV  P                + YA K+ V LR+
Sbjct: 117 PAELLRTSLNVGDIVLLKQCTSELTMCVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRI 176

Query: 63  PGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQL 122
           P      +  LL RE++H Y  +GT+KN+ + T +LPV  R+L  +  +   ++ A  QL
Sbjct: 177 PKDLPEEVNQLLKRESNHPYQKIGTIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQL 236

Query: 123 PEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQG 182
           P V+ KLEL+HR+LQ   G   ++   LV ++  L +     EA++ +         G  
Sbjct: 237 PIVLKKLELIHRYLQDSRGSKHVNFMSLVRIIKNLNIK----EATDAIN--------GDA 284

Query: 183 SYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLR 242
                 D ++ +   K +D    LATYWGV +QQ + +WG +  + AL SP +V VLPL+
Sbjct: 285 YVRKVIDESMSVVN-KSIDPTTLLATYWGVREQQQNNLWGSVYTNTALLSPTTVAVLPLK 343

Query: 243 DQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAA 302
              LFY  ++  ++ +DY  +  FA LVN   Y      Y  +  LL DY AGNI  NA 
Sbjct: 344 KAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYIRTLLNDYAAGNIEENAV 403

Query: 303 LIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPET-PHNPLHWNHQLELPLSNPRTALE 361
           L  +++++FR +D Y++++VTR++  +LL ++ P++   N +  N  L +P S+  +++E
Sbjct: 404 LTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSNSSNFILGNWDLNIPKSSGISSVE 463

Query: 362 QKVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAY 420
           QK+YD A P +  +    R +F  +  +CIDS DAHEIDDG+SIE L G R R+H+HIA 
Sbjct: 464 QKLYDTAMPTIVSDTD--RYDFGDMPVFCIDSEDAHEIDDGISIEELDGVRSRIHIHIAD 521

Query: 421 PYSLFKKSYTPGEVPI-DPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKT 479
           P  LF +S+   +  I D V+ ++ +RAFTTYLPDLV PM+PKS+   +DLG+ D+ T+T
Sbjct: 522 PAGLFPESFDYTKSGISDDVLRVSLKRAFTTYLPDLVVPMLPKSFCNRADLGKHDRKTET 581

Query: 480 ITISVD-VDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQD---AEASDLR 535
           I+ S + V+       VD  T Q+ LG      +VTYD VD +L          +   L 
Sbjct: 582 ISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKVTYDKVDSILNGDDNSLPSKQKKQLE 641

Query: 536 LLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLVSE 594
           LL+ +A  L  +R    +A++FGD  N GL+SL+P++DG+L      D   TKS  LVSE
Sbjct: 642 LLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGELCIPTFYDQSQTKSTLLVSE 701

Query: 595 LMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVA 654
            MI+ N L   +F EN IPGVYR    L L  +A  Q+  L+  ++     S  D+ K++
Sbjct: 702 FMILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKENIKLGKLPSLKDITKIS 761

Query: 655 AFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDA 714
           + L++S YS  P  H M+G   YLT+TSP+RR PD+INH+QLHR L+ LP CF QE +D 
Sbjct: 762 SQLSSSFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQ 821

Query: 715 LNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGI 774
             W   AR   LK   + SS +WTL +L+        K  D++VTS+P NG V+C  P  
Sbjct: 822 YVWSFQARADILKIFQRHSSTYWTLKHLE----QSGTKTHDVIVTSVPQNGTVNCLFPEY 877

Query: 775 FYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTL 811
            Y+ G LK+ P+    P +G T+ +C +  +  LDG L
Sbjct: 878 SYARGTLKLDPAMKKIPRIGDTIRHCKVESIHPLDGIL 915

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  516 bits (1330), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 288/817 (35%), Positives = 460/817 (56%), Gaps = 27/817 (3%)

Query: 5   DLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVPG 64
           +L  + L++GD+ +L +   +L +CV  P                + ++T+S + LR+P 
Sbjct: 135 ELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNLLFSTRSSINLRIPY 194

Query: 65  LHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLPE 124
                +  L+ RE  HG+ P+G +K++I+ T++LP   R+   +L    +S  A  +LP 
Sbjct: 195 SIPNGIANLITREIPHGFNPIGVIKSSINETFILPTVTRQHITSLKPFTVSHIAWEELPL 254

Query: 125 VVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQGSY 184
            + KLE+LHR LQ+ LG +Q+  F+LV LV  +++ +       K  K L + N    SY
Sbjct: 255 TIKKLEVLHRFLQNPLGWYQIPFFQLVHLVDTIDMSSC---NDRKYMKTLID-NSKNDSY 310

Query: 185 CSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRDQ 244
                          +D +  L+TYW +++QQ   MWGDI  +    SP+SVTV PL+  
Sbjct: 311 -------------NNLDASRCLSTYWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKAY 357

Query: 245 TLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAALI 304
             F DYL+   K+ D   + +   L+N+  Y      Y   + +L+DY +GN+N N+ + 
Sbjct: 358 QHFNDYLVCGTKQKDLDKIGQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGNLNQNSQVA 417

Query: 305 YLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCP-ETPHNPLHWNHQLELPLSNPRTALEQK 363
            L++   R+L+ YK+ +V++T+ ++LL ++ P +   N L +NH L L  S+      ++
Sbjct: 418 VLISAFLRKLNYYKDMDVSKTVCYKLLQEIDPTQFFDNILLFNHDLNLSNSSNLGQSNKQ 477

Query: 364 VYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPY 422
           +Y L  P +  +    R +F  +  YCIDS  AHEIDDG+SI       Y L +HIA P 
Sbjct: 478 LYALCGPQISAD--ADRVDFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPS 535

Query: 423 SLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITI 482
            LF  +        D V  +A  ++FTTYLPD+V P++P +Y+ A+DLG+  + T  +T 
Sbjct: 536 ILFSGASEIQGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTF 595

Query: 483 SVDVDL--SKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESK--RQDAEASDLRLLY 538
           +V+V     + L V+ + T  I L   R   +VTY  V+ +L+S      +   DL  L+
Sbjct: 596 TVNVKTLPDETLHVLYD-TFDIKLSKIRNFPKVTYSRVNKILQSSDYSNPSVKQDLEDLH 654

Query: 539 KVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMI 597
           K+A +LR  R     A++FG+  N G+I        ++ NV+ +D + T +  LVSELMI
Sbjct: 655 KIARALRNNRMKNGGAVVFGEGFNKGMIEFFEEGQAEVKNVKFIDQEETPATLLVSELMI 714

Query: 598 MANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVAAFL 657
           + N+L G +F +N IPG+YR   +LLL  +A+ +Y SLQ + +   S S  D+ +V++ +
Sbjct: 715 LTNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVSPSIKDMTRVSSLM 774

Query: 658 TNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDALNW 717
            +S Y+S P  H M+G ++YLT+TSPLRR PD++NH Q+HR L+ LP  F+ E++  L W
Sbjct: 775 NSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIW 834

Query: 718 HILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGIFYS 777
           HI +R   LK  S+  + +WTL YL+  +   P+KR+D+++TS+P NG V+C  P + ++
Sbjct: 835 HIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFA 894

Query: 778 SGKLKIPSGANNPAVGSTVANCFITRLDSLDGTLRFE 814
            GKLK+  G   P +G TV NC I +L+SLDG L  E
Sbjct: 895 RGKLKLKKGMPYPVIGDTVTNCRIVKLESLDGILYLE 931

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  509 bits (1310), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 296/821 (36%), Positives = 470/821 (57%), Gaps = 52/821 (6%)

Query: 14  GDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVPGLHKRPLRYL 73
           GD+ +LS     L +C+E P                + +A +S V LR+P   + P   L
Sbjct: 124 GDIVLLSQDLSNLYMCIELPQSTADPRYSFANSNGDIIFANRSSVLLRIP--LQLPTNLL 181

Query: 74  LHREADHGYAP-----VGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLPEVVAK 128
           L   +D    P     VGTVKN+I   Y+LPV +R+L  +  ++ IS  A   LP V+ K
Sbjct: 182 L---SDDFLQPEPTQGVGTVKNSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLKK 238

Query: 129 LELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEK-VAKLLAELNIGQGSYCSA 187
           L+LLHR+LQ+      + L +L  LV  L+L  +     E  ++  +A  N         
Sbjct: 239 LQLLHRNLQAF---KIIPLVQLSSLVQNLDLTKATSNDGESYISNFIANSN--------- 286

Query: 188 ADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRDQTLF 247
                   + + ++ +  +AT+W + QQQ D +WGDI Y +AL  PL+V++LPL+   ++
Sbjct: 287 -----ENYSIESINSSNLIATFWAIRQQQQDHLWGDIHYSKALLFPLAVSILPLQSNYMY 341

Query: 248 YDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAALIYLV 307
           Y  +L  ++ D   +++ F     +       + +  +L LL+ Y +G +  +  ++ ++
Sbjct: 342 YKEILPAIELD--HSIERFT----KNGIPNTPNEFPQLLNLLKQYASGAVLMDDKIVTMI 395

Query: 308 TRLFRRLDAYKEEEVTRTIAFQLLGQLCPETP--HNPLHWNHQLELPLSNPRTALEQKVY 365
           +++FR LD YK+ +V+R +  +L  +L P+     N L +N  L LPL++ RT  ++KVY
Sbjct: 396 SKIFRNLDDYKKYDVSRDLCQKLYNELVPKEQKIQNSLLYNTDLALPLASNRTEEQEKVY 455

Query: 366 DLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSL 424
            + +P +       R +F  +  +CID   AHEIDDGVSIE  + + Y LHVHIA P S 
Sbjct: 456 QMYNP-IQTSNNSNRHDFGDLRVFCIDEKTAHEIDDGVSIEYKQNNVYTLHVHIADPSSY 514

Query: 425 FKKSYTPG-EVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITIS 483
           FK        +  D ++ IA +R+FTTYLPD V PM+PK   RA+DLG+  + TKTIT S
Sbjct: 515 FKICNDHNVNIENDEILKIALQRSFTTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFS 574

Query: 484 VDVDLSKK---LRVVDEATLQIALG-TTRTSKRVTYDYVDDLL----ESKRQDAEASDLR 535
           VDV L+KK   ++V+D  T Q+ LG  +   K +TY  VD +L    ES R      DL+
Sbjct: 575 VDVKLNKKDMTVKVLDN-TFQVRLGYVSNFVKDMTYSDVDSILNDSKESGRDKKVEKDLK 633

Query: 536 LLYKVAESLREERKVLKHAIMFGD-VQNGLISLTPNE-DGKLLNVQLVDSKSTKSNTLVS 593
            ++ +A+ L   R ++ +A++F D + NG I LT +E  G++  +     K T SN LVS
Sbjct: 634 SMFLIAKGLNNSR-IMNNAVIFSDEINNGKIELTKDEITGEVTQINFKGGKFTDSNILVS 692

Query: 594 ELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKV 653
           ELMI+ANSLAG++F EN IP +YR  ++LLL  +A ++Y ++   ++     +  D+ K+
Sbjct: 693 ELMILANSLAGKFFAENGIPAIYRSYSDLLLGKDAQSEYNAMLSNLKLGKRPTLKDINKI 752

Query: 654 AAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQID 713
           ++    S +++ P  H+M+ T+ Y T+TSPLRR PDMINH+Q+HR L   P CF+Q  ++
Sbjct: 753 SSLFNTSKFTTYPSPHSMIATKYYATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRDLE 812

Query: 714 ALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPG 773
            +NW+I  +DV L+ +S+  + +WTL ++KDQL  +PDK++D+++TS+  NG  HC +  
Sbjct: 813 NMNWNIQTKDVILRSSSRMINTYWTLRHIKDQLSEDPDKKFDVMITSVQQNGVAHCILAQ 872

Query: 774 IFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRF 813
             ++ GKL   P+  ++P +G TV+NC IT++D L   L F
Sbjct: 873 FSFAKGKLVFDPNDESHPLIGDTVSNCKITKIDCLGNVLEF 913

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  506 bits (1302), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 300/826 (36%), Positives = 464/826 (56%), Gaps = 33/826 (3%)

Query: 4   GDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVP 63
            DLA T L+I DL +L A P +L +CV+ P                + +  +S +++R+P
Sbjct: 130 NDLAKTPLKIRDLAILRATPSELSMCVQLPESVEDPRYTFASRSGKLYFVYRSMIKIRIP 189

Query: 64  GLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLP 123
               + ++ L+ +E  H ++P+GT+K+N   T++LP   R L +  G+++I++ A  Q P
Sbjct: 190 YQVPKGIQGLILKELQHEFSPIGTLKSNTKDTFILPYLARNLLSRTGLSDINKAASYQRP 249

Query: 124 EVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSP--GEASEKVAKLLAELNIGQ 181
            V+ KLELLHR+LQ+  GP  +    L++LV +L+L  +      ++ +  L+ E N   
Sbjct: 250 IVMKKLELLHRYLQNDKGPTSIPFTHLINLVNKLDLSQALHLQAGNDYIINLIKEAN--- 306

Query: 182 GSYCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPL 241
                          P  ++ +L +A YW +++     +W  I+ + A   P +VTVLPL
Sbjct: 307 -------------DPPSIMNASLTIAVYWSLVELSETFLWDGINRNSASLFPTTVTVLPL 353

Query: 242 RDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNA 301
               + Y  L+ D++R++Y  L++F+ LVN   Y+E   ++  ++ LL++Y AGN+ +N 
Sbjct: 354 LSYRVHYTELIEDLERNNYKQLNKFSNLVNDKNYQEIEQSFSKIINLLQEYTAGNLQNNP 413

Query: 302 ALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPH-NPLHWNHQLELPLSNPRTAL 360
            +  L+++LFR +  Y+  ++TR +  +LL +     P+ NPL  NH L     +     
Sbjct: 414 KITTLISKLFRGIKEYQRCDITRDLCNELLMKFPSIKPNSNPLLKNHDLATRADSQHGQR 473

Query: 361 EQKVYDLASPP--LDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVH 417
           +Q +YD   P   L QE    R +F  +  YCIDS  AHEIDDG+SIE+    ++ LH+H
Sbjct: 474 QQILYDYVKPNDLLIQESLRDRFDFGDLRVYCIDSETAHEIDDGISIEKKFNGKFTLHIH 533

Query: 418 IAYPYSLFKKSYTPGEVP--IDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDK 475
           IA P   F +      V    D V+ IA+  +FTTYLPD V PM+PKSY + +DLG   K
Sbjct: 534 IADPAIFFPECNNEKGVLGLQDDVLKIAYENSFTTYLPDTVVPMLPKSYCKMADLGINGK 593

Query: 476 PTKTITISVDVDLSKK---LRVVDEATLQIALGTTRTSKRVTYDYVDDLLESK---RQDA 529
            T +I+ SVDV L+K+   L++  + T QI LG      + TYD VDD+L S+    Q  
Sbjct: 594 KTPSISFSVDVILNKEKSNLKICYD-TFQIRLGLVSNFPKATYDNVDDILSSEVNSEQKL 652

Query: 530 EASDLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKS 588
              DLR L  +A  LR +R     AI FG+  N G    + + + +   +  VD K+TKS
Sbjct: 653 LQDDLRQLSMIAGILRNKRTQENGAITFGEGFNRGTPKYSEDSETESDVISFVDQKNTKS 712

Query: 589 NTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSS 648
           N LV+ELMI+AN+L GRYF EN I GVYR   +L L+ +A  QY  L+   +     +  
Sbjct: 713 NELVTELMILANTLCGRYFKENKIFGVYRCYNDLNLEPKAKMQYNKLREECKNGKLPTLE 772

Query: 649 DLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFS 708
           D+VKV + L +S+YS  P RH M+G+E+YLT+TSPLRR  D+++H+QLH HL+  P  F+
Sbjct: 773 DIVKVQSLLNSSYYSEHPSRHDMIGSEQYLTVTSPLRRFTDLVSHIQLHNHLKGHPLPFN 832

Query: 709 QEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVH 768
           Q+ I     HI +R   L+  S  S+V  TL YLK+ L  +PD  +D+ +TS+P  G   
Sbjct: 833 QKAIRNFVPHIQSRADKLRKISTESNVCMTLSYLKNLLKTKPDTMFDVKITSVPSEGRAR 892

Query: 769 CKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRF 813
           C IP   ++ G++++ PS    P VG TV +C + ++  +DG L F
Sbjct: 893 CLIPEYSFARGEIRLSPSLKVYPKVGDTVNSCKVVKISCVDGILEF 938

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  459 bits (1182), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 274/830 (33%), Positives = 460/830 (55%), Gaps = 41/830 (4%)

Query: 11  LQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVPGLHKRPL 70
           L+IGD+ +L     +  +C++ P                + +  +S + L++P      +
Sbjct: 146 LKIGDIVLLKTNTSEFSMCIDLPQSLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNI 205

Query: 71  RYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLPEVVAKLE 130
             L+ +E  H Y P+GT+K+++  T L+PV  R+L       +IS+ A  QLP ++ KLE
Sbjct: 206 ERLIIKEPAHKYNPIGTIKSSLDETVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLE 265

Query: 131 LLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPG--EASEKVAKLLAELNIGQGSYCSAA 188
           LLHR+LQ   GP Q+   KL++++  L L  +    + +E V +LL      Q  Y    
Sbjct: 266 LLHRYLQDFSGPQQIHFHKLINIIEALNLDRATDYEKGNEYVNELLK-----QKYYNDYT 320

Query: 189 DINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRDQTLFY 248
           D++L       +D  + L+TYW +++QQ   +WG+I  + +   P +VT+LP     ++Y
Sbjct: 321 DLSL-----SSLDATVALSTYWAIIEQQDLFLWGEIKRNSSSLFPTTVTILPFSHH-VYY 374

Query: 249 DYLLRDMKRDDYAALDEFACLVNQGKYK----EACSNYKSVLQLLRDYCAGNINSNAALI 304
             L++ ++++++   +EF+  +N+        E    +   L LL++YCAGN+  N  +I
Sbjct: 375 TKLIKSLRKNNFRRTNEFSAFINEHNLNTSSPEIQFKFPEFLHLLKEYCAGNLLDNPKII 434

Query: 305 YLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETP--HNPLHWNHQLELPLSNPRTALEQ 362
            +++++FR L+ +KE ++T+ +A++LL +L P +    NPL  NH L LP ++ R   + 
Sbjct: 435 TILSKIFRNLNDFKERDITKDLAYELLTKLIPTSNLLANPLLANHDLSLPTNSGRGENQS 494

Query: 363 KVYDLASPPLDQ--EEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIER-LKGSRYRLHVHI 418
           K+Y+LA+P   +  E    R  F+ +  YCIDS  AHEIDDG+SI++ LK       + +
Sbjct: 495 KLYELATPTKIESGETTTKRHNFNDLNVYCIDSETAHEIDDGISIKKYLKIDLLYSFILL 554

Query: 419 AYPYSLFKKSYTPGEVPIDP-VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPT 477
              +   K S    +  ID  ++ IA+ R+FTTYLPD V PM+P  Y   SDLG+ ++  
Sbjct: 555 TLQFISMKDSNKEKKTGIDDDILKIAYYRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNI 614

Query: 478 KTITISVDVDL------SKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEA 531
           +T+T SVD+ +       + L+++ + T +I  G      +VTYD VD +L++  +  + 
Sbjct: 615 ETLTFSVDITIFDGSNNEETLKILYD-TFKIQFGLVSNFPKVTYDTVDKILDNSTKIPDT 673

Query: 532 S---DLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTK 587
           S   DLR L ++A+ LR+ R    +AI+FG+  N G+  L   ED     +   D K++ 
Sbjct: 674 SITEDLRQLSRIAKLLRKYRINENNAIVFGEGFNRGIPDLQSTED----EIIFTDQKNSD 729

Query: 588 SNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSS 647
           SN LVSE+MI+AN+L G+Y  ++ IP +YR  + L +  EA  Q   + R+       S+
Sbjct: 730 SNELVSEMMILANTLTGKYCKDHKIPVIYRCYSPLDIGPEAQ-QECIILRSKNIDRLPSN 788

Query: 648 SDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCF 707
            D+ K+++FL +S+YS TP RH+M+G++EY T+TSPLRR PD++NH+QLH HL+     F
Sbjct: 789 IDMAKMSSFLNSSYYSGTPSRHSMLGSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPF 848

Query: 708 SQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFV 767
           +   +      I +R   LK+         TL Y+K  +  EP K +D++VTS+P+ G  
Sbjct: 849 TPNHVAHYLTTIQSRSDTLKNIGNAVYTEMTLNYIKLLINKEPTKAFDVLVTSVPIEGSA 908

Query: 768 HCKIPGIFYSSGKLKIPSGANN-PAVGSTVANCFITRLDSLDGTLRFEMK 816
            C I G  Y+ G +K+ +  N  P +G  +  C +T++  ++G L   M+
Sbjct: 909 RCAIVGYEYARGTIKLKAEINPVPIIGDIITKCKVTKIFPIEGALELSME 958

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  447 bits (1150), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 294/826 (35%), Positives = 452/826 (54%), Gaps = 38/826 (4%)

Query: 6   LAGTTLQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVPGL 65
           L   +L IGDL +L     +L++CV+ P                + ++TK +V LR+  L
Sbjct: 127 LFDRSLDIGDLVLLRNSDKELLMCVDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRI--L 184

Query: 66  HKRPLRYLLHREADHGYAP--VGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLP 123
           +  P   L H    + Y    +   +NN  +   LPV  R++  +   +EIS+ A   L 
Sbjct: 185 NTLPKNILNHDLIKNKYEAGLINRKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLN 244

Query: 124 EVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQGS 183
             + KLE+LHR++   +    +S  KLV LV  ++L       ++  A  ++  NI + +
Sbjct: 245 VNLKKLEVLHRYISDGVETSSISFLKLVHLVQNVDLNKLARNRADHDANHIS--NIIRNT 302

Query: 184 YCSAADINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRD 243
                DI        ++D    L+TYW V+QQQ  Q+WGDI  H AL  P+SV+VLP  +
Sbjct: 303 ---KDDIQYMT----KIDAITLLSTYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPFNN 355

Query: 244 QTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNINSNAAL 303
                + + R    ++   +++F   +N+   ++    +   L +L++Y  G    N  +
Sbjct: 356 VIYLNETIPRVATDEN---INKFTEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKI 412

Query: 304 IYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETP-HNPLHWNHQLELPLSNPRTALEQ 362
             ++++LFRR++ YK +E++R    +L  +L P     N L  +  L LP  +  T  EQ
Sbjct: 413 TTIISKLFRRIETYKNKELSRDNCQKLYNELNPSNKILNSLLLSKDLCLPEISGTTRTEQ 472

Query: 363 KVYDLAS----PPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVH 417
            +Y L        +DQ     R +F  +  +CID   AHEIDDGVS+ R  G+  RL +H
Sbjct: 473 LIYSLTEVDNHAIIDQR----RHDFKDLKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIH 528

Query: 418 IAYPYSLFKKSYT-PGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKP 476
           IA P SLF    T       D +++IAFRRAFTTYLP+ V PM+PKS+   SDLG   K 
Sbjct: 529 IADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKM 588

Query: 477 TKTITISVDVDLSKKLRVVDEATLQIALGTTRT-SKRVTYDYVDDLLES--KRQDAEASD 533
           T TIT SVD D  K    + E T +I LG      K  TY  VD +L S  KR++    D
Sbjct: 589 TNTITFSVDFD--KSSCSILEDTFEIQLGKVNNFPKNTTYKEVDKILNSSIKRENDIERD 646

Query: 534 LRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLT-PNEDG-KLLNVQLVDSKSTKSNT 590
           LR +  +A  LR+ R +   A++FG+  N G ++L    +DG K   V   DS++T SN 
Sbjct: 647 LREMRFIANHLRKCR-IDNSAVIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNI 705

Query: 591 LVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDL 650
           +VSE MI+ANSLAG+YF  + IP +Y+    L +K +AS+Q+  +    +++   S  ++
Sbjct: 706 IVSEFMILANSLAGKYFKNHKIPAIYKTYKGLNMKPKASSQFKKILNVNKKRLP-SIKEI 764

Query: 651 VKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQE 710
            K+ + L++S +SS P  H M+GT++Y T+TSPLRR PD+INH QLHR+L + P CFSQE
Sbjct: 765 SKIGSLLSSSTFSSKPSIHEMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQE 824

Query: 711 QIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCK 770
           ++D + WH++ RD  L+  S++ + +WTL YL +++   P  R+D++V S+  NG VHC 
Sbjct: 825 KLDEMVWHLIERDTILRHYSRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCI 884

Query: 771 IPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815
           +P + Y++G LK+ PS    PA+G  + NC I  +D L  +L F +
Sbjct: 885 LPKLSYATGTLKLKPSATTIPAIGEIIKNCKIANIDCLGNSLEFAI 930

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  445 bits (1145), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 284/894 (31%), Positives = 471/894 (52%), Gaps = 106/894 (11%)

Query: 11   LQIGDLCVLSAVPGKLVVCVEQPTXXXXXXXXXXXXXXXVCYATKSDVRLRVPGLHKRPL 70
            L IGDL +L      L++CV+ P                + + T+S++ LR+P      L
Sbjct: 152  LNIGDLILLPD-SSNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYL 210

Query: 71   --RYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLPEVVAK 128
                LL  E DHG   +GT+KN  +   LLP+  R+L     +  +++ A  +L  ++ K
Sbjct: 211  MDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDKLSIILKK 270

Query: 129  LELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQGSYCSAA 188
            LEL+HR +Q+  GP+Q+S FKL+ L+  L L  +  + S+K      ++N+      S+ 
Sbjct: 271  LELIHRLIQNGNGPYQISFFKLIKLIDILNL--NDFDNSKKF-----DINLNFSKLLSSN 323

Query: 189  DINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRDQTLFY 248
            +I   + +  ++D + +LATYW +  QQ D +WG I  ++AL SP+SVTVLPL    L++
Sbjct: 324  EIE-SLNSSTEIDASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPL---VLYH 379

Query: 249  DYLLRDMKRDDYAA------LDEF--------------------------ACLVNQGKYK 276
            +Y    ++R + A       LD F                                   K
Sbjct: 380  NYYNNFLQRSNNAIKNGKSLLDSFIDDINNQSTTNTTNNNNNTTIITTTTTNNNKLDSSK 439

Query: 277  EACSNYKSVLQLLRDYCAGNINSNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLC- 335
                NY   + + ++YCAGN + N+ +I L++++ RRL  +K+ ++T+    +LL  LC 
Sbjct: 440  NISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKDTCKELL-DLCT 498

Query: 336  -----------------------------PETPH---------NPLHWNHQLELPLSNPR 357
                                          +TP+         N LH N ++ LP S+  
Sbjct: 499  SKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKL 558

Query: 358  TALEQKVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHV 416
            T  +   Y+L  PP   +      +F+ +  YCIDS  AHEIDDG+SIE+L  + + LH+
Sbjct: 559  TKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHI 618

Query: 417  HIAYPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKP 476
            HIA P S+F       +  I  ++++A  ++FTTYLPDLV PM+PKS+ + SDLG  ++ 
Sbjct: 619  HIADPSSIFLNHEKNSD--IQNLLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQK 676

Query: 477  TKTITISVDVDL---SKKLRVVDEATLQIALG-TTRTSKRVTYDYVDDLLESKRQDAEAS 532
            T TI+ SV+V++   ++ ++++   T ++ LG  ++     TYD VD +L +  ++   S
Sbjct: 677  TATISFSVNVEVDSNNESIKIL-HNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKS 735

Query: 533  --------DLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDS 583
                    DLR L +++  L++ R    +A++FG+  N GL++L+ ++DG  + +   D 
Sbjct: 736  GVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQ 794

Query: 584  KSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKG 643
              TKS TLV+E+MI+ANSLA R F EN IPG++R   EL L  +A  ++  L+  ++   
Sbjct: 795  NDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNS 854

Query: 644  SVSS-SDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRS 702
             + +  ++ K  + L +S Y+  P  H M+G   YLT+TSPLRR PD++NHMQ+   ++ 
Sbjct: 855  HLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKK 914

Query: 703  LPPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLP 762
             P  +S   I  +   I +RD+ +++ S + + ++ L YLK+Q+   P + +D+++TS+ 
Sbjct: 915  KPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVS 974

Query: 763  LNGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815
              GF+HC +P    S G LK+ P     P++G  + NC I ++D+LDG L F M
Sbjct: 975  NLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDFSM 1028

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 86/379 (22%), Positives = 146/379 (38%), Gaps = 62/379 (16%)

Query: 356 PRTALEQKV-YDLASPPLDQEEP--GPRKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSR 411
           P    E KV  DL S     ++P    RK+      C ID P   +IDD +  ++L    
Sbjct: 500 PSEGHEWKVPSDLTSSDALAKDPQLARRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGN 559

Query: 412 YRLHVHIAYPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLG 471
           + + VHIA   + F K  TP +            R  + YL D    M+P      +DL 
Sbjct: 560 WEVGVHIA-DVTHFVKPNTPLDAE-------GASRGTSVYLVDKRIDMLP--LLLGTDLC 609

Query: 472 QWDKPTKTITISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEA 531
                      SV  +L     +VD   +       R+ +  +Y+     ++ K Q  E 
Sbjct: 610 SLKPYVDRYAFSVLWELDDNANIVD---VNFTKSVIRSREAFSYEQAQIRIDDKSQTDEL 666

Query: 532 SD-LRLLYKVAESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTK--- 587
           +  +R L K++  L+++R           +  G ++L   E    ++ +  D    +   
Sbjct: 667 TQGMRALLKLSIKLKQKR-----------LDAGALNLASPEVKVHMDSETSDPNEVEIKK 715

Query: 588 ---SNTLVSELMIMANSLAGRYFHEN-------------------TIPGVYRGCTELLLK 625
              +N+LV E M++AN    R   E+                   T+  +     ++ + 
Sbjct: 716 LLATNSLVEEFMLLANISVARKIFESFPQTAMLRRHGVPPSTNFETLNEMLHQRKQMTIS 775

Query: 626 FEASNQYA-SLQRAMRQKG-------SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEY 677
            E+S   A SL R +  K         + S+  +  A +  +  YS +  RH  +  + Y
Sbjct: 776 LESSKALADSLDRCVDPKDPYFNTLIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIY 835

Query: 678 LTITSPLRRLPDMINHMQL 696
              TSP+RR  D++ H QL
Sbjct: 836 THFTSPIRRYCDVVAHRQL 854

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 82/365 (22%), Positives = 145/365 (39%), Gaps = 63/365 (17%)

Query: 367 LASPPLDQEEPGPRKEFSGVCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFK 426
           +A  PL Q+    R +   +C  ID P   +IDD +  ++L    + + VHIA   + F 
Sbjct: 509 IAKDPLLQKRVDLRDKL--IC-SIDPPGCVDIDDALHAKKLPNGHFEVGVHIA-DVTHFV 564

Query: 427 KSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDV 486
           K+ TP +            R  + YL D    M+P      +DL            SV  
Sbjct: 565 KAGTPLDAE-------GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIW 615

Query: 487 DLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEAS-DLRLLYKVAESLR 545
           +L +   +V    +  +    R+ +  +Y+     ++ K Q  E +  +R L  ++  L+
Sbjct: 616 ELDENADIV---KVDFSKSVIRSREAFSYEQAQLRIDDKNQTDELTLGMRALLDLSIKLK 672

Query: 546 EERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSELMIMA 599
           ++R           +  G ++L   E    ++ +  D       K   +N+LV E M++A
Sbjct: 673 QKR-----------LDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLA 721

Query: 600 NSLAGRYFHENTIPGV-------------YRGCTELLLK-------FEASNQYA-SLQRA 638
           N    R  ++ + P               +    E+L K        E+S   A SL R 
Sbjct: 722 NISVARKIYD-SFPQTAMLRRHAAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRC 780

Query: 639 MRQKG-------SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMI 691
           + +K         + S+  +  A +  +  YS +  RH  +  + Y   TSP+RR  D++
Sbjct: 781 VDKKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVV 840

Query: 692 NHMQL 696
            H QL
Sbjct: 841 AHRQL 845

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/345 (22%), Positives = 136/345 (39%), Gaps = 59/345 (17%)

Query: 386 VCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDPVMDIAFR 445
           +C  ID P   +IDD +  +RL    + + VHIA      K    PG   +D        
Sbjct: 553 IC-SIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVK----PG-TALDAE---GAS 603

Query: 446 RAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDEATLQIALG 505
           R  + YL D    M+P      +DL            SV  +L     ++D   ++    
Sbjct: 604 RGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDDNAEIID---VKFTKS 658

Query: 506 TTRTSKRVTYDYVDDLLESKRQDAEASD-LRLLYKVAESLREERKVLKHAIMFGDVQNGL 564
             R+ +  +Y+     ++ K Q  E +  +R L +++  L+++R           +  G 
Sbjct: 659 VIRSREAFSYEQAQLRIDDKNQTDELTKGMRALLELSVKLKQKR-----------LDAGA 707

Query: 565 ISLTPNEDGKLLNVQLVDSKSTK------SNTLVSELMIMAN-SLAGRYF---------- 607
           ++L   E    ++ +  D    +      +N+LV E M++AN S+A + F          
Sbjct: 708 LNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIFDAFPQTAMLR 767

Query: 608 -HENTIPGVYRGCTELLLK-------FEASNQYA-SLQRAMRQKG-------SVSSSDLV 651
            H +     +    E+L K        E+S   A SL R +  K         + S+  +
Sbjct: 768 RHASPPSTNFAILNEMLQKRKNLSISLESSKALADSLDRCIDPKDPYFNTLIRIMSTRCM 827

Query: 652 KVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
             A +  +  Y  +  RH  +  + Y   TSP+RR  D+I H QL
Sbjct: 828 MAAQYFYSGAYQYSDFRHYGLAVDIYTHFTSPIRRFCDVIAHRQL 872

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 76/355 (21%), Positives = 138/355 (38%), Gaps = 61/355 (17%)

Query: 378 GPRKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPI 436
             R++      C ID P   +IDD +  ++L    + + VHIA   + F K  T  +   
Sbjct: 517 AKRRDMRDKLICSIDPPGCVDIDDALHAKKLINGNWEVGVHIA-DVTHFVKPNTALDAE- 574

Query: 437 DPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVD 496
                    RA + YL D    M+P      +DL            SV  +L     +V 
Sbjct: 575 ------GASRATSVYLVDKRIDMLP--MLLGTDLCSLKASVDRFAFSVIWELDNDANIV- 625

Query: 497 EATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEAS-DLRLLYKVAESLREERKVLKHAI 555
             +++      R+ +  +Y+     ++   Q+ E +  +R L ++++ L+++R       
Sbjct: 626 --SVEFTKSVIRSREAFSYEQAQLRIDDPNQNDELTLGMRALLQLSKKLKQKR------- 676

Query: 556 MFGDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSELMIMANSLAGRYFHE 609
               +  G ++L   E    ++ +  D       K   +N+LV E M++AN    R  ++
Sbjct: 677 ----LDAGALNLASPEVKVHMDSETSDPSEVEIKKLLSTNSLVEEFMLLANISVARKIYD 732

Query: 610 NTIPGV-------------YRGCTELL-------LKFEASNQYA-SLQRAMRQKG----- 643
            + P               +    E+L       +  E+S   A SL R +         
Sbjct: 733 -SFPQTAMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVYFNT 791

Query: 644 --SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
              + S+  +  A +  +  YS +  RH  +  + Y   TSP+RR  D+I H QL
Sbjct: 792 LVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQL 846

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 77/352 (21%), Positives = 135/352 (38%), Gaps = 59/352 (16%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           R++      C ID P   +IDD +  ++L    + + VHIA   + F K+ TP +     
Sbjct: 518 RRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIA-DVTHFVKAGTPLDAE--- 573

Query: 439 VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDEA 498
                  R  + YL D    M+P      +DL            SV  +L +K  +V+  
Sbjct: 574 ----GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDQKASIVN-- 625

Query: 499 TLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASD-LRLLYKVAESLREERKVLKHAIMF 557
            +       R+ +  +Y+     ++   Q  E +  +R L  ++  L+++R         
Sbjct: 626 -VDFTKSVIRSREAFSYEQAQLRIDDPNQKDELTQGMRALLNLSVKLKQKR--------- 675

Query: 558 GDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSELMIMANSLAGRYFHEN- 610
             +  G ++L   E    ++ +  D       K   +N+LV E M++AN    +  +E  
Sbjct: 676 --LDAGALNLASPEVKVHMDSETSDPGDVEIKKLLATNSLVEEFMLLANISVAKKIYEAF 733

Query: 611 -TIPGVYRGCTELLLKFEASNQYASLQRAM-----RQKGSVSSSD------------LVK 652
                + R        FE  N+   L+++M       K    S D            LV+
Sbjct: 734 PQTAMLRRHAAPPSTNFETLNEMLQLRKSMSISLESSKALADSLDRCIDPQDPYFNTLVR 793

Query: 653 V--------AAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
           +        A +  +  YS    RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 794 IMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 845

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 79/356 (22%), Positives = 140/356 (39%), Gaps = 67/356 (18%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFK-KSYTPGEVPID 437
           R++      C ID P   +IDD +  ++L    + + VHIA      K  +   GE    
Sbjct: 523 RRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPNTALDGE---- 578

Query: 438 PVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDE 497
                   R  + YL D    M+P      +DL            SV  +L++   +V+ 
Sbjct: 579 -----GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVLWELNENADIVN- 630

Query: 498 ATLQIALGTTRTSKRVTYDY----VDDLLESKRQDAEASDLRLLYKVAESLREERKVLKH 553
             +  A    ++ +  +Y+     +DD     +QD     +R L K++  L+E+R     
Sbjct: 631 --VDFAKSVIKSREAFSYEQAQLRIDD---PNQQDELTHGMRALLKLSIKLKEKR----- 680

Query: 554 AIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSELMIMAN-SLAGRY 606
                 +  G ++L   E    ++ +  D    +      +N+LV E M++AN S+A + 
Sbjct: 681 ------INAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI 734

Query: 607 F-----------HENTIPGVYRGCTELL-------LKFEASNQYA-SLQRAMRQKG---- 643
           +           H +     +    E+L       +  E+S   A SL R +  K     
Sbjct: 735 YDSFPQTAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKDPYFN 794

Query: 644 ---SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
               + S+  +  A +  +  YS +  RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 795 TLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 850

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 74/352 (21%), Positives = 135/352 (38%), Gaps = 59/352 (16%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           RK+      C ID P   +IDD +   +L    + + VHIA   + F K  T  +     
Sbjct: 560 RKDLRDKVICSIDPPGCVDIDDALHARKLPNGNWEVGVHIA-DVTHFVKPSTALDAE--- 615

Query: 439 VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDEA 498
                  R  + YL D    M+P      +DL            SV  +L     +V+  
Sbjct: 616 ----GAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVMWELDDNADIVN-- 667

Query: 499 TLQIALGTTRTSKRVTYDYVDDLLESKRQDAEAS-DLRLLYKVAESLREERKVLKHAIMF 557
            ++      ++ +  +Y+     ++ K QD E +  +R L K++  L+++R         
Sbjct: 668 -VEFMKSVIKSREAFSYEQAQLRIDDKNQDDELTLGMRALLKLSIKLKQKR--------- 717

Query: 558 GDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSELMIMANSLAGRYFHE-- 609
             ++ G ++L   E    ++ +  D    +      +N+LV E M++AN    R  ++  
Sbjct: 718 --LEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAF 775

Query: 610 -----------------NTIPGVYRGCTELLLKFEASNQYA-SLQRAMRQKG-------S 644
                             T+  +      + +  E+S   A SL R +  +         
Sbjct: 776 PQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDSEDPYFNTLVR 835

Query: 645 VSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
           + S+  +  A +  +  YS    RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 836 IMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 887

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 83/371 (22%), Positives = 140/371 (37%), Gaps = 67/371 (18%)

Query: 366 DLASPPLDQEEP--GPRKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPY 422
           DL  P    ++P    R++      C ID P   +IDD +  ++L    + + VHIA   
Sbjct: 500 DLTDPEAVAQDPLLPKRRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIA-DV 558

Query: 423 SLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITI 482
           + F K  TP +            R  + YL D    M+P      ++L            
Sbjct: 559 THFVKPNTPLDAE-------GASRGTSVYLVDKRIDMLP--MLLGTNLCSLKPYVDRFAF 609

Query: 483 SVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDY----VDDLLESKRQDAEASDLRLLY 538
           SV  +L +   +V+   +       ++ +  +Y+     +DD   S + D     +R L 
Sbjct: 610 SVLWELDQDANIVN---VDFTKSVIKSREAFSYEQAQLRIDD---STQTDELTQGMRALL 663

Query: 539 KVAESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLV 592
            ++  L+E+R           +  G ++L   E    ++ +  D       K   +N+LV
Sbjct: 664 SLSIKLKEKR-----------LNAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLV 712

Query: 593 SELMIMANSLAGRYFHEN--TIPGVYRGCTELLLKFEASNQYASLQRAMR-----QKGSV 645
            E M++AN    R  +E       + R        FEA N+   L++ M       K   
Sbjct: 713 EEFMLLANISVARKIYEAFPQTAMLRRHAAPPATNFEALNEMLQLRKGMSISLESSKALA 772

Query: 646 SSSD------------LVKV--------AAFLTNSHYSSTPCRHAMVGTEEYLTITSPLR 685
            S D            LV++        A +  +  YS    RH  +  + Y   TSP+R
Sbjct: 773 DSLDRCVDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIR 832

Query: 686 RLPDMINHMQL 696
           R  D++ H QL
Sbjct: 833 RYCDVVAHRQL 843

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 80/372 (21%), Positives = 140/372 (37%), Gaps = 69/372 (18%)

Query: 366 DLASPPLDQEEP--GPRKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPY 422
           DL  P   + +P    RK+F     C ID P   +IDD +  ++L    + + VHIA   
Sbjct: 523 DLTDPEAIRNDPLLPSRKDFRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVT 582

Query: 423 SLFKKSYTPGEVPIDPVMDI-AFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTIT 481
              K    PG       +D     R  + YL D    M+P      +DL           
Sbjct: 583 HFVK----PG-----TALDAEGASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFA 631

Query: 482 ISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEAS-DLRLLYKV 540
            SV  +L     +V    +       R+ +  +Y+   + ++ +    E +  +R L ++
Sbjct: 632 FSVVWELDNDANIV---GVDFTKSVIRSREAFSYEKAQNRIDDETAKDELTLGMRALLQL 688

Query: 541 AESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSE 594
           ++ L+++R           +  G ++L   E    ++ +  D    +      +N+LV E
Sbjct: 689 SKKLKQKR-----------LDAGALNLASPEVKVHMDSETSDPNEVEIKKLLDTNSLVEE 737

Query: 595 LMIMANSLAGRYFHE----------------------NTIPGVYRGCTELLLKFEASNQY 632
            M++AN    R  +E                      N +  V +G +   +  E+S   
Sbjct: 738 FMLLANISVARKIYEAFPQTAMLRRHAAPPSTNFELLNEMLQVRKGMS---ISLESSKAL 794

Query: 633 A-SLQRAMRQKGS-------VSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPL 684
           A SL R      S       + S+  +  A +     +S    RH  +  + Y   TSP+
Sbjct: 795 ADSLDRCEDPNDSYLNTLIRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPI 854

Query: 685 RRLPDMINHMQL 696
           RR  D++ H QL
Sbjct: 855 RRYCDVVAHRQL 866

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 80/368 (21%), Positives = 140/368 (38%), Gaps = 61/368 (16%)

Query: 366 DLASPPL---DQEEPGPRKEFSGVCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPY 422
           DL+SP     D   P  R     +   ID P   +IDD +  ++L    + + VHIA   
Sbjct: 500 DLSSPEAIAKDHLLPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIA-DV 558

Query: 423 SLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITI 482
           + F K+ TP +            R  + YL D    M+P      ++L            
Sbjct: 559 THFVKANTPLDAE-------GASRGTSVYLVDKRIDMLP--MLLGTNLCSLKPYVDRFAF 609

Query: 483 SVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASD-LRLLYKVA 541
           SV  +L +   +V+   +       ++ +  +Y+     ++ + Q  E +  +R L +++
Sbjct: 610 SVLWELDENANIVN---VDFTKSVIKSREAFSYEQAQLRIDDESQKDELTQGMRALLQLS 666

Query: 542 ESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSEL 595
             L+++R           +  G ++L   E    ++ +  D       K   +N+LV E 
Sbjct: 667 IKLKQKR-----------LDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEF 715

Query: 596 MIMANSLAGRYFHEN--TIPGVYRGCTELLLKFEASNQYASLQRAMR-----QKGSVSSS 648
           M++AN    R  +E       + R        FE  N+   L++ M       K   +S 
Sbjct: 716 MLLANISVARRIYEAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKALANSL 775

Query: 649 D------------LVKV--------AAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLP 688
           D            LV++        A +     YS    RH  +  + Y   TSP+RR  
Sbjct: 776 DRCVDLEDPYFNTLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYC 835

Query: 689 DMINHMQL 696
           D++ H QL
Sbjct: 836 DVVAHRQL 843

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/372 (20%), Positives = 143/372 (38%), Gaps = 64/372 (17%)

Query: 362 QKVYDLASPPLDQEEPGPRKEFSGVCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYP 421
           +K+ D A+   D   P  R     +   ID P+  +IDD +  + L+   + + VHIA  
Sbjct: 520 EKLSDSAAIAKDPLLPKRRDLRDKLICSIDPPNCVDIDDALHAKMLENGNWEVGVHIADV 579

Query: 422 YSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTIT 481
               K    PG   +D        R  + YL D    M+P      +DL           
Sbjct: 580 THFVK----PG-TALDAE---GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFA 629

Query: 482 ISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASD-LRLLYKV 540
            SV  +L +   +V+   +       R+ +  +Y+     ++   Q  E +  +R L ++
Sbjct: 630 FSVLWELDQDANIVN---VDFTKSVIRSREAFSYEQAQIRIDDPNQTDELTQGMRALLQL 686

Query: 541 AESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSE 594
           ++ L+++R           +  G ++L   E    ++ +  D    +      +N+LV E
Sbjct: 687 SKKLKQKR-----------LDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEE 735

Query: 595 LMIMANSLAGRYFHE----------------------NTIPGVYRGCTELLLKFEASNQY 632
            M++AN    R  ++                      N +    +G T   +  E+S   
Sbjct: 736 FMLLANISVARKIYDSFPQTAMLRRHAAPPSTNFEILNEMLQTKKGLT---ISLESSKAL 792

Query: 633 A-SLQRAMRQKG-------SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPL 684
           A SL R + +          + S+  +  A +  +  YS +  RH  +  + Y   TSP+
Sbjct: 793 ADSLDRCVDKNDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPI 852

Query: 685 RRLPDMINHMQL 696
           RR  D++ H QL
Sbjct: 853 RRYCDVVAHRQL 864

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 81/358 (22%), Positives = 136/358 (37%), Gaps = 71/358 (19%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           RK+      C ID P   +IDD +  ++L    + + VHIA      K    PG      
Sbjct: 526 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGHWEVGVHIADVTHFVK----PG-----T 576

Query: 439 VMDI-AFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDE 497
            +D     R  + YL D    M+P      +DL            SV  +L +   +++ 
Sbjct: 577 ALDAEGASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDENADIIN- 633

Query: 498 ATLQIALGTTRTSKRVTYDY----VDDLLESKRQDAEASDLRLLYKVAESLREERKVLKH 553
             ++      R+ +   Y+     +DD    K+QD     +R L +++  L+++R     
Sbjct: 634 --VEFHKSVIRSREAFAYEQAQLRIDD---PKQQDELTLGMRALLQLSIKLKQKR----- 683

Query: 554 AIMFGDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSELMIMANSLAGRYF 607
                 ++ G ++L   E    ++ +  D       K   +N+LV E M++AN    R  
Sbjct: 684 ------LEAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKI 737

Query: 608 HEN--TIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSD---------------- 649
           +++      + R        FE  N+   LQR      SV SS                 
Sbjct: 738 YDSFPQTAMLRRHAPPPATNFEILNEM--LQRRKNMSISVESSKALADSLDRCEDPKDPY 795

Query: 650 ---LVKV--------AAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
              LV++        A +  +  YS    RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 796 FNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDIVAHRQL 853

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 76/352 (21%), Positives = 134/352 (38%), Gaps = 59/352 (16%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           RK+      C ID P   +IDD +  +RL    + + VHIA   + F K  T  +     
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIA-DVTHFVKPNTALDAE--- 586

Query: 439 VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDEA 498
                  R  + YL D    M+P      +DL            SV  +L     +V+  
Sbjct: 587 ----GAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDDDANIVN-- 638

Query: 499 TLQIALGTTRTSKRVTYDYVDDLLESKRQDAE-ASDLRLLYKVAESLREERKVLKHAIMF 557
            +       ++ +  +Y+     ++ K Q+ E  S +R L +++  L+++R         
Sbjct: 639 -VDFMKSVIKSREAFSYEQAQFRIDDKNQNDELTSGMRALLELSIKLKQKR--------- 688

Query: 558 GDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSELMIMANSLAGRYFHEN- 610
             ++ G ++L   E    ++ +  D    +      +N+LV E M++AN    R  ++  
Sbjct: 689 --LEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAF 746

Query: 611 -TIPGVYRGCTELLLKFEASNQYASLQRAM-----RQKGSVSSSD------------LVK 652
                + R        FE  N+  + ++ M       K    S D            LV+
Sbjct: 747 PQTAMLRRHAAPPSTNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLVR 806

Query: 653 V--------AAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
           +        A +  +  YS    RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 807 IMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 77/354 (21%), Positives = 136/354 (38%), Gaps = 63/354 (17%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           RK+      C ID P   +IDD +  ++L    + + VHIA      K    PG      
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVK----PGT----- 581

Query: 439 VMDI-AFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDE 497
            +D     R  + YL D    M+P      +DL            SV  +L     +V+ 
Sbjct: 582 ALDAEGAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDDSANIVN- 638

Query: 498 ATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEAS-DLRLLYKVAESLREERKVLKHAIM 556
             +       R+ +  +Y+     ++ K Q+ E +  +R L K++  L+++R        
Sbjct: 639 --VNFMKSVIRSREAFSYEQAQLRIDDKTQNDELTMGMRALLKLSVKLKQKR-------- 688

Query: 557 FGDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSELMIMANSLAGRYFHEN 610
              ++ G ++L   E    ++ +  D    +      +N+LV E M++AN    R  ++ 
Sbjct: 689 ---LEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYD- 744

Query: 611 TIPGV-------------YRGCTELL-------LKFEASNQYA-SLQRAMRQKG------ 643
             P               +    E+L       +  E+S   A SL R +  +       
Sbjct: 745 AFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTL 804

Query: 644 -SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
             + S+  +  A +  +  YS    RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 805 VRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 74/353 (20%), Positives = 135/353 (38%), Gaps = 61/353 (17%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           RK+      C ID P   +IDD +  +RL    + + VHIA      K    PG      
Sbjct: 531 RKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVK----PGT----- 581

Query: 439 VMDI-AFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDE 497
            +D     R  + YL D    M+P      +DL            SV  +L +   +V+ 
Sbjct: 582 ALDAEGAARGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVIWELDENANIVN- 638

Query: 498 ATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEAS-DLRLLYKVAESLREERKVLKHAIM 556
             +       R+ +  +Y+     ++   Q+ E +  +R L +++  L+++R        
Sbjct: 639 --VDFMKSVIRSREAFSYEQAQLRIDDINQNDELTLGMRALLQLSVKLKQKR-------- 688

Query: 557 FGDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSELMIMANSLAGRYFHE- 609
              ++ G ++L   E    ++ +  D    +      +N+LV E M++AN    R  ++ 
Sbjct: 689 ---LEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDA 745

Query: 610 ------------------NTIPGVYRGCTELLLKFEASNQYA-SLQRAMRQKG------- 643
                              T+  +      + +  E+S   A SL R +  +        
Sbjct: 746 FPQTAMLRRHAAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLV 805

Query: 644 SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
            + S+  +  A +  +  YS    RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 806 RIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 75/352 (21%), Positives = 137/352 (38%), Gaps = 59/352 (16%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           R++      C ID P   +IDD +  +RL    + + VHIA   + F K  T  +     
Sbjct: 527 RRDLRDKLICSIDPPGCVDIDDALHAKRLSNGNWEVGVHIA-DVTHFVKPNTALDAE--- 582

Query: 439 VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDEA 498
                  R  + YL D    M+P      +DL       +    SV  +L     +V+  
Sbjct: 583 ----GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVERFAFSVIWELDDNANIVN-- 634

Query: 499 TLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASD-LRLLYKVAESLREERKVLKHAIMF 557
            +       ++ +  +Y+     ++   Q  E ++ +R L +++  L+++R         
Sbjct: 635 -VDFMKSVIKSREAFSYEQAQLRIDDPNQKDELTEGMRALLQLSIKLKQKR--------- 684

Query: 558 GDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSELMIMAN-SLAGRYF--- 607
             +  G ++L   E    ++ +  D    +      +N+LV E M++AN S+A + F   
Sbjct: 685 --LDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIFDAF 742

Query: 608 --------HENTIPGVYRGCTELL-------LKFEASNQYA-SLQRAMRQKG-------S 644
                   H       +    E+L       +  E+S   A SL R +  +         
Sbjct: 743 PQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQDPYFNTLVR 802

Query: 645 VSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
           + S+  +  A +  +  YS    RH  +  + Y   TSP+RR  D++ H QL
Sbjct: 803 IMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 854

>AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL021C
           (DIS3)
          Length = 997

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 78/369 (21%), Positives = 143/369 (38%), Gaps = 63/369 (17%)

Query: 366 DLASPPLDQEEP--GPRKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPY 422
           DL+ P    ++P    R++      C ID P   +IDD +  +RL    + + VHIA   
Sbjct: 512 DLSDPEAISKDPLLPKRRDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVT 571

Query: 423 SLFKKSYTPGEVPIDPVMDI-AFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTIT 481
              K    PG       +D     RA + YL +    M+P      +DL           
Sbjct: 572 HFVK----PG-----TALDTEGASRATSVYLVNKRIDMLP--MLLGTDLCSLKPYVDRFA 620

Query: 482 ISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEASD-LRLLYKV 540
            SV  +L     +V+   +       R+ +  +Y+     ++   Q+ E ++ +R L ++
Sbjct: 621 FSVLWELDADANIVN---VDFTKSVIRSREAFSYEAAQLRIDDVNQNDELTNGMRALLEL 677

Query: 541 AESLREERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTK------SNTLVSE 594
           ++ L+++R           +  G ++L   E    ++ +  D    +      +N+LV E
Sbjct: 678 SKKLKQKR-----------LDAGALNLASPEVKVHMDNETSDPNEVEIKKLLATNSLVEE 726

Query: 595 LMIMANSLAGRYFHEN--TIPGVYRGCTELLLKFEASNQYASLQRAM-----RQKGSVSS 647
            M++AN    R  ++       + R        FEA N+   +++ M       K    S
Sbjct: 727 FMLLANISVARKINDAFPQTAMLRRHAAPPSTNFEALNEMLQVRKKMAISLESSKALADS 786

Query: 648 SD------------LVKV--------AAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRL 687
            D            LV++        A +  +  +S +   H  +  + Y   TSP+RR 
Sbjct: 787 LDRCIDPEDPYFNTLVRIMSTRCMMAAQYFYSGAFSYSDFHHYGLAVDIYTHFTSPIRRY 846

Query: 688 PDMINHMQL 696
            D++ H QL
Sbjct: 847 CDVVVHRQL 855

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 79/366 (21%), Positives = 142/366 (38%), Gaps = 65/366 (17%)

Query: 367 LASPPLDQEEPGPRKEFSGVCYCIDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFK 426
           LA+ PL  +    R +   +C  ID P   +IDD +  +RL    + + VHIA      K
Sbjct: 521 LANDPLLAKRTDLRDKL--IC-SIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVK 577

Query: 427 KSYTPGEVPIDPVMDI-AFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVD 485
               PG       +D     R  + YL D    M+P      +DL            SV 
Sbjct: 578 ----PG-----TALDAEGASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVI 626

Query: 486 VDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDAEAS-DLRLLYKVAESL 544
            +L++   +V+   +       R+ +  +Y+     ++   Q  E +  +R L  +++ L
Sbjct: 627 WELNEDADIVN---VDFTKSVIRSREAFSYEQAQVRIDDSNQKDELTLGMRALLHLSKKL 683

Query: 545 REERKVLKHAIMFGDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSELMIM 598
           +++R           +  G ++L   E    ++ +  D       K   +N+LV E M++
Sbjct: 684 KQKR-----------LDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLL 732

Query: 599 ANSLAGRYFHENTIPGV-------------YRGCTELL-------LKFEASNQYA-SLQR 637
           AN    R  ++   P               +    E+L       +  E+S   A SL R
Sbjct: 733 ANISVARKIYD-AFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMTISLESSKALADSLDR 791

Query: 638 AMRQKGS-------VSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDM 690
            +  + +       + S+  +  A +  +  YS    +H  +  + Y   TSP+RR  D+
Sbjct: 792 CIDPQDAYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDV 851

Query: 691 INHMQL 696
           + H QL
Sbjct: 852 VAHRQL 857

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 76/354 (21%), Positives = 132/354 (37%), Gaps = 63/354 (17%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           RK+      C ID P   +IDD +  +RL    + + VHIA      K    PG      
Sbjct: 528 RKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTHFVK----PG-----T 578

Query: 439 VMDI-AFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDE 497
            +D     R  + YL D    M+P      +DL            SV  +L +   +V+ 
Sbjct: 579 ALDAEGASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVLWELDENADIVN- 635

Query: 498 ATLQIALGTTRTSKRVTYDYVDDLLESKRQ-DAEASDLRLLYKVAESLREERKVLKHAIM 556
             +       ++ +  +Y+     ++   Q D     +R L +++  L+++R        
Sbjct: 636 --VDFTKSVIKSREAFSYEQAQLRIDDASQTDDLTQGMRALLQLSIKLKQKR-------- 685

Query: 557 FGDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSELMIMANSLAGRYFHEN 610
              +  G ++L   E    ++ +  D       K   +N+LV E M++AN    R  ++ 
Sbjct: 686 ---LDAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKIYD- 741

Query: 611 TIPGV-------------YRGCTELL-------LKFEASNQYA-SLQRAMRQKG------ 643
             P               +    E+L       +  E+S   A SL R    K       
Sbjct: 742 AFPQTAMLRRHAAPPSTNFELLNEMLHQRKNMSISLESSKALADSLDRCEDPKDPYFNTL 801

Query: 644 -SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
             + S+  +  A +  +  YS    +H  +  + Y   TSP+RR  D++ H QL
Sbjct: 802 VRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVVAHRQL 855

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 75/353 (21%), Positives = 131/353 (37%), Gaps = 61/353 (17%)

Query: 380 RKEFSGVCYC-IDSPDAHEIDDGVSIERLKGSRYRLHVHIAYPYSLFKKSYTPGEVPIDP 438
           RK+      C ID P   +IDD +  ++L    + + VHIA   + F K  T  +     
Sbjct: 542 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIA-DVTHFVKQGTALDAE--- 597

Query: 439 VMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPTKTITISVDVDLSKKLRVVDEA 498
                  R  + YL D    M+P      +DL            SV  +L     +V   
Sbjct: 598 ----GASRGTSVYLVDKRIDMLP--MLLGTDLCSLKPYVDRFAFSVLWELDSNADIV--- 648

Query: 499 TLQIALGTTRTSKRVTYDYVDDLLESKRQ-DAEASDLRLLYKVAESLREERKVLKHAIMF 557
            +       ++ +  +Y+     ++   Q D     +R L +++  L+++R         
Sbjct: 649 KVDFTKSVIKSREAFSYEQAQLRIDDPNQTDDLTQGMRALLQLSIKLKQKR--------- 699

Query: 558 GDVQNGLISLTPNEDGKLLNVQLVD------SKSTKSNTLVSELMIMANSLAGRYFHENT 611
             + NG ++L   E    ++ +  D       K   +N+LV E M++AN    R  ++  
Sbjct: 700 --LDNGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKIYD-A 756

Query: 612 IPGV-------------YRGCTELL-------LKFEASNQYA-SLQRAMRQKG------- 643
            P               +    E+L       +  E+S   A SL R    K        
Sbjct: 757 FPQTAMLRRHAAPPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCEDPKDPYFNTLV 816

Query: 644 SVSSSDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQL 696
            + S+  +  A +  +  YS    +H  +  + Y   TSP+RR  D++ H QL
Sbjct: 817 RIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQL 869

>KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]
           {ON} conserved hypothetical protein
          Length = 651

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 555 IMFGDVQNGLISLTPNEDGKLLNVQLVDSKSTKSNTLVSELMIMANSLAGRYFHENTIP- 613
           +++  V++ L+SL P E   LL  Q   +K+ + NT++ E+ +   +    Y+   T   
Sbjct: 244 LLYVSVKHWLVSLGPQETHPLLTTQATFTKNFEDNTVLKEVFLCCGATFMEYYDSETFST 303

Query: 614 ---GVYRGCTELLLKFEASN 630
               +Y+    L+ KF   N
Sbjct: 304 LSTDLYQSSLTLIKKFLEDN 323

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1260

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 677  YLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDAL 715
            Y   TSPLRR  D + H QL   +R +P     E IDAL
Sbjct: 1004 YTHFTSPLRRYADHVVHRQLRSAIRGVPYT---EDIDAL 1039

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,112,385
Number of extensions: 3417682
Number of successful extensions: 8366
Number of sequences better than 10.0: 52
Number of HSP's gapped: 8408
Number of HSP's successfully gapped: 58
Length of query: 817
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 699
Effective length of database: 39,950,811
Effective search space: 27925616889
Effective search space used: 27925616889
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)