Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR320W3.501ON2572578611e-117
Kwal_47.189053.501ON2361303838e-45
KLTH0G02332g3.501ON2331193803e-44
SAKL0F02486g3.501ON2301143706e-43
NCAS0F036003.501ON2371403603e-41
Kpol_480.83.501ON2391303603e-41
NDAI0B059203.501ON2351333577e-41
Skud_16.4483.501ON2081273504e-40
TPHA0A057203.501ON2201223436e-39
KNAG0A079903.501ON2211233437e-39
Smik_16.4063.501ON2121273349e-38
TBLA0C045303.501ON2221363341e-37
YPR154W (PIN3)3.501ON2151293332e-37
Suva_16.4823.501ON2351273333e-37
TDEL0D056903.501ON2011263303e-37
Ecym_12283.501ON2531093335e-37
Smik_6.2323.501ON2411203273e-36
YGR136W (LSB1)3.501ON2411213203e-35
Skud_7.4473.501ON2381133072e-33
Suva_7.4243.501ON2491403012e-32
KAFR0G037403.501ON2341422967e-32
CAGL0F04829g3.501ON2021322842e-30
KLLA0E03873g3.501ON2201072696e-28
ZYRO0D09702g3.501ON158682638e-28
KNAG0B007503.501ON2171322564e-26
ZYRO0G20372gsingletonON150581991e-18
TBLA0D029103.501ON2691132034e-18
Skud_8.681.356ON475571511e-10
YHR016C (YSC84)1.356ON468511492e-10
TBLA0B054702.502ON539731475e-10
Suva_15.1991.356ON457811465e-10
TDEL0A027802.502ON451811457e-10
ZYRO0D11110g5.470ON459561457e-10
SAKL0G03454g5.470ON468561449e-10
NDAI0A043505.470ON459561422e-09
TPHA0O012801.356ON454931422e-09
NCAS0A089901.356ON434511422e-09
KLLA0A08360g1.356ON423641422e-09
TDEL0A033405.470ON473531422e-09
SAKL0D09702g1.356ON4281071422e-09
Smik_8.811.356ON468511412e-09
KNAG0C046305.470ON516561413e-09
Kpol_440.105.470ON470661403e-09
Ecym_27471.356ON452511403e-09
AFR140C5.470ON388631394e-09
AEL017W1.356ON416941394e-09
TBLA0D049501.356ON468511394e-09
CAGL0M01650g5.470ON466571395e-09
NCAS0A119205.470ON463561386e-09
TPHA0C040202.502ON485671386e-09
NCAS0B072501.356ON441711377e-09
KNAG0C020401.356ON464771377e-09
Kpol_1056.372.502ON501691377e-09
KAFR0E036405.470ON441561361e-08
TBLA0A025705.470ON493551361e-08
ZYRO0B01298g2.502ON411601351e-08
Kwal_0.3711.356ON217511321e-08
Skud_4.6615.470ON460551342e-08
YDR388W (RVS167)5.470ON482561342e-08
Smik_7.3351.356ON460511342e-08
KAFR0D033602.502ON455641342e-08
TDEL0D022401.356ON433651342e-08
Smik_4.6585.470ON472561332e-08
Suva_8.512.502ON456551332e-08
KLTH0H12980g1.356ON399511332e-08
YFR024C-A (LSB3)1.356ON459511332e-08
KAFR0C044001.356ON459511333e-08
CAGL0K02761g2.502ON450551324e-08
YHL002W (HSE1)2.502ON452551324e-08
ABR008C2.502ON443691314e-08
SAKL0E02200g2.502ON511871315e-08
Kwal_55.212875.470ON461561306e-08
Skud_8.432.502ON454551306e-08
TBLA0F034901.356ON511741298e-08
KLTH0F15114g5.470ON435551298e-08
KLTH0D06138g2.502ON489561299e-08
CAGL0I08965g1.356ON437511289e-08
Kwal_26.79022.502ON532651291e-07
Ecym_24402.502ON459561271e-07
NDAI0B045801.356ON424511272e-07
Suva_6.961.356ON455511272e-07
Skud_6.1081.356ON459511272e-07
Kpol_1008.251.356ON449511262e-07
NDAI0G059601.356ON423551253e-07
Smik_8.472.502ON447551243e-07
Ecym_23165.470ON421721235e-07
TPHA0A022101.356ON397511235e-07
ZYRO0G00792g1.356ON469511218e-07
KLLA0B13475g2.502ON508561201e-06
TPHA0E015005.470ON457551201e-06
KAFR0A009701.356ON396511191e-06
NDAI0K021302.502ON459911192e-06
KNAG0I015801.356ON581511155e-06
NCAS0A050802.502ON450551147e-06
KNAG0A067102.502ON419571102e-05
Smik_8.1922.159ON633621093e-05
CAGL0A02145g1.356ON391521083e-05
KLLA0E03059g5.470ON428631083e-05
Skud_8.1752.159ON633561084e-05
ACR266W2.159ON626611076e-05
Suva_15.3102.159ON634621068e-05
Kwal_47.178942.159ON621651041e-04
Ecym_11678.539ON550791032e-04
Ecym_23082.591ON678561032e-04
AGR306C5.170ON923581032e-04
NCAS0B022208.539ON554721013e-04
YHR114W (BZZ1)2.159ON633621004e-04
SAKL0H10098g8.539ON55557995e-04
KLLA0F23848g2.159ON64949987e-04
TDEL0E055204.45ON158973997e-04
KLLA0E06953g7.419ON35752978e-04
KLLA0E23365g8.539ON57563979e-04
ABR082W2.591ON68358970.001
Suva_2.564singletonON4339840.002
SAKL0E10780g2.159ON62563950.002
TPHA0K006807.419ON35552930.003
NDAI0A014707.419ON36753930.003
Kwal_47.169434.335ON46065920.004
KLTH0E09790g2.159ON62278920.004
KLLA0A04983g4.108ON125169920.005
TPHA0B028902.159ON63452910.005
Smik_12.2517.365ON38898900.006
KLLA0E09043g2.319ON81459910.007
Ecym_25266.366ON52451900.007
KAFR0K020007.419ON33252890.007
YLR191W (PEX13)7.365ON38678890.008
Kpol_1072.562.159ON63758900.008
TDEL0F023804.108ON125563900.009
Ecym_71347.419ON33252880.010
NCAS0A145707.419ON35553880.012
Smik_13.2022.591ON66369880.014
NDAI0C054708.539ON58360880.014
Suva_10.2877.365ON39298870.016
Ecym_47107.365ON39972870.017
Skud_12.2567.365ON40361870.017
SAKL0H21912g4.108ON125373870.020
Kpol_325.126.366ON57062860.022
Kpol_538.255.170ON70760850.030
TBLA0F002806.366ON57692850.032
TDEL0C028107.419ON33753840.033
AEL241W8.539ON54951850.034
NCAS0A034904.108ON123575850.036
CAGL0E02783g4.108ON120382840.039
KLTH0E12518g8.539ON55264840.040
ZYRO0B04004g7.419ON37152830.040
KAFR0J026506.366ON55350840.045
YMR032W (HOF1)2.591ON66968830.048
AGL286C7.419ON33052820.051
TBLA0I010507.419ON37152820.058
Kpol_1045.217.419ON35852820.058
TBLA0C055602.159ON67351820.064
Kwal_33.148357.365ON38461820.068
KNAG0B050005.170ON85553820.069
SAKL0E06820g2.319ON90552820.084
Kwal_27.107077.419ON34352810.087
NCAS0D019505.170ON93951820.088
SAKL0A00594g6.366ON63651810.089
Ecym_72314.108ON114681820.090
KNAG0C033907.419ON34252800.093
KLTH0C06028g7.419ON34252800.095
YLL017WsingletonOFF10340750.10
Skud_13.1882.591ON66968800.12
CAGL0C03597g6.366ON58053800.12
ZYRO0D04004g8.539ON57270800.12
KNAG0C029104.108ON124469800.12
Suva_5.2397.419ON36854790.13
TBLA0C041004.108ON130264800.14
KLTH0B04818g7.365ON38061790.15
Kwal_27.120278.539ON49960790.15
Suva_13.2012.591ON66868790.16
KLLA0F14575g5.170ON85155790.17
NDAI0I002206.366ON61553790.17
ZYRO0D17358g6.366ON66850780.20
TDEL0A078106.366ON55850780.22
Smik_5.2637.419ON36852770.23
Ecym_33662.319ON90653780.26
YBL007C (SLA1)4.108ON124452780.27
Suva_2.1184.108ON116652780.27
KAFR0L015807.365ON34461770.28
Kwal_23.64376.366ON63151770.28
AGR170C4.108ON112173770.29
Smik_2.1134.108ON123052770.29
ADL288C2.319ON92567770.33
Ecym_54262.159ON67258770.33
CAGL0M05357g8.539ON55784760.34
KNAG0I027006.366ON57550760.34
TPHA0F031007.365ON38161760.36
ZYRO0G10098g4.108ON139264770.36
Skud_2.1044.108ON121452760.38
ZYRO0B16214g2.159ON65962760.40
CAGL0I02750g2.159ON61955760.40
NDAI0A033304.108ON122660760.41
TPHA0F003804.45ON161870760.47
Skud_3.1606.366ON58653750.49
TBLA0A076107.365ON41361750.54
Smik_3.1866.366ON59153750.55
CAGL0G03597g7.419ON35352740.62
Suva_3.1246.366ON60053740.70
KLLA0F10175g6.366ON57650740.70
TBLA0H035908.539ON60095740.74
KLTH0A07348g6.366ON62651740.75
TPHA0L016608.539ON54789730.79
Kpol_1024.458.539ON55454730.84
KAFR0J005805.170ON90259730.85
NCAS0D047406.366ON59450730.90
AGL237C6.366ON57851730.95
YCR088W (ABP1)6.366ON59253730.98
TDEL0B052202.159ON61362731.0
CAGL0G06842g5.170ON103970731.1
YJL020C (BBC1)5.170ON115768731.1
TBLA0A006108.539ON59769721.2
TPHA0H023806.366ON52850721.2
YER118C (SHO1)7.419ON36738711.5
SAKL0F13112g7.419ON34052701.9
YBR200W (BEM1)8.539ON55164702.0
Kwal_33.153395.170ON118462702.2
Kpol_457.12singletonON56751702.2
NCAS0B069802.159ON63961702.2
Ecym_82195.170ON102455692.7
NDAI0B043202.159ON63262692.7
Scer_YGOB_SDC25 (SDC25)4.45ON125240692.8
CAGL0C01881g7.413ON99951692.9
Skud_5.2617.419ON37234682.9
Skud_2.3268.539ON55357683.4
Smik_10.2515.170ON112255693.5
NCAS0A059704.45ON132361683.7
KLTH0B02354g5.170ON121456684.1
TBLA0C064405.170ON131455684.2
Kpol_1025.404.108ON120260675.8
SAKL0H24222g4.45ON152677676.0
TPHA0C026102.591ON67063666.0
NDAI0E040507.413ON97251666.4
Skud_12.514.45ON125440666.6
Suva_12.605.170ON114169659.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR320W
         (257 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   336   e-117
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   152   8e-45
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   150   3e-44
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   147   6e-43
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   143   3e-41
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   143   3e-41
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   142   7e-41
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   139   4e-40
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   136   6e-39
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   136   7e-39
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   133   9e-38
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   133   1e-37
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   132   2e-37
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   132   3e-37
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   131   3e-37
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   132   5e-37
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   130   3e-36
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   127   3e-35
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   122   2e-33
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   120   2e-32
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   118   7e-32
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   114   2e-30
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   108   6e-28
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   105   8e-28
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   103   4e-26
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    81   1e-18
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    83   4e-18
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    63   1e-10
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    62   2e-10
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    61   5e-10
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    61   5e-10
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    60   7e-10
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    60   7e-10
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    60   9e-10
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    59   2e-09
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    59   2e-09
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    59   2e-09
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    59   2e-09
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    59   2e-09
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    59   2e-09
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    59   2e-09
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    59   3e-09
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    59   3e-09
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    59   3e-09
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    58   4e-09
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    58   4e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    58   4e-09
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    58   5e-09
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    58   6e-09
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    58   6e-09
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    57   7e-09
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    57   7e-09
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    57   7e-09
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    57   1e-08
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    57   1e-08
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    57   1e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    55   1e-08
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    56   2e-08
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    56   2e-08
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    56   2e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    56   2e-08
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    56   2e-08
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    56   2e-08
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    56   2e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    56   2e-08
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    56   2e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    56   3e-08
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    55   4e-08
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    55   4e-08
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    55   4e-08
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    55   5e-08
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    55   6e-08
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    55   6e-08
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    54   8e-08
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    54   8e-08
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    54   9e-08
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    54   9e-08
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    54   1e-07
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    54   1e-07
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    54   2e-07
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    54   2e-07
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    54   2e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    53   2e-07
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    53   3e-07
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    52   3e-07
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    52   5e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    52   5e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    51   8e-07
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    51   1e-06
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    51   1e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    50   1e-06
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    50   2e-06
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    49   5e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    49   7e-06
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    47   2e-05
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    47   3e-05
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    46   3e-05
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    46   3e-05
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    46   4e-05
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    46   6e-05
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    45   8e-05
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    45   1e-04
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    44   2e-04
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    44   2e-04
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    44   2e-04
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     44   3e-04
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    43   4e-04
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    43   5e-04
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    42   7e-04
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    43   7e-04
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    42   8e-04
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    42   9e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    42   0.001
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    37   0.002
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    41   0.002
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    40   0.003
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    40   0.003
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    40   0.004
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    40   0.004
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    40   0.005
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    40   0.005
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    39   0.006
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    40   0.007
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    39   0.007
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    39   0.007
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    39   0.008
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    39   0.008
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    39   0.009
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    39   0.010
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    39   0.012
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    39   0.014
NDAI0C05470 Chr3 complement(1270339..1272090) [1752 bp, 583 aa] ...    39   0.014
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    38   0.016
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    38   0.017
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    38   0.017
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    38   0.020
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    38   0.022
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    37   0.030
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    37   0.032
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    37   0.033
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    37   0.034
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    37   0.036
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    37   0.039
KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369) ...    37   0.040
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    37   0.040
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    37   0.045
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    37   0.048
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    36   0.051
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    36   0.058
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    36   0.058
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    36   0.064
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    36   0.068
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    36   0.069
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    36   0.084
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    36   0.087
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     36   0.088
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    36   0.089
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    36   0.090
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    35   0.093
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    35   0.095
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    33   0.10 
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    35   0.12 
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    35   0.12 
ZYRO0D04004g Chr4 (327544..327552,327618..329327) [1719 bp, 572 ...    35   0.12 
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    35   0.12 
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    35   0.13 
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    35   0.14 
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    35   0.15 
Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]...    35   0.15 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    35   0.16 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    35   0.17 
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    35   0.17 
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    35   0.20 
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    35   0.22 
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    34   0.23 
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    35   0.26 
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    35   0.27 
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    35   0.27 
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    34   0.28 
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    34   0.28 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    34   0.29 
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    34   0.29 
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    34   0.33 
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    34   0.33 
CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} simil...    34   0.34 
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    34   0.34 
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    34   0.36 
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    34   0.36 
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    34   0.38 
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    34   0.40 
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    34   0.40 
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    34   0.41 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    34   0.47 
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    33   0.49 
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    33   0.54 
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    33   0.55 
CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {...    33   0.62 
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    33   0.70 
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    33   0.70 
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    33   0.74 
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    33   0.75 
TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {...    33   0.79 
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    33   0.84 
KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.1...    33   0.85 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    33   0.90 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    33   0.95 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    33   0.98 
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    33   1.0  
CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa] ...    33   1.1  
YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}...    33   1.1  
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    32   1.2  
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    32   1.2  
YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}  ...    32   1.5  
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    32   1.9  
YBR200W Chr2 (620872..622527) [1656 bp, 551 aa] {ON}  BEM1Protei...    32   2.0  
Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa...    32   2.2  
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    32   2.2  
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    32   2.2  
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    31   2.7  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    31   2.7  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    31   2.8  
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    31   2.9  
Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C ...    31   2.9  
Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W ...    31   3.4  
Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa] ...    31   3.5  
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    31   3.7  
KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakl...    31   4.1  
TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON} Anc_...    31   4.2  
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    30   5.8  
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    30   6.0  
TPHA0C02610 Chr3 complement(577049..579061) [2013 bp, 670 aa] {O...    30   6.0  
NDAI0E04050 Chr5 complement(903302..906220) [2919 bp, 972 aa] {O...    30   6.4  
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    30   6.6  
Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON...    30   9.3  

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  336 bits (861), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 178/257 (69%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120
           ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120

Query: 121 ASPPRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGANGYYKQSVXXXXXXXXXXXXXX 180
           ASPPRY                              GANGYYKQSV              
Sbjct: 121 ASPPRYPAQASAPQVQSPTPQSPPPPAGFSQSPFPPGANGYYKQSVAPYQPPPAPYQPPA 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAEQGADSGMSGAAKKFGSKLGNAA 240
                                              TAEQGADSGMSGAAKKFGSKLGNAA
Sbjct: 181 QYQTSPAQYAPPAQFQAAPVPYQAPPQAVAQPAPATAEQGADSGMSGAAKKFGSKLGNAA 240

Query: 241 IFGAGATLGSDLVHSIF 257
           IFGAGATLGSDLVHSIF
Sbjct: 241 IFGAGATLGSDLVHSIF 257

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  152 bits (383), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 91/130 (70%), Gaps = 4/130 (3%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MS++ INRSL+T+RTEL FL +S VI       I   LP   E  R  P   +   E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120
           A+YAFQAQQ GDL+ +VG+KIEVLEKPSPEWYKGRCNG+VGMFPSNYVKPAFSG +   E
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120

Query: 121 ----ASPPRY 126
                +PP Y
Sbjct: 121 RPNVPAPPEY 130

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 1/39 (2%)

Query: 220 GADSGMSGAA-KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           G  S  +GAA KKFG KLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 198 GTGSSHTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  150 bits (380), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 90/119 (75%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MS++ INRSL+T+RTEL FL +S VIT      I S LP   +  RG    +A   E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQGEFVE 60

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMK 119
           A+YAFQAQQ GDL+ +VG+K+EVLEKPSPEW+KG+CNG+VGMFPSNYVKPAFSG +  +
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGSTTTE 119

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (81%)

Query: 220 GADSGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           G  S  S A KKFG KLGNAA+FGAGAT+GSD+V+SIF
Sbjct: 196 GHSSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  147 bits (370), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MS++LINRSL TIRTEL FL +S VI+ +  +QI ++LP   +       +++  +EYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSG 114
           A+YAFQAQQ GDL+ K G+KI+VLEKPS EWYKG+CNG VGMFPSNYVKPAFSG
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSG 114

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (82%)

Query: 218 EQGADSGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           EQ A    S A KKFGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 191 EQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  143 bits (360), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 14/140 (10%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP-----NPNEALRGAPANNAGP 55
           MS++ INRSLATIRTEL FL +S VI+++  +QI S LP     + + A     +NN  P
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 56  V----EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA 111
                E+VEA+Y F+ QQ GDL  K G+KIEV+EKPSPEW+KGRCNG+ GMFPSNYVKPA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 112 FSG--GSLMKEAS---PPRY 126
           FSG  GS+ K A    PP+Y
Sbjct: 121 FSGSSGSVNKVARPNGPPQY 140

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 28/28 (100%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           KKFGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 210 KKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  143 bits (360), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 95/130 (73%), Gaps = 6/130 (4%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPA-NNAGP-VEY 58
           MSS  INRSL +++TEL FL DS VI+ +  +QI + LP+ ++  R + A NN+ P +EY
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLM 118
           VEA+Y F  QQ GDL  + G+KI+VLEK SPEWYKG+CNGKVG+FPSNYVKPAFSGGS  
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSGGSNE 120

Query: 119 KE----ASPP 124
           K      SPP
Sbjct: 121 KSRSHLTSPP 130

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAGATLGSDLV+SIF
Sbjct: 212 KSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  142 bits (357), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 8/133 (6%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEALRGAPANNAGPVE 57
           MS++LINRSL  IRTEL FL +S VI+ +   QI + LP   +PN + R + ++ A  +E
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGS-RESVSSQAPTLE 59

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSL 117
           YVEA+Y F+ QQ GDL  K G+KI+V+EKPSPEW+KG+CNG+VG+FPSNYV+PAFSG S 
Sbjct: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQ 119

Query: 118 MKEAS----PPRY 126
             +      PP+Y
Sbjct: 120 PSKTRLTPGPPQY 132

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 28/28 (100%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           KKFGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 208 KKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  139 bits (350), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 71/127 (55%), Positives = 89/127 (70%), Gaps = 6/127 (4%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEALRGAPANNAGPVE 57
           MS++LINRSL TIRTEL FL +S VI+    +QI  +LP   NP+ A R     ++  +E
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDT---SSASLE 57

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSL 117
           YVEALY F  QQ GDL  K G+K+++LEK SPEWYKG CNG+VG+FP+NYVKPAFSG + 
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNG 117

Query: 118 MKEASPP 124
                PP
Sbjct: 118 SSNLPPP 124

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAGA++GSD+V+SIF
Sbjct: 181 KSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  136 bits (343), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEA---LRGAPANNAG 54
           MS++LINRSL TIRTEL FL +S VI+    ++I S+LP   +P+ A   L      ++ 
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSG 114
            +EYVEA+Y F  QQ GDL  + G+KI+VLEK SPEWYKG CNGKVG+FPSNY KPAFSG
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 115 GS 116
            +
Sbjct: 121 ST 122

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/28 (85%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 193 KSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  136 bits (343), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 71/123 (57%), Positives = 91/123 (73%), Gaps = 8/123 (6%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEA----LRGAPANNA 53
           MS++LINRSL  +RTEL FL +S VI+ +   +I  +LP   +PN+      R +  ++A
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 54  GPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFS 113
             +EYVEALYAFQ QQ GDL+ + G+KI+VLEKPS EWYKG+C G+VGMFPSNYVKPAFS
Sbjct: 61  K-LEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFS 119

Query: 114 GGS 116
           G S
Sbjct: 120 GES 122

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (96%)

Query: 228 AAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           A KKFGS+LGNAAIFGAGAT+GSD+V+SIF
Sbjct: 192 AFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  133 bits (334), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (67%), Gaps = 6/127 (4%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEALRGAPANNAGPVE 57
           MS++LINRSL  IRTEL FL +S VI+    +QI  +LP   +P  A R   + +   +E
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTS---LE 57

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSL 117
           YVEALY F  QQ GDL  K G+KI++LEK SPEWYKG CNG+ G+FP+NYVKPAFSG + 
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNG 117

Query: 118 MKEASPP 124
                PP
Sbjct: 118 QSNLPPP 124

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAGA++GSD+V+SIF
Sbjct: 185 KSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  133 bits (334), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 91/136 (66%), Gaps = 16/136 (11%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAP-------ANNA 53
           MSS+LIN+SL+TI TEL FL+ S  I ++   +I   LP      R AP       +N++
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLP------RRAPEVPSRQQSNSS 54

Query: 54  GPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFS 113
              E+VEA+Y F  QQ GDL    G+KI V EKPSPEW+KG+CNGKVG+FPSNYV+PAFS
Sbjct: 55  KNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFS 114

Query: 114 GGSLMK---EASPPRY 126
           G +  K   +A+PP+Y
Sbjct: 115 GSNNEKSRSDAAPPQY 130

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAGATLGSDLV+SIF
Sbjct: 195 KNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  132 bits (333), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (66%), Gaps = 10/129 (7%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPAN---NAGP-- 55
           MS++LINRSL  IRTEL FL  S VI+    +QI  +LP      +  PAN   NA P  
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLP-----AKWDPANAPRNASPAS 55

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGG 115
           +EYVEALY F  QQ GDL  K G+K+++LEK SPEWYKG CNG+ G+FP+NYVKPAFSG 
Sbjct: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGS 115

Query: 116 SLMKEASPP 124
           +      PP
Sbjct: 116 NGPSNLPPP 124

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/28 (78%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAGA++GSD+V++IF
Sbjct: 188 KSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  132 bits (333), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 86/127 (67%), Gaps = 6/127 (4%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEALRGAPANNAGPVE 57
           MS++L+NRSL  IRTEL FL +S VI+    +QI  +LP   +P+ A RG+   N+  +E
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGS---NSASLE 75

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSL 117
           YVEA+Y F  QQ GDL  K G+K+++LEK SPEWYKG CNG+ G+FP+NYVKP FS    
Sbjct: 76  YVEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDG 135

Query: 118 MKEASPP 124
                PP
Sbjct: 136 QHRLPPP 142

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/35 (68%), Positives = 29/35 (82%)

Query: 223 SGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           S  +   K FGSKLGNAAIFGAGA++GSD+V+SIF
Sbjct: 201 SSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  131 bits (330), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 86/126 (68%), Gaps = 9/126 (7%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MS++ INRSLAT+RTEL FL +S VI+++  + +  +LP  N + +G         EY+E
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ-NASNKGG--------EYME 51

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120
           ALY F  QQ GDL    G+KIEVLEKPS EW+KGRCNG+VGMFP+NYVK A+SG      
Sbjct: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSV 111

Query: 121 ASPPRY 126
             PP+Y
Sbjct: 112 PPPPQY 117

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 28/28 (100%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           KKFGSKLGNAAIFGAGAT+GSDLV+SIF
Sbjct: 174 KKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  132 bits (333), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 75/109 (68%), Positives = 87/109 (79%), Gaps = 1/109 (0%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MSS+LINRSLA I+TEL FLV+S VI++ QS+QI S L NP E    A A+     EYVE
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKA-ASQQVLKEYVE 59

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           ALYAF  QQPGDL+FKVG+KIEVLEKPS +WYKG+ NG+VGMFPSNYVK
Sbjct: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%)

Query: 219 QGADSGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           QG  SG S   KKFGSKLGNAA+FGAGAT+GS+LVH IF
Sbjct: 215 QGQSSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  130 bits (327), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 68/120 (56%), Positives = 83/120 (69%), Gaps = 3/120 (2%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNP-NEALRGAPANNAGPVEYV 59
           MS+TL+NRSL  IR EL FL +S VI+    + I S LP   N+  R    NNA   EYV
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSP--NNADTEEYV 58

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMK 119
           EALY F+AQQ GDL  K G+KI+VLEK SP+WYKG+ N +VG+FP+NYVKPAF+   L K
Sbjct: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTK 118

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/28 (78%), Positives = 26/28 (92%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAG+ +GSD+V+SIF
Sbjct: 214 KSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  127 bits (320), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 84/121 (69%), Gaps = 1/121 (0%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MS++L+NRSL  IR EL FL +S VI+    E I S LP   +  + +P  NA   EYVE
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSP-QNADTEEYVE 59

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120
           ALY F+AQQ GDL  K G+KI+VLEK SP+WY+G+ N K+G+FP+NYVKPAF+  +  K 
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSASPKS 119

Query: 121 A 121
           A
Sbjct: 120 A 120

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (85%)

Query: 223 SGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           SG S A K FGSKLGNAAIFGAG+ +GSD+V+SIF
Sbjct: 207 SGASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  122 bits (307), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 80/113 (70%), Gaps = 1/113 (0%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60
           MS++LINRSL  IR EL FL +S VI+ +    I+SNLP   +      ANNA   EYVE
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDE-NSKSANNASTEEYVE 59

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFS 113
           ALY F+AQQ GDL  K G+KI++LEK S +WYKG+ N  +G+FP+NYVKPAF+
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFT 112

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLG+AAIFGAG+T+GSD+++SIF
Sbjct: 211 KSFGSKLGDAAIFGAGSTIGSDIINSIF 238

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  120 bits (301), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 87/140 (62%), Gaps = 16/140 (11%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEA-LRGAPANNAGPVEYV 59
           MS++LINRSL  IR EL FL +S VI+      I S LP   +  LR  P  NA   E+V
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVP--NASVEEFV 58

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFS------ 113
           EALY F+ QQ GDL  K G+KI++LEK SP+WY+G+ N +VG+FP+NYVKPAF+      
Sbjct: 59  EALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARSASPE 118

Query: 114 --GGSLMKEAS-----PPRY 126
             G SL  + S     PP Y
Sbjct: 119 NEGASLSSKVSRPSAPPPSY 138

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (88%)

Query: 223 SGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           SG S A K FGSKLGNAAIFGAG+T+GSD+VHSIF
Sbjct: 215 SGASSAFKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  118 bits (296), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 84/142 (59%), Gaps = 34/142 (23%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NP-------NEAL----- 45
           MSS LINR++  I+TEL FL +S +IT+QQ ++I   LP   +P       NE L     
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 46  ----------------RGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP 89
                              PAN    +EYVEALYAF+ QQ GDL    G+K+++LEKPS 
Sbjct: 61  NAAANSSSASVDHASATPPPANQ---LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA 117

Query: 90  EWYKGRCNGKVGMFPSNYVKPA 111
           EWYKG CNG++GMFP+NYVKP 
Sbjct: 118 EWYKGTCNGQIGMFPANYVKPV 139

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 28/28 (100%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K+FGSKLGNAAIFGAGATLGSDLV+SIF
Sbjct: 207 KRFGSKLGNAAIFGAGATLGSDLVNSIF 234

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  114 bits (284), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 81/132 (61%), Gaps = 19/132 (14%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPV---- 56
           MS + INRSL  IR EL FL +S VI+    ++I   LP          +N A PV    
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP----------SNGASPVPPPM 50

Query: 57  --EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSG 114
             EYVEALY FQ QQ GDL  + G+KI+VLEKPS EWY+G  NG+ GMFPSNYV+PA + 
Sbjct: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAP 110

Query: 115 GSLMKEASPPRY 126
            + +   +PP Y
Sbjct: 111 SANL---APPAY 119

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 27/28 (96%)

Query: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           K FGSKLGNAAIFGAGATLGSDLV+SIF
Sbjct: 175 KSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  108 bits (269), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 7/107 (6%)

Query: 6   INRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAP--ANNAGPV-EYVEAL 62
           +  S+ATI++EL +L + G +     + IES LP     +R  P  A+  G   E VEAL
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPR----VRPQPPVADTMGQNNEIVEAL 59

Query: 63  YAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           YAFQ QQ GDL  K G+KIE+LEK SPEWYKG+CNG+VG+FPSNYVK
Sbjct: 60  YAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 226 SGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
           S A KKFGSKLGNAAIFGAGAT+GSDLV+SIF
Sbjct: 189 SAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  105 bits (263), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 48/68 (70%), Positives = 54/68 (79%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGS 116
           E+VEA+Y F  QQ GDL    G+KIEVLEKPSPEW++GRCNG+VGMFPSNYVKPAFSGG 
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63

Query: 117 LMKEASPP 124
               A PP
Sbjct: 64  DRPAAPPP 71

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 27/27 (100%)

Query: 231 KFGSKLGNAAIFGAGATLGSDLVHSIF 257
           KFGSKLGNAAIFGAGATLGSDL++SIF
Sbjct: 132 KFGSKLGNAAIFGAGATLGSDLINSIF 158

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  103 bits (256), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 11/132 (8%)

Query: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPV---- 56
           MS   +NRS+  IRTEL +L++S VI+R   ++    LP   +   G P   AG      
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLP---DNWDGKPIGGAGEKHPPH 57

Query: 57  --EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA-FS 113
             EYVEA++ ++ Q+  DL+ +VG+K+E+LEK S +WY+G+  GKVG+FPSNYVK   FS
Sbjct: 58  EPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFS 117

Query: 114 G-GSLMKEASPP 124
           G    M +  PP
Sbjct: 118 GVDDAMFQDIPP 129

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 226 SGAAKKFGSKLGNAAIFGAGATLGSDLVHSI 256
           SGA K    + GN+ +FGAG  +GSD+V+ I
Sbjct: 183 SGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 81.3 bits (199), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSG 114
           EYVE LY F+ Q   DL  K G+K+EV+EK S +WYKG+CNGK GMFP+NYVKP   G
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPVGGG 72

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/42 (61%), Positives = 27/42 (64%)

Query: 216 TAEQGADSGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257
             EQ        A  K GSKLGNAAIFG GATLG+DLV SIF
Sbjct: 109 VVEQDKPKHRHHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 82.8 bits (203), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 67/113 (59%), Gaps = 10/113 (8%)

Query: 6   INRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEA---------LRGAPANNAGPV 56
           I  +   IR  L  L+D+  I+    ++I+  L +   +          +GA +   GP 
Sbjct: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGP- 68

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +YVEA+YA+  +Q GDL+   G+ IEV+ K SP+WY+GR NGKVG+FP+NYVK
Sbjct: 69  QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (86%)

Query: 235 KLGNAAIFGAGATLGSDLVHSIF 257
           KLGNAA+FGAG+  G+D+V+ IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           P     ALY F  +QPGDL FK G+ I +L+K     +W+ GR NGK G+FP+NYV+
Sbjct: 417 PTPTAIALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY F  +QPGDL FK G+ I +L+K     +W+ GR NGK G+FP+NYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%)

Query: 38  LPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCN 97
           +PN N   +         V+ V A+Y   A +PG+L FK G+ I+V+E+   +W++G   
Sbjct: 224 VPNSNNPNQQIDEQKPAVVKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLR 283

Query: 98  GKVGMFPSNYVKP 110
           G VG+FP NYV P
Sbjct: 284 GTVGIFPLNYVNP 296

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 31  SEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP- 89
           S ++     + N +    P +   P +   ALY F  +Q GDL FK G+ I +L+K    
Sbjct: 375 SHKMSKTEIDDNHSRVKLPTSLQSPTQTAVALYNFAGEQSGDLAFKKGDVITILKKSDSQ 434

Query: 90  -EWYKGRCNGKVGMFPSNYVK 109
            +W+ GR NGK G+FP+NYV+
Sbjct: 435 NDWWTGRVNGKEGIFPANYVR 455

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 4/81 (4%)

Query: 30  QSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP 89
           Q EQ    + N  EA   APA     +  V A+Y   +++P +L F+ G+ I VLE+   
Sbjct: 203 QPEQPVQTISNQGEAKSSAPAV----IRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYR 258

Query: 90  EWYKGRCNGKVGMFPSNYVKP 110
           +W++G   GKVG+FP NYV P
Sbjct: 259 DWWRGTLCGKVGIFPLNYVTP 279

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKP--SPEWYKGRCNGKVGMFPSNYVK 109
           VE V ALY +QAQ PGDL F     IE++++   + EW+ GR +G+VG+FP NYV+
Sbjct: 400 VETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE--WYKGRCNGKVGMFPSNYVK 109
           VE V ALY +QAQ  GDL F VG  IEV+E+ +    W+ GR NG+ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           VE V ALY +QAQ  GDL F  G  IE++E+ S   EW+ G+ NG+ G+FP NYV+
Sbjct: 400 VETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 10/93 (10%)

Query: 25  VITRQQSEQIESNLPNPNEALRGAPAN------NAGPVEYVEALYAFQAQQPGDLDFKVG 78
           V  R    +I SN  + N   R + ++      +AGP     ALY F  ++ GDL FK G
Sbjct: 362 VSNRFSRARISSNNNSANRERRASRSSYNDGVSHAGPK--AVALYTFSGEESGDLSFKKG 419

Query: 79  EKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           + I +L+K     +W+ GR NGK G+FP+NYV+
Sbjct: 420 DVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY F  +Q GDL F+ G+KI +L++     +W+ GR NGK G+FP+NYV+
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 44/64 (68%), Gaps = 3/64 (4%)

Query: 48  APANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPS 105
           +PA N+G  + V ALY F+ ++ GDL F+ G+ I +++K     +W+ GR NGK G+FP+
Sbjct: 359 SPARNSGAPKAV-ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPA 417

Query: 106 NYVK 109
           NYV+
Sbjct: 418 NYVE 421

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           V ALY +QAQ PGDL F  G  IEV+++     EW+ GR NG+ G+FP NYV+
Sbjct: 417 VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQ 469

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%), Gaps = 13/107 (12%)

Query: 14  RTELAFLVDSGVITRQQSEQIESNL--PNPNE-------ALRGAPANNAGPVEYVEALYA 64
           RT ++    +G  +R +SE+ +  L   NPN          R +PA++  P     ALY 
Sbjct: 322 RTGISSSSGNGAPSRPRSEKPDFGLGKTNPNNKGISSPPVSRRSPASSGAPKAV--ALYT 379

Query: 65  FQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           F+ +Q GDL F+ G+ + +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 380 FKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVE 426

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY F  +Q GDL FK G+ I +L+K     +W+ GR NGK G+FP+NYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           VE V ALY +QAQ  GDL F  G  IE++++ +   EW+ GR NG+ G+FP NYV+
Sbjct: 458 VETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 47  GAPANNAGP-VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMF 103
           G PA +A P  E   +LY +QAQ  GDL F  G  IE++E+ +   EW+ GR NG+ G+F
Sbjct: 402 GPPAYSAAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVF 461

Query: 104 PSNYVK 109
           P NYV+
Sbjct: 462 PGNYVQ 467

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           ALY F+ +Q GDL F+ G+ I +L+K +   +W+ GR NG+ G+FP+NYV+
Sbjct: 400 ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 47  GAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYKGRCNGKVGMFPS 105
            +PA  A P E   ALY F AQ  GDL F V   IE+L++     W+ GR NG+ G+FP+
Sbjct: 323 ASPATTAAP-ETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPA 381

Query: 106 NYV 108
           NYV
Sbjct: 382 NYV 384

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 7/94 (7%)

Query: 22  DSGVIT-----RQQSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFK 76
           D G++       Q S++     P   +   G+ + ++G +    ALY F+ +Q GDL F+
Sbjct: 320 DQGIVNTSGKPEQNSQRRAPARPTSAKPDFGSHSTSSGAIPKAVALYTFKGEQKGDLPFR 379

Query: 77  VGEKIEVLEKP--SPEWYKGRCNGKVGMFPSNYV 108
            G+ I +L++     +W+ GR NG+ G+FP+NYV
Sbjct: 380 KGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           ALY F  ++ GDL F+ G+ I +++K     +W+ GRCNG+ G+FP+NYV+
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVE 466

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 4/57 (7%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP---EWYKGRCNGKVGMFPSNYVK 109
           VE V ALY +QAQ  GDL F  G  IEV+++ +P   EW+ GR NG+ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 464

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP---EWYKGRCNGKVGMFPSNYVK 109
           E V ALY +QAQ  GDL F  G  IE++E+ +P   EW+ GR NG+ G+FP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVER-TPDVNEWWTGRYNGQQGVFPGNYVQ 459

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKP--AFS 113
           +  V A+Y   +Q+  +L F+ G+ I VLE+   +W++G  +GK+G+FP NYV P    S
Sbjct: 231 IRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELS 290

Query: 114 GGSLMKE 120
              ++KE
Sbjct: 291 NEDIIKE 297

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 5/71 (7%)

Query: 41  PNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNG 98
           P   L+ AP++ A       ALY+F  ++ GDL F+ G+ I +L+K     +W+ GR NG
Sbjct: 372 PKSDLQAAPSSTA---PKAVALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNG 428

Query: 99  KVGMFPSNYVK 109
           + G+FP+NYV+
Sbjct: 429 REGIFPANYVE 439

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 10/77 (12%)

Query: 35  ESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWY 92
            S  P+ + ++ GAP           ALY+F  ++ GDL F+ G+ I VL+K     +W+
Sbjct: 394 RSTKPSSSPSISGAPK--------AVALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWW 445

Query: 93  KGRCNGKVGMFPSNYVK 109
            GR NG+ G+FP+NYV+
Sbjct: 446 TGRVNGREGIFPANYVE 462

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA--FS 113
           V  V A+Y   + +P +L FK G+ I VLE+   +W+KG   G +G+FP NYV P    S
Sbjct: 237 VRKVRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISDLS 296

Query: 114 GGSLMKEAS 122
              L +E +
Sbjct: 297 NAELEQELT 305

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           +E V ALY +QAQ  GDL F  G  IE++++ +   EW+ GR NG+ G+FP NYV+
Sbjct: 383 METVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           E V ALY +QAQ  GDL F  G  IE++++ +   EW+ G+ NG+ G+FP NYVK
Sbjct: 435 ETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVK 489

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 38/60 (63%)

Query: 52  NAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA 111
           +A P + V+ALY   + +P +L FK G+ I VLE+   +W++G   G +G+FP NYV P 
Sbjct: 225 SAAPPKRVKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           ALY F  +Q GDL F+ G+ I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKP--SPEWYKGRCNGKVGMFPSNYVK 109
           E V ALY +QAQ  GDL F  G  IE++++   + EW+ GR NG+ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP---EWYKGRCNGKVGMFPSNYVK 109
           E V ALY +QAQ  GDL F  G  IE++++ +P   EW+ GR NG+ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY+F  ++ GDL F+ G+ I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYV 108
           P+ +AG V+ V A+Y F + +  +L FK G+ I VLE+   +W++G   G++G+FP NYV
Sbjct: 207 PSTSAG-VKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYV 265

Query: 109 KPAF 112
            P  
Sbjct: 266 TPIM 269

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 47  GAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFP 104
           G+P+++  P     ALY+F  ++ GDL F+ G+ I +L+K     +W+ GR NG+ G+FP
Sbjct: 369 GSPSSSNAPKAV--ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFP 426

Query: 105 SNYVK 109
           +NYV+
Sbjct: 427 ANYVE 431

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP---EWYKGRCNGKVGMFPSNYVK 109
           E V ALY +QAQ  GDL F  G  IE++++ +P   EW+ GR NG+ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKP 110
           V  V A+Y     +P +L F+ G+ I VLE+   +W+KG   G++G+FP NYV P
Sbjct: 223 VRRVRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           ALY F+ +Q GDL F+ G+ I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY+F  ++ GDL F+ G+ I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY+F  ++ GDL F+ G+ I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 457

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKP 110
           +  V ALY   A +  +L F+ G+ I VLE+   +W++G  +GK+G+FP NYV P
Sbjct: 214 IRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKP 110
           V  V ALY     +P +L F+ G+ I VLE+   +W+KG   G +G+FP NYV P
Sbjct: 219 VRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNY--VKPAFS 113
           V  V+A++   A +P +L FK G+ I V+E+   +W++G   GKVG+FP NY  V P  +
Sbjct: 212 VRRVKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYVGVCPEPT 271

Query: 114 GGSLMKEAS 122
              + KEA+
Sbjct: 272 AEEVAKEAA 280

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 29  QQSEQ-----IESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEV 83
           QQ++Q     + S +P    A   APA     ++ V A+Y   A +  +L FK G+ I V
Sbjct: 200 QQNQQTSYGVLASFVPTSEPAPTPAPAQTV--IKRVRAMYDLTATESDELSFKKGDVITV 257

Query: 84  LEKPSPEWYKGRCNGKVGMFPSNYVKP 110
           +E+   +W++G   G+VG+FP NYV P
Sbjct: 258 VEQVYRDWWRGNIRGRVGIFPLNYVTP 284

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE---WYKGRCNGKVGMFPSNYVK 109
           E V ALY +QAQ  GDL F  G  IEV+E+ +P+   W+ GR NG  G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKP 110
           V  V ALY     +P +L F+  + I VLE+   +W+KG   GK+G+FP NYV P
Sbjct: 222 VRRVRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 45/74 (60%), Gaps = 10/74 (13%)

Query: 38  LPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGR 95
           +P  ++A+ G+P           ALY+F  ++ GDL F+ G+ I +++K     +W+ GR
Sbjct: 444 IPTRDDAVPGSPK--------AVALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGR 495

Query: 96  CNGKVGMFPSNYVK 109
            +G+ G+FP+NYV+
Sbjct: 496 VSGREGIFPANYVE 509

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE--WYKGRCNGKVGMFPSNYVK 109
           E V ALY +QAQ  GDL F  G  IEV+E+ +    W+ GR NG  G+FP NYV+
Sbjct: 378 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA 111
           V  V AL+    ++  +L F+ G+ I V+E+   +W++GR  G+VG+FP NYV P 
Sbjct: 214 VRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPV 269

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY+F  ++ GDL F+ G+ I +++K     +W+ G+ NG+ G+FP+NYV+
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVE 435

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 49  PANNAGP--VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSN 106
           P+ N GP  V  V AL+    +   +L F+ G+ I V+E+   +W++G   GK+G+FP N
Sbjct: 217 PSTNPGPPVVRKVRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLN 276

Query: 107 YVKPA 111
           YV P 
Sbjct: 277 YVTPV 281

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA 111
           V+ V A+Y+  A +  +L F  G+ I V+E+   +W++G   GKVG+FP NYV P 
Sbjct: 228 VKKVRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY+F  ++  DL F+ G+ I +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           AL++F  ++ GDL F+ G+ + +L+K     +W+ GR NG+ G+FP+NYV+
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY F  ++ GDL F+ G+ I +L+K     +W+ GR +G+ G+FP+NYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           ALY+F  ++ GDL FK G+ I +L+K     +W+ GR N   G+FP+NYV+
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVE 447

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           E V ALY F  +Q GDL FK G+ I V++K     +W+ G+   K G+FP+NYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKP 110
           V+ V ALY     +  +L F+ G+ I VLE+   +W+KG   GK+G+FP NYV P
Sbjct: 214 VKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 268

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 39  PNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEK-PSPEWYKGRCN 97
           P+P  A    P+    P E   +LYAF AQ   DL F     IE+L++  S  W+ GR N
Sbjct: 348 PSPYTAY-TTPSTAPAP-ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYN 405

Query: 98  GKVGMFPSNYVK 109
           G+ G+FP NYV+
Sbjct: 406 GQEGLFPGNYVR 417

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           AL+ F+ +Q GDL F  G+ + +L+K     +W+ GR N + G+FP+NYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPS--PEWYKGRCNGKVGMFPSNYVK 109
           ALY F  ++ GDL F+ G+ I +L+K     +W+ GR  G+ G+FP+NYV+
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA 111
           +  V A+Y F + +  +L FK G+ I V+E+   +W++G   G VG+FP NYV P 
Sbjct: 224 IRKVRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPV 279

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           EY  +LY +QAQ  GDL F  G  I+++++ +   +W+ G  NG+ G+FP NYV+
Sbjct: 400 EYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY F  ++ GDL FK G+ I ++++     +W+ G  NGK G+FP+NYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 42/91 (46%)

Query: 21  VDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEK 80
           +DS   +   S Q +S+ P  N             V  V ALY        +L FK G+ 
Sbjct: 195 MDSSQQSANTSAQNQSSQPQSNYYYSTEQQQQPTIVRKVRALYDLAGSGSDELSFKKGDV 254

Query: 81  IEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA 111
           I VLE+   +W+KG+   + G+FP NYV P 
Sbjct: 255 IMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           AL+ F   +PGDL FK G+ I ++++     +W+ GR N + G+FP+NYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKP 110
           +  V ALY   + +  +L F  G+ I VLE+   +W++G   G  G+FP NYV P
Sbjct: 217 IRKVRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAF 112
           ++ V A+Y  +   P +L F+  + I V+E+   +W+ G    +VG+FP NYV P  
Sbjct: 216 IKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTPII 272

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNY 107
           P  +  P+  +EA+YA++AQ   ++   VG+ I V+       W  G C+G  G+FP++Y
Sbjct: 572 PRRSTLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSY 631

Query: 108 VK 109
            K
Sbjct: 632 CK 633

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYV 108
           V ALY F  QQ GDL FK  + I V +K     +W+ G  +G  G+FP+NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 48  APANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYKGRCNGKVGMFPSN 106
            P  +AG VE   ALY + AQ  GDL F  G  I+V+++     W+ G  NG  G+FP N
Sbjct: 363 TPPTSAG-VETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGN 421

Query: 107 YVK 109
           YV+
Sbjct: 422 YVE 424

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNYVK 109
           PV  +EA+YA++AQ   ++   VG++I V+       W  G C+G  G+FP++Y +
Sbjct: 578 PVRTMEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYKGRCNGKVGMFPSNY 107
           P   A P++ V A+Y + AQ   ++  + G+ I+VL   +   W  G  NG  G+FPSNY
Sbjct: 565 PRKGAAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNY 624

Query: 108 V 108
            
Sbjct: 625 C 625

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNY 107
           P   A PV  +EA YA++A+   ++   VG+ I V+       W  G C+G  G+FP++Y
Sbjct: 573 PRRTALPVRTLEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSY 632

Query: 108 VK 109
            K
Sbjct: 633 CK 634

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYK--GRCNGKVGMFPSNYVKPAFSGG 115
           + LYA+  Q   ++    G+KI ++ + S   W K      G+ G+ P+ YV+ + + G
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVRISNADG 557

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 46  RGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYKGRCNGKVGMFP 104
           R  P    G    VEA+Y++QAQ   +     G+ I VL+      W  G  NG+ G+FP
Sbjct: 557 RAPPPRKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFP 616

Query: 105 SNYVK 109
           ++Y K
Sbjct: 617 TSYCK 621

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 5/99 (5%)

Query: 32  EQIESNLPNPNEALRGAPANNAGPVE--YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP 89
           ++ +SN    +EA+    +++  P+E      LY +Q Q   ++    G+ I +L   + 
Sbjct: 464 DRAQSNASGLSEAVSSDYSSSVAPMESNTNTVLYLYQKQDDDEVSISPGDPITLLVADTG 523

Query: 90  E-WYKGRCN--GKVGMFPSNYVKPAFSGGSLMKEASPPR 125
             W K + +  G+ G+ P+ YV       S    A PPR
Sbjct: 524 SGWTKIKNDRTGQTGLVPTTYVDIKEKARSSAPRAPPPR 562

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 11/79 (13%)

Query: 42  NEALRGAPANNAG-------PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG 94
           N +LRG   N  G       P+  ++ALY + AQ PG+L F  GE + V+ +   EW++ 
Sbjct: 46  NTSLRGVKNNGGGVSPSNEVPI-ILKALYTYHAQSPGELSFTKGELVHVIGEDG-EWFEV 103

Query: 95  RC--NGKVGMFPSNYVKPA 111
               +G+ GM P +Y +P 
Sbjct: 104 SSPDSGRKGMVPKSYFEPV 122

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 26  ITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE 85
           ++R +    +S L +P +A++   A +     Y   LY F+A++  +L    GE + +  
Sbjct: 122 VSRSRVVSTQSILVSPQQAMQSVKAGSL----YAIVLYDFKAEKSDELSAFAGENLFICA 177

Query: 86  KPSPEWYKGRCNGKVG 101
             + EW+  +  G++G
Sbjct: 178 HHNYEWFIAKPIGRLG 193

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 58  YVEALYAFQAQQPGD-LDFKVGEKIEVLEKPSPEWYKGRC---NGKVGMFPSNYVK 109
           Y +ALY+F      D L+F++G+ + + EK + +WY G     NG+ G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 5/58 (8%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC-----NGKVGMFPSNYVKPA 111
           V A Y +++   GDL+F+ G++IEV+     +WY G       N + G+FP NYV+ A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539
          Length = 554

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 54  GPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNY---- 107
            P + ++ALY + +Q P ++ F  GE   V+ + + EWY+     NGK GM P +Y    
Sbjct: 69  SPEKVIKALYNYHSQTPNEVSFVEGEFFYVINE-TEEWYEASNPSNGKKGMVPKSYFEEF 127

Query: 108 --VKPAFSGGSL 117
              +PA  GG+L
Sbjct: 128 DRTRPASIGGTL 139

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNY 107
           P  +  PV  +EA+YA++AQ   ++    G+ I V+       W  G C+G  G+FP++Y
Sbjct: 572 PRRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSY 631

Query: 108 VK 109
            K
Sbjct: 632 CK 633

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 53  AGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNY 107
           + P + ++A+Y +QAQ PG+L F  G+   VL +   EWY      +GK GM P +Y
Sbjct: 65  SSPEKVIKAMYNYQAQSPGELSFVKGDFFHVLTEDR-EWYDASNPSDGKRGMVPKSY 120

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYKGRCNGKVGMFPSNYV 108
           A Y +Q+Q P +L  +VG+KI+VL++     W  G  NG  G+FP+ Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 46  RGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG---RCNGKV-- 100
           + +P  N  PV+ V A++ +  +   +L+ + G+ I V+ K    W+ G     NGKV  
Sbjct: 38  QSSPICNVSPVDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHR 97

Query: 101 GMFPSNYVKPAFS 113
           G FP NY + + S
Sbjct: 98  GWFPQNYCRSSHS 110

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           EALY +QA Q    ++ F+ GE + V +     W   + NG+ G+ PSNYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 47  GAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFP 104
           G   + + P + ++ALY +QAQ  G+L F  G+   V ++ + +WY+     +GK GM P
Sbjct: 56  GKSKDISSPEKVIKALYNYQAQSAGELSFNKGDFFHVQQEEN-DWYEASNPADGKRGMVP 114

Query: 105 SNY 107
            NY
Sbjct: 115 KNY 117

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 8/58 (13%)

Query: 58  YVEALYAFQAQQPGDLD---FKVGEKIEVLEKPSPEWYKGRC---NGKVGMFPSNYVK 109
           Y  A+Y+F   +P D D   F++G+ + + EK + +WY G     NGK G+ P NYV+
Sbjct: 625 YARAIYSFT--EPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 37.0 bits (84), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 73  LDFKVGEKIEVLEKP--SPEWYKGRCNGKVGMFPSNYVK 109
           L F  G  IE++++   + EW+ GR NG+ G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSN 106
           P      V  +EALY +QAQ   +L    G  ++VL KP     W  G  +G  G+FP++
Sbjct: 564 PRKCVSSVRTIEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTYGELDGAKGLFPTS 622

Query: 107 YVK 109
           Y K
Sbjct: 623 YCK 625

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALY++QA      ++ F+ GE ++V +     W   R NG+VG+ PSNYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 59  VEALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           V+ALY++QA      ++ F  GE ++V +     W   R NG+ G+ PSNYV+
Sbjct: 311 VKALYSYQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVE 363

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 50  ANNAGPVEYVEALYAFQAQQPG---DLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFP 104
            N   P  Y  AL+ ++  +P    DL+F+  E I+V++K    W+ G      K G FP
Sbjct: 391 CNGTIPTIYATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFP 450

Query: 105 SNYVK 109
           +NYV+
Sbjct: 451 ANYVE 455

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 34  IESNLPNPNEALRGAPANNAG-PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-W 91
           IE N    + A R  P   +G     V+AL+ ++AQ   ++  + G+ I VL+      W
Sbjct: 545 IEINEKPRSSAPRAPPPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGW 604

Query: 92  YKGRCNGKVGMFPSNYVK 109
             G  NG+ G+FP+NY +
Sbjct: 605 TYGELNGQKGLFPTNYCQ 622

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRC--NGKVGMFPSNYVKPAFSGGS 116
           +A+Y F A  P +L  K G+ I +L+ + S +WY       GK G+ P+ +V+   SG S
Sbjct: 416 KAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVETRGSGSS 475

Query: 117 LMKEASPPR 125
              + SP R
Sbjct: 476 RPSDESPSR 484

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNGK-----VGMFPSNYVKPA 111
           +ALY + AQ   +L  K G+ + +LEK S  +W+  K R  G      VG+ P  Y++ A
Sbjct: 9   QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

Query: 112 FSGGSLM 118
              GS++
Sbjct: 69  PVIGSVV 75

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNYVK 109
           V+ALY ++AQ   ++   VG+ I V++      W  G  NG  G+FPS+Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 13/98 (13%)

Query: 19  FLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPG-DLDFKV 77
           +L++  +   Q S  I+++  N  E +      +   +E+  ALY F  + P  ++  K 
Sbjct: 279 YLLNKFIAKIQTSGAIQASRENDGECI------DPSKLEFARALYDFVPENPEMEVALKK 332

Query: 78  GEKIEVLEKPSP-----EWYKGRC-NGKVGMFPSNYVK 109
           G+ + +L K  P     +W+K R  NG +G  P NY++
Sbjct: 333 GDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYIE 370

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 53  AGPVEY-VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           +GPV + V+  +A+  ++  DL F  G+ IEV  + + +WY G+   N K G FPSNYV
Sbjct: 4   SGPVTFKVKTNFAWSGEKKDDLGFLEGDFIEVT-RVTGDWYFGKLIRNKKQGYFPSNYV 61

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG--RCNGKVGMFPSNYVK 109
           A Y ++A +  +L FK G++I  +E    +W+ G  +  G+ G+FPSNYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALY++QA +    ++ F+ GE + V +     W   R NG+ G+ PSNYV+
Sbjct: 273 KALYSYQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query: 44  ALRGAPANNAGPV-----EYVEALYAFQAQQPG-DLDFKVGEKIEVLEKPSP-----EWY 92
            +R +  N + P+     E+  ALY F  + P  ++  K G+ + +L K  P     +W+
Sbjct: 291 TIRASQGNGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWW 350

Query: 93  KGRC-NGKVGMFPSNYVK 109
           K R  NG +G  P NY++
Sbjct: 351 KVRTKNGNIGYIPYNYIE 368

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 53  AGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNYVK 109
              +  VEA+Y ++A    +L    GE I+V+       W  G  NG  G+FPS+Y K
Sbjct: 580 TASIRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 56  VEYVEALYAF-QAQQPGD-LDFKVGEKIEVLEKPSPEWY--KGRCNGKVGMFPSNYVKPA 111
           +  V ALY + QAQ P + L F   E+ +V +   P+W   + +  G  G  P NYV+P 
Sbjct: 71  INSVRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYVEPC 130

Query: 112 FSG 114
             G
Sbjct: 131 GQG 133

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNGK-----VGMFPSNYVKPA 111
           +ALY ++ Q   +L  +  E + +LEK    EW+  K R  G      VG+ PSNYV+ A
Sbjct: 9   KALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNYVEQA 68

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
            ALYA++A +    ++ F+ GE + V +     W   R NG+ G+ PSNYV+
Sbjct: 273 RALYAYEADESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIPSNYVE 324

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 59  VEALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           V+ALY+++A      +L F+ G+ ++V +     W   + NG+ G+ PSNYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 56  VEYVEALYAFQAQQ-PGDLDFKVGEKIEVLEKPSPEWYKGRC--------NGKVGMFPSN 106
           +EY +A+Y     + PG  +F  G+ I + E  + +WYKG          N +VG+ P N
Sbjct: 595 IEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYN 654

Query: 107 YVKPAFSGG 115
           +++    G 
Sbjct: 655 FIQLLHQGS 663

>NDAI0C05470 Chr3 complement(1270339..1272090) [1752 bp, 583 aa]
           {ON} Anc_8.539
          Length = 583

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 50  ANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNY 107
           +N + P + ++A+Y + +Q P +L F  GE   V+ + + EWY+      GK GM P +Y
Sbjct: 75  SNVSSPDKAIKAIYNYHSQTPKELSFVKGEFFYVINE-NDEWYEASNPSTGKQGMVPKSY 133

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 13/98 (13%)

Query: 19  FLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPG-DLDFKV 77
           +L++  +   Q S  I+++  N +E +      +   +E+  ALY F  + P  ++  K 
Sbjct: 283 YLLNRFIAKVQNSGAIQASQGNGDEPI------DPSKLEFARALYDFIPENPQMEVALKK 336

Query: 78  GEKIEVLEKPSP-----EWYKGRC-NGKVGMFPSNYVK 109
           G+ + +L K  P     +W+K R  NG +G  P NY++
Sbjct: 337 GDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYNYIE 374

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 45  LRGAPANNAGPVEYVEALYAFQAQQPG-DLDFKVGEKIEVLEKPSP-----EWYKGRCN- 97
           L+G   NN   +E+  A+Y F  + P  +   K G+ + ++ K  P     +W+K R   
Sbjct: 306 LQGIDLNN---LEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKK 362

Query: 98  GKVGMFPSNYVK 109
           G+VG  PSNY++
Sbjct: 363 GEVGYIPSNYIE 374

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  VEYVEALYAFQAQQPG-DLDFKVGEKIEVLEKPSP-----EWYKGRC-NGKVGMFPSNYV 108
           +E+  ALY F  + P  ++    G+ + +L K  P     +W+K R  NGK+G  P NY+
Sbjct: 325 LEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYI 384

Query: 109 K 109
           +
Sbjct: 385 E 385

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 9/73 (12%)

Query: 41  PNEALRGAPANNAGPVEYVEALYAF-QAQQPGD-LDFKVGEKIEVLEKPSPEWY--KGRC 96
           PN  +  AP      + + +ALY + Q Q P + L F  G++ +V +   P+W     + 
Sbjct: 61  PNNYIEQAPV-----ISHAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKT 115

Query: 97  NGKVGMFPSNYVK 109
           +G++G  P NYV+
Sbjct: 116 SGEIGFVPGNYVE 128

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNGK-----VGMFPSNYVKPA 111
           +A+YA+Q Q P +L     + + +L+K    +W+  K R  G      VG+ P+NY++ A
Sbjct: 9   KAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNYIEQA 68

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSN 106
           PA + GP    E  Y + A +  +L F  G+KI  +E    +W+ G     G+ G+FPSN
Sbjct: 507 PAQSGGPSAVAE--YDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSN 564

Query: 107 YV 108
           YV
Sbjct: 565 YV 566

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGK-----VGMFPSNYVK 109
           P E V A+ A++ Q   DL    G+KI VL      WY GR   K      G+FPS++VK
Sbjct: 8   PFEVV-AVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 5/92 (5%)

Query: 20  LVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGE 79
           L + G   +Q+SE + S LP+  E     P+  AG    + A Y ++A +  +L F   +
Sbjct: 485 LPNRGNTEQQESEPVPS-LPS-RENATEEPSKPAGGATAI-AQYDYEAAEDNELTFNEND 541

Query: 80  KIEVLEKPSPEWYKG--RCNGKVGMFPSNYVK 109
           KI  +E    +W+ G    +G+ G+FPSNYV+
Sbjct: 542 KIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 60  EALYAFQAQQPGD---LDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           + LY++QA   GD   + F  GE ++V +     W   R NG+ G+ PSNYV+
Sbjct: 279 KTLYSYQAD-AGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCN--GKVGMFPSNY 107
           ++ALY + AQ PG+L F  GE  +V      EWY+      G+ GM P +Y
Sbjct: 67  LKALYTYHAQSPGELSFNKGELFQV-NGEDGEWYEVTSTEGGRKGMVPKSY 116

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 24  GVITRQQSEQIESNLPNPNEALRGAPANNAGPVE----YVEALYAFQAQQPGDLDFKVGE 79
           G++ +   EQ+  +      ++  +P     PV+    Y   LY F+A++  +L    GE
Sbjct: 110 GMVPKSYFEQVSKSRVVSTHSILTSPQQVQMPVKTGSLYAIVLYDFKAEKSDELSAFAGE 169

Query: 80  KIEVLEKPSPEWYKGRCNGKV---GMFPSNYV 108
            + +    + EW+  +  G++   G+ P  +V
Sbjct: 170 NLFICAHHNFEWFIAKPIGRLGGPGLVPVGFV 201

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 9/75 (12%)

Query: 41  PNEALRGAPANNAGPVEYVEALYAF-QAQ-QPGDLDFKVGEKIEVLEKPSPEWY--KGRC 96
           P+  +  APA     +  ++ALY + +AQ Q  +L F   +  +V +   P+W   K R 
Sbjct: 61  PSNYIEEAPA-----ISQMKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRT 115

Query: 97  NGKVGMFPSNYVKPA 111
           + +VG  P NYV+P 
Sbjct: 116 SNEVGFIPGNYVEPV 130

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 10/64 (15%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNGK-----VGMFPSNYVK-- 109
           +A+Y ++ Q P +L+    + + +LEK    EW+  K R  G      VG+ PSNY++  
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIEEA 68

Query: 110 PAFS 113
           PA S
Sbjct: 69  PAIS 72

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 41  PNEALRGAPANNAGPVEYVEALYAF-QAQQPGD-LDFKVGEKIEVLEKPSPEWY--KGRC 96
           P+  +  AP      +  + ALY F QAQ P + L FK  +  +V +   P+W   +   
Sbjct: 61  PSNYIEAAPV-----ISTMRALYDFDQAQNPQEELVFKENDMFDVYDDKDPDWILVRSHS 115

Query: 97  NGKVGMFPSNYVKPAFSGGSLM 118
           + + G  P NYV+PA  GG+ M
Sbjct: 116 SNEYGFVPGNYVEPA--GGAGM 135

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVL-EKPSPEWYKGRC--NGKVGMFPSNYVK 109
           ALY F+A+ P +L  + G+ + V+ +K S +W+      NGK G+ P+ +++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE 428

>KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369)
           [1659 bp, 552 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 552

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 55  PVEYV-EALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVKPA 111
           PVE V +ALY +QAQ P +L F  GE   V++    EWY      + + GM P +Y +  
Sbjct: 61  PVEKVIKALYNYQAQSPKELSFVKGE-FFVVQAEDKEWYDAFNPQDQRRGMVPKSYFESF 119

Query: 112 FSGG 115
             GG
Sbjct: 120 ARGG 123

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 36.6 bits (83), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           + LY +QA +    ++ F+ GE ++V +     W   R  G+ G+ PSNYVK
Sbjct: 312 QTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSNYVK 363

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           A Y ++A +  +L F+  +KI  +E    +W+ G    NG+ G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 56  VEYVEALYAFQAQQ-PGDLDFKVGEKIEVLEKPSPEWYKGRC--------NGKVGMFPSN 106
           +EY +A+Y     + PG  +F  G+ + + E  + +WYKG          N ++G+ P N
Sbjct: 601 IEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYN 660

Query: 107 YVKPAFSG 114
           +++    G
Sbjct: 661 FIQLLHQG 668

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALYA++A      ++ F+ GE + V +     W   + NG+ G+ PSNYV+
Sbjct: 271 KALYAYEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYVE 322

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 36.2 bits (82), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
            ALY+++A +    ++ F+  E +EV +     W   R NG  G+ PSNYV+
Sbjct: 317 RALYSYKANENDAYEISFEQNELLEVSDIEGRWWKARRENGTTGIIPSNYVE 368

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 36.2 bits (82), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
            ALY++QA      ++ F+ GE ++V +     W   +  G+VG+ PSNYV+
Sbjct: 299 RALYSYQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQ 350

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSP--EWYKGRCNGKVGMFPSNYVK 109
           ALY ++AQ   ++   VG+ I+V+ KP     W  G  N K  +FP++Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYK--GRCNGKVGMFPSNYVK 109
           + LYA+      ++    G+ I+V+EK +   W K      G++G+ PS+Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 56  VEYVEALYAFQAQQPG-DLDFKVGEKIEVLEKPSP-----EWYKGRCN-GKVGMFPSNYV 108
           +E+  A+Y F  + P  +L  K G+ + V+ K  P     EW++ R   G +G  P NY+
Sbjct: 307 LEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPYNYL 366

Query: 109 K 109
           +
Sbjct: 367 E 367

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCN---GKV--GMFPSNYV 108
           A +A++++   DL+FK G+KI V      EWY G      G V  G+FP ++V
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFV 64

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 36.2 bits (82), Expect = 0.084,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           V+A+Y++  ++  DL F   + IEV  K    WY GR   N K G FP+NYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEV-TKAKGGWYYGRLLRNKKSGSFPANYV 62

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALY + A      ++ F+ GE + V +     W   R NG+ G+ PSNYV+
Sbjct: 285 KALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGIIPSNYVE 336

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 36.2 bits (82), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           V+A + ++++   DL+F   + I V      EWY G    K G+FP ++VK
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVK 109
           A Y ++A +  +L F  G+KI  +E    +W+ G     G+ G+FPSNYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 36.2 bits (82), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 43  EALRGAPANN----AGPVEYVEALYAF-QAQQPGD-LDFKVGEKIEVLEKPSPEWYKGRC 96
           E L G   NN    A  +  V A+Y + Q Q P + L F+ G+  ++ +    +W+  R 
Sbjct: 54  EELVGLVPNNYIEEADVLYQVHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRA 113

Query: 97  --NGKVGMFPSNYVKPAFSGG 115
             + KVG  P NYV+    GG
Sbjct: 114 VKDKKVGFIPGNYVETIEEGG 134

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 35.4 bits (80), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALY++ A      ++ F+ GE ++V +     W   R NG+ G+ PSNYV+
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVE 338

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 35.4 bits (80), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALY + A      ++ F+ GE + V +     W   R NG+ G+ PSNYV+
Sbjct: 284 KALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYVE 335

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 33.5 bits (75), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 55 PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG 94
          P++ VE  Y +  +    L  +VG+ I VL K S  W+ G
Sbjct: 27 PIDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 56  VEYVEALYAFQAQQ-PGDLDFKVGEKIEVLEKPSPEWYKGRC--------NGKVGMFPSN 106
           +EY +A+Y     + PG  +F  G+ + + E  + +WYKG          + +VG+ P N
Sbjct: 601 IEYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYN 660

Query: 107 YVKPAFSG 114
           +++    G
Sbjct: 661 FIQLLHQG 668

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           +  A Y ++A +  +L F+  +KI  +E    +W+ G     G+ G+FPSNYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>ZYRO0D04004g Chr4 (327544..327552,327618..329327) [1719 bp, 572 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 572

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNYVKPAF 112
           P +++ A+ ++++Q P ++ F  GE   VLE+   EWY+       K G+ P  Y + A 
Sbjct: 73  PEKWIRAIGSYRSQTPQEVSFTEGEVFFVLEE-EKEWYQALNPSTKKQGLVPRGYFELAD 131

Query: 113 SGGSLMKEAS 122
              S+ + AS
Sbjct: 132 RNKSISRHAS 141

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 13/69 (18%)

Query: 55  PVEYVE---------ALYAF-QAQQPGD-LDFKVGEKIEVLEKPSPEWY--KGRCNGKVG 101
           P  Y+E         ALY + Q Q P + L FK  +  ++ +   P+W   + + +G VG
Sbjct: 61  PSNYIEESPVIGQWRALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVG 120

Query: 102 MFPSNYVKP 110
             P NYV+P
Sbjct: 121 FVPGNYVEP 129

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 6/54 (11%)

Query: 60  EALYAFQAQQPGDLDFKVG-EKIEVLEKPSPE--WYKGR-CNGKVGMFPSNYVK 109
           +ALY + A   GD  +++  E+ E+L+    E  W+K R  NG+ G+ PSNYV+
Sbjct: 307 KALYPYDAD--GDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 56  VEYVEALYAF-QAQQPGD-LDFKVGEKIEVLEKPSPEWY--KGRCNGKVGMFPSNYVKPA 111
           +  V+A+Y + +AQ P + L F   E  +V +    +W   K R   +VG  P NYV+P 
Sbjct: 71  ISQVKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEP- 129

Query: 112 FSGG 115
            SGG
Sbjct: 130 ISGG 133

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNGK-----VGMFPSNYVKPA 111
           +A+YA++ Q P +L  +  + + +LEK    +W+  K R  G       G+ PSNYV+ A
Sbjct: 9   KAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNYVEEA 68

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 56  VEYVEALYAFQAQQPG-DLDFKVGEKIEVLEKPSP-----EWYKGRCN-GKVGMFPSNYV 108
           +E+  A+Y F  + P  +   + G+ + V+ K  P     EW++ R   G VG  PSNYV
Sbjct: 310 LEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYV 369

Query: 109 K 109
           +
Sbjct: 370 E 370

>Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]
           {ON} YBR200W (BEM1) - contains two SH3 domains [contig
           24] FULL
          Length = 499

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVKPAFSGGS 116
           ++ALY +QAQ P +L F  GE   V++    EWY      + + GM P +Y +     GS
Sbjct: 8   IKALYNYQAQSPRELSFVKGEFF-VVQAEDKEWYDAANPQDHRRGMVPKSYFESFARRGS 66

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 56  VEYVEALYAFQAQQ-PGDLDFKVGEKIEVLEKPSPEWYKGRC--------NGKVGMFPSN 106
           +EY +A+Y     + PG  +F  G+ I + E  + +W+KG          + +VG+ P N
Sbjct: 600 IEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYN 659

Query: 107 YVKPAFSG 114
           +++    G
Sbjct: 660 FIQLLHQG 667

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR---CNGKV--GMFPSNYV 108
           VEAL+ + +    DL F  G+ I VLE    EW+ G     +GK   G+FP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           +  A Y + A +  +L F   +KI  +E    +W+ G    NG+ G+FPSNYV
Sbjct: 559 WATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNYV 108
           A Y + A +  +L F+  +KI  +E    +W+ G     G+ G+FPSNYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           A Y ++A +  +L F   +KI  ++    +W+ G    NG+ G+FPSNYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALY + A      ++ F+  E ++V +     W   R NG+ G+ PSNYV+
Sbjct: 307 KALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 34.7 bits (78), Expect = 0.26,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVK 109
           V ALY++  +Q  DL F   + IEV  K   +W  GR   N K G FP  YV+
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQPGDLDFKVGEKIEVL-EKPSPEWYKGRC--NGKVGMFPSNYVKPA 111
           Y F A+   +L  K G+K+ +L +K S +W+  +   +GK G+ P+ +++P 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQPGDLDFKVGEKIEVL-EKPSPEWYKGRC--NGKVGMFPSNYVKPA 111
           Y F A+   +L  K G+K+ +L +K S +W+  +   +GK G+ P+ +V+P 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  VEYVEALYAFQAQQPG-DLDFKVGEKIEVLEKPSP-----EWYKGRC-NGKVGMFPSNYV 108
           +E+  A+Y F  + P  +++ + G+ + +L K        +W+K R  NG VG  P NY+
Sbjct: 259 LEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYI 318

Query: 109 K 109
           +
Sbjct: 319 E 319

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVK 109
           A Y  +A++  +L FK G+KI  +     +W+ G     G+ G+FPSNYV+
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 9/73 (12%)

Query: 41  PNEALRGAPANNAGPVEYVEALYAFQ-AQQPGD-LDFKVGEKIEVLEKPSPEWY--KGRC 96
           PN  +  AP      V  V ++Y ++ AQ P + L F+ G++ +V +    +W   + R 
Sbjct: 61  PNNYIEEAPV-----VGRVRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRA 115

Query: 97  NGKVGMFPSNYVK 109
           +G VG  P NYV+
Sbjct: 116 DGSVGFAPGNYVE 128

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQPGDLDFKVGEKIEVL-EKPSPEWYKGRC--NGKVGMFPSNYVKPA 111
           Y F A+   +L  K G+K+ +L +K S +W+  +   +GK G+ P+ +++P 
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPV 410

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 56  VEYVEALYAFQAQQPGD--LDFKVGEKIEVLEKPSPEWY--KGRCNGKVGMFPSNYVKPA 111
           ++ V A+Y +   Q  D  L F   +  +V +    +W   K   + + G  P NYV+PA
Sbjct: 71  LKKVRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA 130

Query: 112 FSGGSLMKEASP 123
             G +  +E SP
Sbjct: 131 -DGSAPKQERSP 141

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVKPAFSGGS 116
           V+A+Y++  +   DL F   + IEV  K    W  GR   N K G FP NYV+  +   +
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQVLYEVPN 70

Query: 117 LMKEASP 123
              E SP
Sbjct: 71  GYIERSP 77

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 52  NAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPE-WYKGRCNGKVGMFPSNYV 108
           N   +  V A+Y + A+   ++  + G+ I+V+   +   W  G   G  G+FPSNY 
Sbjct: 614 NPTSLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} similar
           to uniprot|P29366 Saccharomyces cerevisiae YBR200w BEM1
           bud emergence mediator
          Length = 557

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 23  SGVITRQQSEQIESNLPNPNEALRGAPANNAGPVE-----YVEALYAFQAQQPGDLDFKV 77
           +GV+ +   + I+   P+ ++AL  + + ++   E     Y   LY F+A++  +LD  V
Sbjct: 109 NGVVPKSHFDVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEKSDELDTFV 168

Query: 78  GEKIEVLEKPSPEWYKGRCNGKVG 101
           GE + +    + EW+  +  G++G
Sbjct: 169 GENLFICAHHNYEWFIAKPIGRLG 192

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           A Y + A +  +L F   +KI  +E    +W+ G    NG+ G+FPSNYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 56  VEYVEALYAFQAQ-QPGDLDFKVGEKIEVLEKPSP-----EWYKGRC-NGKVGMFPSNYV 108
           +E+  AL+ F  + +  +L    G+ + +L K  P     +W+K R  NG  G  PSNY+
Sbjct: 306 LEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNYI 365

Query: 109 K 109
           +
Sbjct: 366 E 366

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 56  VEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNG-----KVGMFPSNY 107
           +  V+ALY ++ Q   +L  K  + + +LEK    EW+  K R  G       G+ PSNY
Sbjct: 5   IGVVKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNY 64

Query: 108 VKPA 111
           V+PA
Sbjct: 65  VEPA 68

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRC--NGKVGMFPSNYVKPA 111
           Y F A+   +L  K G+K+ +L+ K S +W+  +   +GK G+ P+ +++P 
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 56  VEYVEALYAFQAQQPGD--LDFKVGEKIEVLEKPSPEWY--KGRCNGKVGMFPSNYVKP 110
           ++ V A+Y ++  Q  D  L F   +  +VL+    +W   K   + + G  P NYV+P
Sbjct: 71  LKKVRAIYDYEQVQNADEELTFHENDVFDVLDDKDVDWLLVKSTVSNEFGFIPGNYVEP 129

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVL-EKPSPEWYKGRCNGKVGMFPSNY 107
           P  +  P   +   Y + AQ+  ++  +VG+ + VL E     W     +G  G+ P+NY
Sbjct: 598 PRGSKKPSLTLTVQYDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNY 657

Query: 108 VK 109
            K
Sbjct: 658 CK 659

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNYV 108
           PV  + A Y + +Q   +L   VG+ + VL+      W  G  NG  G+ P++Y 
Sbjct: 564 PVRTITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSYC 618

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 56  VEYVEALYAF-QAQQPGD-LDFKVGEKIEVLEKPSPEWY--KGRCNGKVGMFPSNYVKPA 111
           +  V+ALY + Q Q P + L F   +   V +   P+W   K + + +VG  P NYV+P 
Sbjct: 71  IAQVKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQPV 130

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNGK-----VGMFPSNYVKPA 111
           +A+Y ++ Q P +L+ K  + + +LEK    +W+  K R  G      VG+ PSNY++ A
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 33.9 bits (76), Expect = 0.47,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 49  PANNAGPVEYVEAL--YAFQAQQPGD--LDFKVGEKIEVLEKPSPEWYKG-RCNGKV--- 100
           P     P++ V A+  +   +  P D  L F  G+KI VL K    W+ G   +GKV   
Sbjct: 25  PLTTVVPIDRVVAIARHPTSSNHPSDTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTR 84

Query: 101 GMFPSNYVKP 110
           G FP ++VKP
Sbjct: 85  GWFPLHFVKP 94

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           +  A Y + A +  +L F   +KI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 56  VEYVEALYAFQAQQPG-DLDFKVGEKIEVLEKPS-----PEWYKGRC-NGKVGMFPSNYV 108
           +E+  ALY F  + P  +   K GE + +L++        EW+K R  NG  G  P NY+
Sbjct: 331 LEFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTKNGSTGYVPYNYI 390

Query: 109 K 109
           +
Sbjct: 391 E 391

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           +  A Y + A +  +L F   +KI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118c SSU81
          Length = 353

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 59  VEALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYV 108
           V+ALY+++A      ++ F+ GE + V +     W   + +G+ G+ PSNYV
Sbjct: 293 VKALYSYEADSADAYEMSFEQGEILMVSDIEGRWWKAKKESGETGIIPSNYV 344

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           +  A Y + A +  +L F   +KI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNYV 108
           A Y ++A +  +L F+  E+I  ++    +W+ G    +G+ G+FPSNYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 15/95 (15%)

Query: 34  IESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYK 93
           +++    PNE+++           Y   LY FQA++  +L    GE + +    + EW+ 
Sbjct: 145 VDTGRTTPNESIKSGNM-------YAIVLYDFQAEKSDELTVFAGENLFICAHHNYEWFI 197

Query: 94  GRCNGKV---GMFPSNYV-----KPAFSGGSLMKE 120
            +  G++   G+ P ++V        ++ GS +KE
Sbjct: 198 AKPIGRLGGPGLVPVDFVSIVDISTGYATGSDVKE 232

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVK 109
           A Y  +A++  +L F+ G+KI  +     +W+ G     G+ G+FPSNYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {ON}
           Anc_8.539 YBR200W
          Length = 547

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 19/89 (21%)

Query: 23  SGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIE 82
           +G I+RQQS +I +            P++  G V     LY FQA++  +L   VGE + 
Sbjct: 131 NGGISRQQSNEIST-----------QPSSLYGIV-----LYDFQAEKADELTAYVGENLF 174

Query: 83  VLEKPSPEWYKGRCNGKV---GMFPSNYV 108
           +    + EW+  +  G++   G+ P ++V
Sbjct: 175 ICAHHNYEWFIAKPIGRLGGPGLVPIDFV 203

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKV---GMFPSNYV 108
           Y   LY FQA++  +L   VGE + +    + EW+  +  G++   G+ P ++V
Sbjct: 156 YAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 209

>KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.170
           YJL020C
          Length = 902

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 6/59 (10%)

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC---NGKV--GMFPSNYV 108
           P E + A YA+Q++   DL+F   + I+V      EWY G     +G++  G+FP ++V
Sbjct: 7   PFEVI-AQYAYQSEYEDDLNFDKNQIIKVTSVEDDEWYLGEFTDDDGQLLSGIFPKSFV 64

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG--RCNGKVGMFPSNYV 108
           A Y ++A +  +L F   +KI  +E    +W+ G    +G+ G+FPSNYV
Sbjct: 541 AEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYVK 109
           A Y ++A +  +L F+ G+ I  ++    +W+ G     G+ G+FPSNYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--NGKVGMFPSNYV 108
           +  A Y + A +  +L F   +KI  +E    +W+ G    +G  G+FPSNYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNY 107
           P     P   ++A Y ++AQ   +L     + + V+       W  G  NG+ G+FP++Y
Sbjct: 552 PRRTNMPTRTMQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSY 611

Query: 108 VK 109
            +
Sbjct: 612 CR 613

>CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa]
           {ON} weakly similar to uniprot|P47068 Saccharomyces
           cerevisiae YJL020c
          Length = 1039

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR-CNG----KVGMFPSNYVKPAFS 113
           V A + +Q++   DL+F+ G+ I V      EWY G   +G      G+FP ++V     
Sbjct: 8   VVASFPYQSEYEDDLNFEKGQVITVTNIEDDEWYYGEYVDGTGASHEGIFPKSFV---VE 64

Query: 114 GGSLMKEASP 123
           G   +K A P
Sbjct: 65  GDEALKSADP 74

>YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}
           BBC1Protein possibly involved in assembly of actin
           patches; interacts with an actin assembly factor Las17p
           and with the SH3 domains of Type I myosins Myo3p and
           Myo5p; localized predominantly to cortical actin patches
          Length = 1157

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR---CNGKV--GMFPSNYVKPAFS 113
           V A + +++    DL+F+  ++I V      EWY G     NG V  G+FP ++V  A  
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFV--AVQ 67

Query: 114 GGSLMKEA 121
           G  + KEA
Sbjct: 68  GSEVGKEA 75

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 33  QIESNLPNPNEALRGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWY 92
            IE+ LP+  E + G          Y   LY F+A +  +L    GE + +      EW+
Sbjct: 141 DIENLLPDSKE-ISGDKKKKIFKSLYALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWF 199

Query: 93  KGRCNGKVG 101
            GR  G++G
Sbjct: 200 IGRPLGRIG 208

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNYV 108
           A Y + A +  +L F  G KI  +E    +W+ G     G+ G+FP+NYV
Sbjct: 475 AEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}
           SHO1Transmembrane osmosensor involved in activation of
           the Cdc42p- and MAP kinase-dependent filamentous growth
           pathway and the high-osmolarity glycerol response
           pathway; phosphorylated by Hog1p; interacts with Pbs2p,
           Msb2p, Hkr1p, and Ste11p
          Length = 367

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 72  DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           ++ F+  E ++V +     W   R NG+ G+ PSNYV+
Sbjct: 320 EISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 357

>SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]
           {ON} similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 340

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  EALYAFQAQQPG--DLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109
           +ALY + A +    ++ F+ GE + V +     W   +  G+ G+ PSNYV+
Sbjct: 281 KALYDYNASESDAYEISFEQGEILRVGDIEGRWWKAKKATGETGIIPSNYVQ 332

>YBR200W Chr2 (620872..622527) [1656 bp, 551 aa] {ON}  BEM1Protein
           containing SH3-domains, involved in establishing cell
           polarity and morphogenesis; functions as a scaffold
           protein for complexes that include Cdc24p, Ste5p,
           Ste20p, and Rsr1p
          Length = 551

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 3/64 (4%)

Query: 46  RGAPANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMF 103
           R    +   P + ++A Y++QAQ   +L F  GE   V      +WYK      GK G+ 
Sbjct: 64  RHNSKDITSPEKVIKAKYSYQAQTSKELSFMEGEFFYV-SGDEKDWYKASNPSTGKEGVV 122

Query: 104 PSNY 107
           P  Y
Sbjct: 123 PKTY 126

>Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa]
           {ON} YJL020C (BBC1) - 1:1 [contig 290] FULL
          Length = 1184

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 53  AGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNG-----KVGMFPSNY 107
           A P   V A + + ++   DL+F+ G +I V      EWY G         + G+FP ++
Sbjct: 4   AEPPFTVIAQFPYSSEHEDDLNFEKGRRITVQSIEDEEWYFGEYRTEDGEFREGIFPRSF 63

Query: 108 VK 109
           VK
Sbjct: 64  VK 65

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWY---KGRCNGKVGMFPSNYV 108
            LY F+ ++P +L+   G+KI +    + EW+       +GK  + P ++V
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNY 107
           P  +  P   + A Y + AQ   ++    G+ I V+       W  G  NG  G+FP++Y
Sbjct: 578 PRRSTLPTRTMTAKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSY 637

Query: 108 V 108
            
Sbjct: 638 C 638

>Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar to
           Ashbya gossypii AGR306C
          Length = 1024

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC-----NGKVGMFPSNYV 108
           V A ++++++   DL F  G+KI V+     +WY G         + G+FP ++V
Sbjct: 13  VVAQFSYKSEYKHDLHFDKGQKILVISIEDNQWYYGHFVDSEGKQREGIFPKSFV 67

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 1/62 (1%)

Query: 49  PANNAGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLE-KPSPEWYKGRCNGKVGMFPSNY 107
           P     P   + A Y++ A    ++   VG+ I V+       W  G  NG  G+ P++Y
Sbjct: 571 PRRTTMPSRTLTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGLVPTSY 630

Query: 108 VK 109
            K
Sbjct: 631 CK 632

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
          1252 aa] {ON} ANNOTATED BY YGOB - skipping over
          frameshift in strain S288c
          Length = 1252

 Score = 31.2 bits (69), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 55 PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG 94
          P++ VE  Y +  +    L  +VG+ I VL K S  W+ G
Sbjct: 27 PIDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 65  FQAQQPGDLDFKVGEKIEVLEKP---SPEWYKGRC--NGKVGMFPSNYVKP 110
           ++ +   ++D K G+KIEVL         WY+G+     +VG++P+ + +P
Sbjct: 11  YRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C
           (REAL)
          Length = 372

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 79  EKIEVLEKPSPE--WYKGR-CNGKVGMFPSNYVK 109
           E+ E+L+    E  W+K R  NG+ G+ PSNYV+
Sbjct: 329 EQNEILQVSDIEGRWWKARKANGETGIIPSNYVQ 362

>Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W
           (REAL)
          Length = 553

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 53  AGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR--CNGKVGMFPSNY 107
           + P + ++A Y++QAQ   +L F  GE   V      +WY+      GK G+ P +Y
Sbjct: 72  SSPEKVIKAKYSYQAQTLKELSFNEGEFFYV-SGDEKDWYRASNPSTGKQGVVPKSY 127

>Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa]
           {ON} YJL020C (REAL)
          Length = 1122

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR---CNGKV--GMFPSNYV 108
           V A + +++    DL+F+  ++I V      EWY G     NG+V  G+FP ++V
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEITVTSVEDAEWYFGEYQDSNGEVIEGIFPKSFV 64

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 30.8 bits (68), Expect = 3.7,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 7/61 (11%)

Query: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG-------RCNGKVGMFPSNY 107
           P + V  +Y F       L  +  E + VL KP+  W+ G       +   K G FP  +
Sbjct: 59  PTDIVRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTF 118

Query: 108 V 108
           V
Sbjct: 119 V 119

>KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakly
           similar to uniprot|P47068 Saccharomyces cerevisiae
           YJL020C BBC1 Protein possibly involved in assembly of
           actin patches interacts with an actin assembly factor
           Las17p and with the SH3 domains of Type I myosins Myo3p
           and Myo5p localized predominantly to cortical actin
           patches
          Length = 1214

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNG-----KVGMFPSNYVK 109
           V A + + ++   DL+F+ G  I V      EWY G         K G+FP ++VK
Sbjct: 10  VIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYFGEYQDESGTYKEGIFPRSFVK 65

>TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON}
           Anc_5.170 YJL020C
          Length = 1314

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 59  VEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNG-----KVGMFPSNYV 108
           V A + + ++   DL+F   + I V      EWY G   G     +VG+FP ++V
Sbjct: 7   VVATFPYTSEYEDDLNFDKDQTITVTAIEDDEWYSGEYLGPDGVMRVGIFPRSFV 61

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 60  EALYAFQAQQPGDLDFKVGEKIEVLEKPS-PEWY--KGRCNGK-----VGMFPSNYVKPA 111
           +A+Y ++ Q P +L  +  + + +LEK +  +W+  K R  G       G+ PSNYV+ A
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 30.4 bits (67), Expect = 6.0,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 6/77 (7%)

Query: 39  PNPNEALRGAPANN-AGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG--- 94
           P P+    G+  +    PV+ V A Y +   +   L    G+ + VL K    W+ G   
Sbjct: 5   PVPSHEETGSSGSTLVRPVDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIIL 64

Query: 95  RCNGKV--GMFPSNYVK 109
             N K   G FP NY K
Sbjct: 65  DSNNKASRGWFPCNYSK 81

>TPHA0C02610 Chr3 complement(577049..579061) [2013 bp, 670 aa] {ON}
           Anc_2.591 YMR032W
          Length = 670

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query: 56  VEYVEALY-AFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRC--------NGKVGMFPSN 106
           + Y +A Y   +   PG   F+  + + + E  S EWYKG          N + G+ P N
Sbjct: 605 IRYAKAEYPLMENDAPGLAHFEKNDYLLITEVVSDEWYKGEVYGNDMIGINHRSGLIPFN 664

Query: 107 YVK 109
           +++
Sbjct: 665 FIQ 667

>NDAI0E04050 Chr5 complement(903302..906220) [2919 bp, 972 aa] {ON}
           Anc_7.413 YBL085W
          Length = 972

 Score = 30.0 bits (66), Expect = 6.4,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 65  FQAQQPGDLDFKVGEKIEVLE---KPSPEWYKGRC--NGKVGMFPSNYVKP 110
           +  Q   +LD K+G+KI+V+    K +  WY G      + G+FP  + KP
Sbjct: 11  YLKQMEDELDLKIGDKIKVITDDGKYNDGWYLGENLKTKEKGLFPVQFTKP 61

>Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016W
          (REAL)
          Length = 1254

 Score = 30.0 bits (66), Expect = 6.6,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 55 PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKG 94
          P++ VE +Y    +    L  ++G+ + VL K S  W+ G
Sbjct: 27 PIDVVECIYEHFTESRDKLSLRIGDMVYVLNKGSNGWWDG 66

>Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON}
           YJL020C (REAL)
          Length = 1141

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGR---CNGKV--GMFPSNYVKPAFSGG 115
           A + +++    DL+F+  ++I V      EWY G     NG +  G+FP ++V  A    
Sbjct: 12  AQFPYKSDYEDDLNFEKDQEITVTSVEDAEWYFGEYQDSNGDIVEGIFPKSFVT-ANQAP 70

Query: 116 SLMKEASPP 124
              KEA  P
Sbjct: 71  EAAKEAESP 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,931,910
Number of extensions: 625709
Number of successful extensions: 1442
Number of sequences better than 10.0: 242
Number of HSP's gapped: 1358
Number of HSP's successfully gapped: 285
Length of query: 257
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 150
Effective length of database: 41,212,137
Effective search space: 6181820550
Effective search space used: 6181820550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)