Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR319W3.500ON1411415833e-78
SAKL0F02508g3.500ON1401332658e-30
KLTH0G02354g3.500ON1401222389e-26
KLLA0E03895g3.500ON1401332343e-25
Suva_16.4813.500ON1391172301e-24
Smik_16.4053.500ON1391172275e-24
NCAS0F035903.500ON1401302266e-24
Skud_16.4473.500ON1401172223e-23
YPR153W3.500ON1401172205e-23
CAGL0L08382g3.500ON1401282171e-22
Kpol_480.93.500ON1411232172e-22
TBLA0C045203.500ON1401232134e-22
KNAG0A079803.500ON1471172111e-21
TPHA0A057103.500ON1411302004e-20
ZYRO0D09724g3.500ON1391181988e-20
TDEL0D056803.500ON1401301971e-19
KAFR0G037303.500ON1441181911e-18
NOTE: 1 genes in the same pillar as AFR319W were not hit in these BLAST results
LIST: Kwal_47.18903

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR319W
         (141 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   229   3e-78
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   106   8e-30
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...    96   9e-26
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...    95   3e-25
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...    93   1e-24
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...    92   5e-24
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...    92   6e-24
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...    90   3e-23
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...    89   5e-23
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...    88   1e-22
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...    88   2e-22
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....    87   4e-22
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...    86   1e-21
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....    82   4e-20
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...    81   8e-20
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...    80   1e-19
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...    78   1e-18

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  229 bits (583), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 120/141 (85%)

Query: 1   MSSLAASSFGNPPAGYISPSFPSLLWTADDRANGALLYYTKDIVRFTIFWTLILVGGMYG 60
           MSSLAASSFGNPPAGYISPSFPSLLWTADDRANGALLYYTKDIVRFTIFWTLILVGGMYG
Sbjct: 1   MSSLAASSFGNPPAGYISPSFPSLLWTADDRANGALLYYTKDIVRFTIFWTLILVGGMYG 60

Query: 61  AVGLIAGYSHRRITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLA 120
           AVGLIAGYSHRRIT                     TFSGLITAAIYRAALIAMSTWIPLA
Sbjct: 61  AVGLIAGYSHRRITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLA 120

Query: 121 SAVVQALYLLCAAFVAQSKLI 141
           SAVVQALYLLCAAFVAQSKLI
Sbjct: 121 SAVVQALYLLCAAFVAQSKLI 141

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  106 bits (265), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 79/133 (59%), Gaps = 1/133 (0%)

Query: 10  GNPPAGYISPSFPSLLW-TADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGY 68
           G+ P GY++PSFPSL W   +++ + + LYYT DI RFT++WTLIL  G YG+ GLIA Y
Sbjct: 8   GDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSAGLIASY 67

Query: 69  SHRRITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           SHR+                       T  GL+ A IY+A L AMSTW+PL+ A++Q L+
Sbjct: 68  SHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCALMQILF 127

Query: 129 LLCAAFVAQSKLI 141
            +  +++    +I
Sbjct: 128 NVSTSYLMAGVII 140

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score = 96.3 bits (238), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 66/122 (54%), Gaps = 1/122 (0%)

Query: 8   SFGNPPAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIA 66
           + G+ P GY +P FPSL W  ++ R   + LYYT DI +FT+FWTLIL  G Y A GL A
Sbjct: 6   TIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAAGLWA 65

Query: 67  GYSHRRITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQA 126
             SHR+                       T +GLI A  Y+A L  MSTWIPL SAVV  
Sbjct: 66  SISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSAVVLI 125

Query: 127 LY 128
           L+
Sbjct: 126 LF 127

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score = 94.7 bits (234), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 72/133 (54%), Gaps = 1/133 (0%)

Query: 10  GNPPAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGY 68
           G+ P GY  P FPSL W  ++ + + A LYY  DI RFTIFWT+IL   +YG  G IA  
Sbjct: 8   GDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGTTGAIAWT 67

Query: 69  SHRRITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           +H++I                      T  G++ A IY+A L AMSTWIPL  AVVQ L+
Sbjct: 68  THKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCCAVVQILF 127

Query: 129 LLCAAFVAQSKLI 141
            +  ++   S +I
Sbjct: 128 NVSTSYSMTSPII 140

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score = 93.2 bits (230), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 62/117 (52%), Gaps = 1/117 (0%)

Query: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GYI+P FPSL W  +  R N A LYY  DI +F+++WTLI  G  Y A GL A  +HR
Sbjct: 10  PVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAGLYASLTHR 69

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           +                       T  G +  AIYR+ L +MSTWIPL  AVVQ L+
Sbjct: 70  KKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAVVQILF 126

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score = 92.0 bits (227), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 62/117 (52%), Gaps = 1/117 (0%)

Query: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY++P FPSL W  ++ R N A LYY  DI +F+++WTLI  G  Y   GL A  +HR
Sbjct: 10  PVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVTGLYASLTHR 69

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           +                       T  G +  AIYR+ L +MSTWIPL  AVVQ L+
Sbjct: 70  KKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCAVVQILF 126

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score = 91.7 bits (226), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 68/130 (52%), Gaps = 1/130 (0%)

Query: 13  PAGYISPSFPSLLWTADDRA-NGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GYI+P FPSL W  +++  +   LY   DI +FT++WTLI     YGA GL+A +SHR
Sbjct: 11  PIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAAGLLASFSHR 70

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131
           R                       T  G +  AIY A L AMSTWIPL  AV Q L+ + 
Sbjct: 71  RTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCAVAQILFDVI 130

Query: 132 AAFVAQSKLI 141
            A+ + S ++
Sbjct: 131 MAYSSVSGIL 140

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score = 90.1 bits (222), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 61/117 (52%), Gaps = 1/117 (0%)

Query: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY++P FPSL W  +  R N A LYY  DI +F+++WTLI  G  Y   GL A  +HR
Sbjct: 11  PVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVTTGLYASLTHR 70

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           +                       T  G +  AIYR+ L +MSTWIPL  AVVQ L+
Sbjct: 71  KKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCAVVQILF 127

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score = 89.4 bits (220), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 62/117 (52%), Gaps = 1/117 (0%)

Query: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY++P FPSL W  ++ + N A LYY  DI +F+++WTLI  G  Y   G+ A  +HR
Sbjct: 11  PVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAGVYASLTHR 70

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           +                       T  G +  AIYR+ L +MSTW+PL  AVVQ L+
Sbjct: 71  KKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVVQILF 127

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score = 88.2 bits (217), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 66/128 (51%), Gaps = 3/128 (2%)

Query: 1   MSSLAASSFGNPPAGYISPSFPSLLWTADDRA-NGALLYYTKDIVRFTIFWTLILVGGMY 59
           M S   S+  + P GY +PSFPSL W  +DR  + A LY+ +DI +FT++WT I  G  Y
Sbjct: 1   MKSFITST--DVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFY 58

Query: 60  GAVGLIAGYSHRRITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPL 119
           G  GL A  +H +                       T  G +  AIYR+ L +MSTW+P+
Sbjct: 59  GGAGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPM 118

Query: 120 ASAVVQAL 127
             AVVQ L
Sbjct: 119 CCAVVQIL 126

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score = 88.2 bits (217), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (53%), Gaps = 1/123 (0%)

Query: 13  PAGYISPSFPSLLW-TADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY  P FPSL W  +  + + + LY TK I  FT++W++IL GG Y   GL+A Y+HR
Sbjct: 12  PVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLISGLMASYTHR 71

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131
           +                       T +G + + IY + L AMSTWIPL  A+ Q L+ LC
Sbjct: 72  KRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCAITQVLFDLC 131

Query: 132 AAF 134
           ++F
Sbjct: 132 SSF 134

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score = 86.7 bits (213), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 1/123 (0%)

Query: 13  PAGYISPSFPSLLWTADDRA-NGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY++P FPSL W  +++  N + LY T DI +F+I+W +IL    YG  G IAG SHR
Sbjct: 11  PVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVTGTIAGVSHR 70

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131
                                   T  G + +AIY + L  MSTWIP   AVVQ L+ + 
Sbjct: 71  GKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCAVVQILFDVV 130

Query: 132 AAF 134
            +F
Sbjct: 131 QSF 133

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score = 85.9 bits (211), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 62/117 (52%), Gaps = 1/117 (0%)

Query: 13  PAGYISPSFPSLLW-TADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY +PSFPSL W  +++  + A LY  +DI +FT++W LIL G  YG  GL+A  SH 
Sbjct: 18  PVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGTSGLVATISHW 77

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           +                         +GL+  AIYRA L  MSTWIPL  AV Q L+
Sbjct: 78  KNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCCAVAQILF 134

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score = 81.6 bits (200), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 68/130 (52%), Gaps = 1/130 (0%)

Query: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY++PSFPSL W  ++ + N A LY +  I  FT++W+LIL G  YG  G +A ++HR
Sbjct: 12  PVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAGALACFTHR 71

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131
           +                       T  G I +A Y +AL +MSTWIPL  AV Q L+ + 
Sbjct: 72  KKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAVAQVLFEVT 131

Query: 132 AAFVAQSKLI 141
            ++     L+
Sbjct: 132 TSYSLVGNLM 141

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score = 80.9 bits (198), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 58/118 (49%)

Query: 11  NPPAGYISPSFPSLLWTADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSH 70
           + P GY +PSFPSL W  + R +  ++Y    I +FT++W+LI   G Y   GL A +SH
Sbjct: 9   DVPVGYETPSFPSLYWPTESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALTGLWASFSH 68

Query: 71  RRITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           R+                       T +G +   IY + L +MSTWIP   AV Q LY
Sbjct: 69  RKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCAVAQVLY 126

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score = 80.5 bits (197), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 67/130 (51%), Gaps = 1/130 (0%)

Query: 13  PAGYISPSFPSLLW-TADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71
           P GY++PSFPSL W  ++ + + A+LY    I +FT++W+LI  G  YG  GL A YSHR
Sbjct: 11  PIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIAGLWASYSHR 70

Query: 72  RITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131
           R                       T  G +  +IY A L +MSTWIP    +VQ L+   
Sbjct: 71  RRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCVIVQILFDFS 130

Query: 132 AAFVAQSKLI 141
            ++++   ++
Sbjct: 131 VSYLSSGTIM 140

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score = 78.2 bits (191), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 57/118 (48%), Gaps = 2/118 (1%)

Query: 13  PAGYISPSFPSLLWTA--DDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSH 70
           P GYI+P FPSL W    D+  + A LY   DI +FT++W+LI  G  Y + G +A  + 
Sbjct: 14  PIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVACLTT 73

Query: 71  RRITXXXXXXXXXXXXXXXXXXXXXTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128
           ++ +                     T  G +   IYRA L  MS WIP+  AV Q LY
Sbjct: 74  KKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQILY 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,902,697
Number of extensions: 318675
Number of successful extensions: 930
Number of sequences better than 10.0: 18
Number of HSP's gapped: 898
Number of HSP's successfully gapped: 18
Length of query: 141
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 43
Effective length of database: 42,244,131
Effective search space: 1816497633
Effective search space used: 1816497633
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)