Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR318W3.499ON25125112261e-172
Ecym_12303.499ON25125111121e-155
KLLA0E03917g3.499ON24924810501e-146
SAKL0F02530g3.499ON25225110441e-145
Kwal_47.188983.499ON25125110361e-143
YGR135W (PRE9)3.499ON25824710341e-143
Smik_6.2313.499ON25824710331e-143
Suva_7.4233.499ON25824710301e-142
KAFR0C020203.499ON25825310271e-142
KLTH0G02376g3.499ON25125110231e-141
Skud_7.4463.499ON25825210211e-141
Kpol_480.103.499ON25924610211e-141
NDAI0G008903.499ON25425110171e-140
ZYRO0D09746g3.499ON25325110111e-139
TDEL0D056703.499ON25525110091e-139
TPHA0A057003.499ON25624810001e-138
NCAS0E007603.499ON2592479961e-137
CAGL0I10406g3.499ON2572539951e-137
KNAG0B007603.499ON2592519791e-135
TBLA0D029203.499ON2582549221e-126
KLTH0F13574g7.120ON2541793891e-45
KLLA0B11836g7.120ON2541763864e-45
Kwal_YGOB_Anc_7.1207.120ON2541793864e-45
CAGL0F01199g7.120ON2541773849e-45
AAR012C7.120ON2511763822e-44
NCAS0F010307.120ON2531793822e-44
SAKL0F04224g7.120ON2521793812e-44
Skud_15.1197.120ON2541763813e-44
NDAI0H015207.120ON2521763803e-44
TBLA0J019807.120ON2541793803e-44
Suva_15.1317.120ON2541763787e-44
TPHA0I020707.120ON2561793779e-44
YOL038W (PRE6)7.120ON2541763771e-43
Ecym_51005.64ON2611903771e-43
KAFR0G030307.120ON2541793771e-43
Kwal_56.247805.64ON2621903771e-43
Smik_15.1297.120ON2541893761e-43
KLTH0E16324g8.871ON2501873752e-43
TPHA0H011905.64ON2601903762e-43
Kpol_1062.25.64ON2601903762e-43
CAGL0H07007g8.871ON2501873733e-43
Ecym_12727.120ON2511763733e-43
AER296W5.64ON2601903734e-43
ZYRO0G04136g7.120ON2541793725e-43
SAKL0H02068g5.64ON2611903735e-43
KNAG0J001808.871ON2501873716e-43
ADL354W8.871ON2501873717e-43
NCAS0D013405.64ON2611903718e-43
KLTH0H00528g5.64ON2611903711e-42
KAFR0L020808.871ON2501873691e-42
KLLA0A05093g5.64ON2621903701e-42
NDAI0E001608.871ON2501873692e-42
TDEL0H033007.120ON2561793692e-42
KAFR0B044405.64ON2601903692e-42
Kpol_1023.1087.120ON2541763682e-42
NDAI0C034005.64ON2631903674e-42
TBLA0C066205.64ON2621903674e-42
KNAG0K004505.64ON2671903674e-42
Ecym_81518.871ON2501873665e-42
KLLA0D10373g8.871ON2501873665e-42
KNAG0L010207.120ON2661813659e-42
TDEL0G008805.64ON2601903641e-41
Smik_13.438.871ON2501873631e-41
Suva_13.568.871ON2501873612e-41
Kpol_455.58.871ON2491883612e-41
CAGL0I02442g5.64ON2601903613e-41
Skud_13.518.871ON2501873594e-41
YML092C (PRE8)8.871ON2501873595e-41
Suva_7.5495.64ON2601903595e-41
YGR253C (PUP2)5.64ON2601903596e-41
Smik_16.545.64ON2601903596e-41
NCAS0B001508.871ON2501873586e-41
TPHA0C049308.871ON2501883561e-40
Skud_7.5865.64ON2601903552e-40
TDEL0B004008.871ON2501873542e-40
ZYRO0C11770g5.64ON2601903543e-40
SAKL0D00440g8.871ON2501873524e-40
ZYRO0A00616g8.871ON2501873525e-40
TBLA0C063408.871ON2561933525e-40
TBLA0E006907.20ON2781883241e-35
Skud_15.5307.20ON2881883215e-35
CAGL0H06105g7.20ON2901723215e-35
KLLA0A03487g7.20ON2751723198e-35
Smik_15.5467.20ON2881723199e-35
ADR401C7.20ON2791883153e-34
Suva_8.4197.20ON2921723154e-34
Kpol_538.407.20ON2741723135e-34
YOR362C (PRE10)7.20ON2881723138e-34
NCAS0I002507.20ON2921723121e-33
KAFR0C050007.20ON2811723111e-33
NDAI0A087707.20ON2921883112e-33
ZYRO0C00792g7.20ON2901883102e-33
KLTH0D00902g7.20ON2771723075e-33
SAKL0D14476g7.20ON2811873066e-33
Ecym_50197.20ON2851723068e-33
TDEL0H043107.20ON2741723031e-32
Ecym_72334.110ON2461823002e-32
KNAG0E002307.20ON2791883023e-32
AGL089W4.110ON2461822993e-32
TPHA0N002407.20ON2771722996e-32
KLLA0A05027g4.110ON2461822923e-31
TBLA0C040804.110ON2531792915e-31
Kpol_1061.454.110ON2561772882e-30
KLTH0E07788g4.110ON2461822811e-29
YGL011C (SCL1)4.110ON2521772802e-29
Suva_7.2704.110ON2521772802e-29
Kwal_47.174934.110ON2461822802e-29
NCAS0A016404.110ON2531812784e-29
TPHA0F006704.110ON2571772784e-29
ZYRO0G10164g4.110ON2531732785e-29
KNAG0E011805.1ON2331902757e-29
Smik_7.2794.110ON2521772769e-29
Skud_7.2764.110ON2521772761e-28
SAKL0H21956g4.110ON2481842732e-28
TDEL0F023604.110ON2531792723e-28
KLTH0B09504g5.1ON2331892705e-28
CAGL0A00407g4.110ON2541772706e-28
KNAG0D035404.110ON2521812653e-27
CAGL0M14003g5.1ON2331892601e-26
Kwal_26.94835.1ON2331882574e-26
KAFR0F034304.110ON2521792551e-25
NDAI0I026405.1ON2331772504e-25
KAFR0I027205.1ON2351792504e-25
KLLA0A10153g5.1ON2331902504e-25
TPHA0A056705.1ON2331772495e-25
AGL336W5.1ON3061892535e-25
Skud_13.4885.1ON2341772487e-25
Smik_13.5315.1ON2341772488e-25
YMR314W (PRE5)5.1ON2341772488e-25
Kpol_1060.15.1ON2331862479e-25
NCAS0D023105.1ON2331782479e-25
ZYRO0C01144g5.1ON2331912471e-24
Kwal_27.97208.871ON1731132421e-24
Ecym_56505.1ON2331772452e-24
Suva_13.5075.1ON2341772443e-24
SAKL0H00946g5.1ON2331892391e-23
TBLA0C071905.1ON2331882392e-23
TDEL0G002405.1ON2381932225e-21
NDAI0D035604.110ON172801555e-12
Kwal_26.68197.20ON1961101556e-12
Suva_8.2085.507ON2611611357e-09
Smik_15.3375.507ON2611611331e-08
Skud_15.3215.507ON2611681313e-08
TPHA0E020505.507ON2611731286e-08
YOR157C (PUP1)5.507ON2611611261e-07
KNAG0B038005.507ON2611681251e-07
TDEL0A037105.507ON2611831232e-07
AGL324W7.480ON2431531224e-07
ZYRO0D12034g5.507ON2611681224e-07
NDAI0C011705.507ON2631681224e-07
SAKL0G04290g5.507ON2611831191e-06
NCAS0A148807.480ON2411781172e-06
Kpol_218.15.507ON2611611162e-06
CAGL0L04312g5.507ON2611691162e-06
KLLA0E05633g7.480ON2401461162e-06
TBLA0D017505.507ON2591721162e-06
KLLA0A02233g5.507ON2621611153e-06
NDAI0J006007.480ON2411861144e-06
SAKL0F15092g7.480ON2611781144e-06
KAFR0B006507.480ON2411741144e-06
Ecym_54585.507ON2581681135e-06
KAFR0C053005.507ON2611831136e-06
KNAG0F035907.480ON2481761119e-06
Ecym_71717.480ON2421581101e-05
TDEL0C034407.480ON2411761091e-05
KLTH0E01826g7.480ON2421741092e-05
Kwal_55.198827.480ON2421591083e-05
Kpol_534.575.216ON2151621073e-05
Kpol_2002.1095.216ON2151621073e-05
Kwal_47.187485.507ON2631681073e-05
CAGL0F04477g7.480ON2421551064e-05
Kpol_1028.927.480ON2421591064e-05
TDEL0E041305.216ON2191591046e-05
KLTH0G03168g5.507ON2631681048e-05
AAR119W5.507ON2591771049e-05
TPHA0E004207.480ON2411641039e-05
TBLA0F026807.480ON2411591031e-04
NCAS0H024805.507ON2641841012e-04
KLLA0F12936g5.216ON2151631002e-04
ZYRO0G17842g7.480ON2441471002e-04
TPHA0M017503.417ON286166994e-04
YBL041W (PRE7)7.480ON241155984e-04
Smik_2.737.480ON241155975e-04
Skud_2.617.480ON241155976e-04
Kwal_33.151935.216ON193155958e-04
Smik_10.2785.216ON216162958e-04
NCAS0A114403.417ON287166960.001
NDAI0A048603.417ON287166950.001
ZYRO0B10142g5.216ON215161940.001
TBLA0F017603.417ON287166930.002
Suva_2.777.480ON241155920.002
Skud_10.2225.216ON215162910.003
CAGL0D03058g5.216ON215159910.003
Ecym_82765.216ON215159910.003
YJL001W (PRE3)5.216ON215162910.003
Skud_16.3883.417ON287166910.003
Smik_16.3433.417ON287166910.004
SAKL0G12584g5.216ON21573900.004
Suva_16.4293.417ON287166910.004
KLTH0D03058g3.417ON287166900.005
YPR103W (PRE2)3.417ON287166900.005
TPHA0N007405.216ON216163890.006
AEL326C3.417ON285166890.007
SAKL0B09262g3.417ON287166890.007
Suva_12.805.216ON215162870.009
Kwal_26.72733.417ON287166880.010
KLTH0B03102g5.216ON215159870.010
Kpol_1018.1443.417ON288166880.010
NDAI0C024205.216ON216160870.011
KAFR0C063505.216ON21671860.012
KNAG0A075203.417ON287162870.012
TBLA0C062005.216ON21676860.012
KLLA0F08228g3.417ON285166860.015
CAGL0G01804g3.417ON286166850.025
TPHA0E029905.216ON216163830.028
NCAS0A014805.216ON216161830.030
Ecym_26143.417ON285166830.037
KAFR0D042103.417ON287166830.037
AAL172C5.216ON21572820.043
ZYRO0C17688g3.417ON287166800.099
KNAG0H024505.216ON21671780.16
TDEL0C055403.417ON287166770.20
KLLA0B11660g7.162ON195159760.24
Smik_7.1736.159ON34942740.54
KAFR0D030502.449ON14744720.57
ZYRO0B03146g7.383ON205118720.80
TDEL0B071102.618ON88892721.1
TBLA0I004807.383ON205115691.6
KLTH0G00550g3.574ON26570692.2
Kwal_55.210287.162ON195158682.2
NDAI0A016907.383ON205115682.4
KLTH0F13750g7.162ON195157673.2
AAR019W7.162ON195157664.0
ADL116C7.222ON43580665.4
Suva_5.2137.383ON205115656.6
TDEL0C016407.383ON20579656.7
NCAS0A143507.383ON20579647.3
Skud_5.1167.162ON198169647.3
SAKL0F12210g7.383ON205113647.9
KLTH0C06886g7.383ON205115648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR318W
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   476   e-172
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   432   e-155
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   409   e-146
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   406   e-145
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   403   e-143
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   402   e-143
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   402   e-143
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   401   e-142
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   400   e-142
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   398   e-141
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   397   e-141
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   397   e-141
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   396   e-140
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   394   e-139
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   393   e-139
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   389   e-138
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     388   e-137
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   387   e-137
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   381   e-135
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   359   e-126
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   154   1e-45
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   153   4e-45
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   153   4e-45
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   152   9e-45
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   151   2e-44
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     151   2e-44
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   151   2e-44
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   151   3e-44
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     150   3e-44
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   150   3e-44
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   150   7e-44
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   149   9e-44
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   149   1e-43
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   149   1e-43
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   149   1e-43
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   149   1e-43
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   149   1e-43
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   149   2e-43
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   149   2e-43
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   149   2e-43
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   148   3e-43
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   148   3e-43
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   148   4e-43
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   147   5e-43
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   148   5e-43
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   147   6e-43
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   147   7e-43
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      147   8e-43
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   147   1e-42
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   146   1e-42
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   147   1e-42
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   146   2e-42
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   146   2e-42
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   146   2e-42
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   146   2e-42
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   145   4e-42
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   145   4e-42
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   145   4e-42
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   145   5e-42
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   145   5e-42
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   145   9e-42
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   144   1e-41
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   144   1e-41
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   143   2e-41
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   143   2e-41
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   143   3e-41
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   142   4e-41
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   142   5e-41
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   142   5e-41
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   142   6e-41
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   142   6e-41
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   142   6e-41
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   141   1e-40
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   141   2e-40
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   140   2e-40
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   140   3e-40
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   140   4e-40
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   140   5e-40
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   140   5e-40
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   129   1e-35
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   128   5e-35
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   128   5e-35
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   127   8e-35
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   127   9e-35
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   125   3e-34
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   125   4e-34
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   125   5e-34
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   125   8e-34
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   124   1e-33
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   124   1e-33
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   124   2e-33
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   124   2e-33
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   122   5e-33
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   122   6e-33
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   122   8e-33
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   121   1e-32
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   120   2e-32
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   120   3e-32
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   119   3e-32
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   119   6e-32
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   117   3e-31
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   116   5e-31
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   115   2e-30
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   112   1e-29
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   112   2e-29
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   112   2e-29
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   112   2e-29
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   111   4e-29
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   111   4e-29
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   111   5e-29
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   110   7e-29
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   110   9e-29
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   110   1e-28
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   109   2e-28
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   109   3e-28
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   108   5e-28
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   108   6e-28
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   106   3e-27
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   104   1e-26
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   103   4e-26
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...   102   1e-25
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       100   4e-25
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...   100   4e-25
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   100   4e-25
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             100   5e-25
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   102   5e-25
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   100   7e-25
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   100   8e-25
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   100   8e-25
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   100   9e-25
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   100   9e-25
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   100   1e-24
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...    98   1e-24
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...    99   2e-24
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...    99   3e-24
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    97   1e-23
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    97   2e-23
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    90   5e-21
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    64   5e-12
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    64   6e-12
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    57   7e-09
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    56   1e-08
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    55   3e-08
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    54   6e-08
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    53   1e-07
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    53   1e-07
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    52   2e-07
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    52   4e-07
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    52   4e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    52   4e-07
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    50   1e-06
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    50   2e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    49   2e-06
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    49   2e-06
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    49   2e-06
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    49   2e-06
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    49   3e-06
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    49   4e-06
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    49   4e-06
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    49   4e-06
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    48   5e-06
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    48   6e-06
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    47   9e-06
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    47   1e-05
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    47   1e-05
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    47   2e-05
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    46   3e-05
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    46   3e-05
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    46   3e-05
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    46   3e-05
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    45   4e-05
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    45   4e-05
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    45   6e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    45   8e-05
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    45   9e-05
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    44   9e-05
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    44   1e-04
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      44   2e-04
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    43   2e-04
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    43   2e-04
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    43   4e-04
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    42   4e-04
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    42   5e-04
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    42   6e-04
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    41   8e-04
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    41   8e-04
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    42   0.001
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    41   0.001
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    41   0.001
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    40   0.002
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    40   0.002
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    40   0.003
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    40   0.003
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    40   0.003
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    40   0.003
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    40   0.003
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    40   0.004
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    39   0.004
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    40   0.004
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    39   0.005
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    39   0.005
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    39   0.006
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    39   0.007
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    39   0.007
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    38   0.009
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    39   0.010
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    38   0.010
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    39   0.010
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    38   0.011
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    38   0.012
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    38   0.012
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    38   0.012
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    38   0.015
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    37   0.025
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    37   0.028
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    37   0.030
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    37   0.037
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    37   0.037
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    36   0.043
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    35   0.099
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    35   0.16 
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    34   0.20 
KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa] ...    34   0.24 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.54 
KAFR0D03050 Chr4 complement(602858..603301) [444 bp, 147 aa] {ON...    32   0.57 
ZYRO0B03146g Chr2 complement(254858..255475) [618 bp, 205 aa] {O...    32   0.80 
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    32   1.1  
TBLA0I00480 Chr9 (82662..83279) [618 bp, 205 aa] {ON} Anc_7.383 ...    31   1.6  
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    31   2.2  
Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W...    31   2.2  
NDAI0A01690 Chr1 (376192..376809) [618 bp, 205 aa] {ON} Anc_7.38...    31   2.4  
KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highl...    30   3.2  
AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic hom...    30   4.0  
ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON} S...    30   5.4  
Suva_5.213 Chr5 complement(323441..324058) [618 bp, 205 aa] {ON}...    30   6.6  
TDEL0C01640 Chr3 (287368..287985) [618 bp, 205 aa] {ON} Anc_7.38...    30   6.7  
NCAS0A14350 Chr1 complement(2826776..2827393) [618 bp, 205 aa] {...    29   7.3  
Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W (...    29   7.3  
SAKL0F12210g Chr6 complement(950838..951430,951636..951660) [618...    29   7.9  
KLTH0C06886g Chr3 (598854..598878,599007..599599) [618 bp, 205 a...    29   8.8  

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  476 bits (1226), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/251 (93%), Positives = 234/251 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDDLTFDDAI                 HERLEFATIQRNADGKVVQKIYKLGEIKDLLEK
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240

Query: 241 TGINKQEEKED 251
           TGINKQEEKED
Sbjct: 241 TGINKQEEKED 251

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  432 bits (1112), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 210/251 (83%), Positives = 226/251 (90%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TSSEKLYRLNDNITVAVAGLTADAEIL+NTARLHAQNYLKMYNEEIPVE+LVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNYSGWKAISVGANTQA QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KD++TF++AI                  +RLEFATI+++++GK+VQKIYK  EIK+LL+K
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSNGKLVQKIYKPSEIKELLQK 240

Query: 241 TGINKQEEKED 251
           +GI KQEE  D
Sbjct: 241 SGIMKQEENAD 251

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  409 bits (1050), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 200/248 (80%), Positives = 215/248 (86%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM + GIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TSSEKLY+LNDNITVAVAGLTADAEIL+NTAR+ AQ+YLK YNEEIPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNYSGWKAISVGANTQA QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDD+T D AI                 HERLEFATI ++A+GK+ QKIYK  EI  LLEK
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDAEGKIYQKIYKPTEIATLLEK 240

Query: 241 TGINKQEE 248
           T I K+++
Sbjct: 241 TEIVKKDD 248

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  406 bits (1044), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 196/251 (78%), Positives = 218/251 (86%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TSSEKLY+LNDNITVAVAGLTADAEIL+NTAR++AQNYL+ YNEEIPVE+LVRRLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNYSGWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KD +  D AI                 H+R+EFATI++ ++G++ QKIYK  EI+ LL K
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSNGQLYQKIYKPQEIQTLLSK 240

Query: 241 TGINKQEEKED 251
           TGI K++++++
Sbjct: 241 TGITKKDDEDE 251

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  403 bits (1036), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/251 (77%), Positives = 214/251 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MAKDGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +SSEKLY+LNDNITVAVAGLTADAEIL+NTARL AQNYLK YNEEIPVE+LVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD R+GYQLYTSNPSGNYSGWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDD+T  +A                   ER+EFATI +  +GK+ QKI+K  EI+ LL +
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLENGKIAQKIFKPREIETLLNE 240

Query: 241 TGINKQEEKED 251
           TGINK+E +E+
Sbjct: 241 TGINKKENEEE 251

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  402 bits (1034), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 197/247 (79%), Positives = 213/247 (86%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLY+LND I VAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239
           KDD+  DDAI                 ++RLEFATI++ A DG+V QKI+K  EIKD+L 
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 240 KTGINKQ 246
           KTGI K+
Sbjct: 241 KTGITKK 247

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  402 bits (1033), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 197/247 (79%), Positives = 213/247 (86%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLY+LND I+VAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239
           KDD+  DDAI                 ++RLEFATI++   DG+V QKI+K  EIKDLL 
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGINKQ 246
           KTGI K+
Sbjct: 241 KTGITKK 247

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  401 bits (1030), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 197/247 (79%), Positives = 213/247 (86%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLY+LND I VAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+D RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239
           KDD+  DDAI                 ++RLEFATI++ A DG+V QKI+K  EIKDLL 
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGINKQ 246
           KTGI K+
Sbjct: 241 KTGITKK 247

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  400 bits (1027), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 216/253 (85%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS EKLY+LND ITVAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQR-NADGKVVQKIYKLGEIKDLLE 239
           KD++T DDA+                 ++RLEFATI++   + K+ QKI+   EIK LL 
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 240 KTGINKQE-EKED 251
           KTGI+K+E E ED
Sbjct: 241 KTGISKKENEDED 253

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  398 bits (1023), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 192/251 (76%), Positives = 213/251 (84%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MAKDGIVLAAERKVTSKLLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +SSEKLY+LNDNITVAVAGLTADAEIL+NTARL AQNYLK YNEEIPVE+LVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYD RYGYQLYTSNPSGNYSGWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDD+T ++A                   ER+EF+TI +  +GK+ QKI+K  EI+ LL K
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240

Query: 241 TGINKQEEKED 251
           TG+ K+E  ++
Sbjct: 241 TGVTKKENDDE 251

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  397 bits (1021), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 216/252 (85%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLY+LND I VAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+D RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239
           K+D+  D AI                 ++RLEFATI++   DG+V QKI+K  EIKDLL 
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGINKQEEKED 251
           KTGI+K++E ++
Sbjct: 241 KTGISKKDEDDE 252

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  397 bits (1021), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 193/246 (78%), Positives = 210/246 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EK+YRLND ITVAVAGLTADAEIL+NTAR+HAQ YLK YNEEIPVE+LVRRLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDD+  D+AI                 ++R+EFATI++  + K+ QKI+K  EIK LL K
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240

Query: 241 TGINKQ 246
           TGI K+
Sbjct: 241 TGITKK 246

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  396 bits (1017), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 194/251 (77%), Positives = 213/251 (84%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS EKLY+LND ITVAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239
           KDD+  D+AI                 +++LEFATI++   DG+V QKIYK  EIK+LL 
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 240 KTGINKQEEKE 250
           KTG+ K+++ E
Sbjct: 241 KTGVTKKKDDE 251

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  394 bits (1011), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 192/251 (76%), Positives = 212/251 (84%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLYRLND I VAVAGLT+DAEIL+NTAR+HAQNYLK YNE+IPVE+LV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDD+  D AI                 ++R+EFATI+   +GK+ QK++K  EI+ LL K
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240

Query: 241 TGINKQEEKED 251
            GI K  E ED
Sbjct: 241 NGITKAGEDED 251

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  393 bits (1009), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 191/251 (76%), Positives = 213/251 (84%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLYRLND ITVAVAGLTADAEIL+NTAR++AQNYL+ YNE+IPVE+LV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDD+  + AI                 ++R+EFATIQ+  DGK+ QKI+K  EI+ LL K
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240

Query: 241 TGINKQEEKED 251
            GI K+   ++
Sbjct: 241 HGITKKHHDDE 251

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  389 bits (1000), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 210/248 (84%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLY+LNDNITVAVAGLTADAEIL+NTAR+ AQNYL+ YNE+IPVEVLVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD R GYQL+TSNPSGNY+GWKAISVGANT A QTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240
           KDD+  + AI                 ++R+EFATI++  + KV QKIYK  EIK LL K
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240

Query: 241 TGINKQEE 248
            GI K+ E
Sbjct: 241 AGITKKSE 248

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  388 bits (996), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 190/247 (76%), Positives = 210/247 (85%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLY+LND ITVAVAGLTADAEIL+NTAR++AQ+YLK YNEEIPVE+LVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQR-NADGKVVQKIYKLGEIKDLLE 239
           KD++  DDAI                 +++LE ATI++     +V QKIYK  E+K+LL 
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 240 KTGINKQ 246
           KTGI K+
Sbjct: 241 KTGITKK 247

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  387 bits (995), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 214/253 (84%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM  +GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLY+LND  TVAVAGLTADAEIL+NTAR+HAQNYLK YNEEIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GYTQ+GGLRP+GVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNADG-KVVQKIYKLGEIKDLLE 239
           KD++T DDA+                 ++RLEFAT+++  +  +  QKI+K  EIK LL 
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 240 KTGINKQ-EEKED 251
           KTGI+K+ +E ED
Sbjct: 241 KTGISKKSDEDED 253

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  381 bits (979), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 182/251 (72%), Positives = 212/251 (84%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           TS+EKLYRLND I VAVAGLTADAEIL+NTAR+H QNYLK Y E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG D RYG+QLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239
           KD++T ++A                  ++R+EF+TI+R   +G+V+QKIYK  EIK LL 
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 240 KTGINKQEEKE 250
           K+GI K++ ++
Sbjct: 241 KSGITKKDAED 251

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  359 bits (922), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 204/254 (80%), Gaps = 3/254 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+KDGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
             +EKLY+L+D IT+AVAGLTADAEIL+N AR  AQNYL  YNEEIPVE+LV++LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYD   G QLYTSNPSGNY+GWKAIS+GANT A QTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDLTFDDAIXXXXXXXXXXXXXXXXXHERLEFATIQ--RNADGKVVQKIYKLGEIKDLL 238
           KDD+  +DA+                 ++R+E + I+  +  D K++QKIY   EIK LL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 239 EKTGINKQ-EEKED 251
            K GINK+ +E ED
Sbjct: 241 IKFGINKKNDEDED 254

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  154 bits (389), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 115/179 (64%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  KD +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ AGL AD+ IL+  AR+ AQ++     + + V+ L R ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDAR-YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARD 182

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  153 bits (386), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + ++++++ ++ AGL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYGY-QLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG YS W A S+G N+  V+  L+ +Y
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNY 179

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  153 bits (386), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 115/179 (64%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  KD +V+  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ AGL AD+ IL+  AR+ AQ++     + + V+ L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDAR-YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRD 182

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  152 bits (384), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 114/177 (64%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  KD +VL  ER+ T KL +    + K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERRSTLKLQDTRVIASK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ ++ ++ AGL AD+ ILVN AR+ AQ++     + + VE + R ++ ++Q YTQ 
Sbjct: 64  VLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDAR--YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+D R     +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNY 180

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 113/176 (64%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP G ++QVEYALE++      +GI  +D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + R+++++ ++ AGL AD+ IL+  AR+ AQ++     + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYGY-QLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNY 179

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDAR-YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRD 182

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  151 bits (381), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ AGL AD+ IL+  AR+ AQ++     + + ++ L R ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYGY-QLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGVS + AG+D   G  +LY + PSG YS W A ++G N++ V+  L+ +Y  +
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKE 182

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 115/176 (65%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYG-YQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+DAR    +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  150 bits (380), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 114/176 (64%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDAR-YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNY 179

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  150 bits (380), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++++I ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYGY-QLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFG+S + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRD 182

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  150 bits (378), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 115/176 (65%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYG-YQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+D+R    +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  149 bits (377), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 115/179 (64%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  +D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++++I ++ +GL AD+ IL+  AR+ AQ++     + + +E L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYG-YQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGVS + AG+D      +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKD 182

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 114/176 (64%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYG-YQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 119/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR+ +  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WYSSLTLKEA 196

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++++I ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYGY-QLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGVS + AG D R    +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKD 182

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 118/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  +  ++  A++GLTADA  ++  AR+ A  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  149 bits (376), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 119/189 (62%), Gaps = 4/189 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  K+ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYG-YQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDLTFDDAI 190
              T +D +
Sbjct: 184 PPATVEDCV 192

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  149 bits (375), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K TS L   ++ S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTESLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I  A +G+  D  +L++ +R  A  +Y ++YNE  P ++LV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD   GY LY  +PSG+Y  WKA ++G    A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 118/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++GA ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 119/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++++I  A++GLTADA  ++  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  148 bits (373), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  L  +I    +G+  D  +LV+ +R  A  NY ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD   GY LY  +PSG+Y  WKA S+G  + A +T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  148 bits (373), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP G ++QVEYALE++      +G+   D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ AGL AD+ IL+  AR+ AQ++     + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDAR-YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  148 bits (373), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 119/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR+ +  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WYSSLTLKEA 196

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  147 bits (372), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI  KD +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + +++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYGY-QLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGV+ + AG+D      +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRD 182

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I  A++GLTADA  ++  AR+ A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  147 bits (371), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   DT S 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I    +G+  D  +LV+ +R  A  +Y ++YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD   G+ LY  +PSG+Y  WKA ++G    A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  147 bits (371), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  + L  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDTL-D 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHA-QNYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+ ++  +I    +G+  D  +L+N +R  A  +Y K Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD   G+ LY  +PSG+Y  WKA ++G    A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  147 bits (371), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 118/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  +  +I  A++GLTADA  ++  AR+ A N+   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 119/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  +  ++  A++GLTADA  ++  AR+ +  +   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  146 bits (369), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 117/187 (62%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I    +G+  D  +LV+ +R  A  +Y ++YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 118/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +GIVL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I  A++GLTADA  ++  AR++A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
                    RPFGV+ +  GYD   G+QLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL +++   T+IGI A +GIV+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I    +G+  D  +LV+ +R  A  NY ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI  +D +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ ++ ++ +GL AD+ IL+  AR+ AQ++     + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDARYGY-QLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           GG+RPFGV+ + AG+D +    +LY + PSG YS W A ++G N++ V+  L+ +Y  D
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRD 182

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+GI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ ++  A++GLTADA  ++  AR+ A ++   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYDA  GYQL+ + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  146 bits (368), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 114/176 (64%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  ++ +VL  ER+ T KL +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           + ++++++ ++ +GL AD+ IL+  AR+ AQ++     + I VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDAR-YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
           GG+RPFG+S + AG+D      +LY + PSG YS W A ++G N++ V+  L+ +Y
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNY 179

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 118/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  +  ++  A++GLTADA  ++  AR+ A N+   Y+E++ VE L + + D+     +G
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLREA 196

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 115/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS+LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  +  +I  A++GLTADA  ++  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 114/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
                    RPFGV+ + AGYDA  GYQLY + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   L   DA
Sbjct: 187 WHSSLNMRDA 196

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  S L   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDTL-D 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHA-QNYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+ ++  +I    +G+  D  +L+N +R  A  +Y+K Y E  P ++LV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD    + LY  +PSG+Y  WKA ++G    A +T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI + +GIV+A E+K +S L   DT S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDTVS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I    +G+  D  +LV+ AR  A  NY ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG Y  WKA ++G  + A +T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  145 bits (365), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 113/181 (62%), Gaps = 1/181 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T KL +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ ++ ++ AGL+ADA +L+  AR  AQ++     + + VE + R ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDA-RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDL 184
           GG+RPFGVS + AG+D+     +LY + PSG YS W A ++G N + V+  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNYAGES 183

Query: 185 T 185
           T
Sbjct: 184 T 184

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 115/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E++ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  L  +I    +G+  D  +LV+ +R  A  NY ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  143 bits (361), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  L  +I    +G+  D  +LV+ +R  A  +Y ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  143 bits (361), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 116/188 (61%), Gaps = 4/188 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKL-LEQDTSS 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGY 122
            K+  L  +I    +G+  D  +LV+ +R  A  NY ++Y E  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DLTFDDAI 190
           +L  +DAI
Sbjct: 182 ELELEDAI 189

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 119/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ ++  A++GLTADA  ++  AR+ A  +   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  142 bits (359), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  L  +I    +G+  D  +LV+ +R  A  +Y ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  142 bits (359), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  L  +I    +G+  D  +LV+ +R  A  +Y ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  142 bits (359), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AG+DA  GYQL+ + PSG +  + A ++G+ ++  Q  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  142 bits (359), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AG+DA  GYQL+ + PSG +  + A ++G+ ++  Q  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  142 bits (359), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AG+DA  GYQL+ + PSG +  + A ++G+ ++  Q  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  142 bits (358), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL +++   T++GI A +G+V+A E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I    +G+  D  +LV+ +R  A  NY ++Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  141 bits (356), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 115/188 (61%), Gaps = 4/188 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKL-LEQDTSS 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGY 122
            K+  L  +I    +G+  D  +LV+ +R  A  NY ++Y E    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D   G+ LY  +PSG+Y  WKA S+G  + A +T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DLTFDDAI 190
           +L  +DAI
Sbjct: 182 ELELEDAI 189

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  141 bits (355), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  K+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AG+DA  GYQL+ + PSG +  + A ++G+ ++  Q  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDLTFDDA 189
           +   L+  +A
Sbjct: 187 WHSSLSLKEA 196

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  140 bits (354), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YA  ++    T+IGI A +G+V+A+E+K +S L   +T S 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I    +G+  D  +LV+ +R  A  +Y ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD   G+ LY  +PSG+Y  WKA ++G  + A +T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  140 bits (354), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 115/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G++L  E++  S LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK----QG 121
           +  ++ +I  A++GLTADA  ++  AR  A  +   Y+E I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ ++  Q+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDLTFDDA 189
           +   LT  +A
Sbjct: 187 WHSSLTLKEA 196

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  140 bits (352), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L   ++ S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTESLS- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  +  +I    +G+  D  +LV+ +R  A  +Y ++Y E  P ++LV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD   GY LY  +PSG+Y  WKA ++G +  A +T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  140 bits (352), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTETLN- 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+ ++  NI    +G+  D  +LV+ +R  A  +Y ++Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
           Q GG+RP+G S + AGYD   G+ LY  +PSG+Y  WKA ++G  + A +T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 LTFDDAI 190
           L  +DAI
Sbjct: 183 LELEDAI 189

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  140 bits (352), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 79/193 (40%), Positives = 111/193 (57%), Gaps = 8/193 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           RY    T FSP G+L Q++YAL ++    TA+GI A +G+VLA E+K  S L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQ-NYLKMYNEEIPVEVLVRRLSDIKQGYT 123
           K+  L  NI    AG+  D  +LV+ AR  A  NY ++Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGY------DARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
           Q GG+RPFGVS + AG+      D+  G+ LY  +PSG Y  WKA +VG    A +T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDDLTFDDAI 190
             + D+L  +DA+
Sbjct: 183 KRWHDELELEDAV 195

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  129 bits (324), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 105/188 (55%), Gaps = 5/188 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A N+ K+Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK---D 182
             +RPFG+S I  G D   G  LY   PSG   G+K  + G   QA +  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 DLTFDDAI 190
            L+  DAI
Sbjct: 186 GLSVKDAI 193

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  128 bits (321), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 106/188 (56%), Gaps = 5/188 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ KMY   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQM---DYKD 182
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G   Q+ +  L+     + D
Sbjct: 127 NSVRPFGVSTIFGGVD-KDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 DLTFDDAI 190
            LT  +A+
Sbjct: 186 GLTAKEAV 193

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  128 bits (321), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TSKLL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I V  +GL  D   LVN AR  +QN+ KMY   IPV+    R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGV+ I+ G D + G  LY   PSG Y G+   + G   Q  +  L+
Sbjct: 127 NSVRPFGVTAIFGGCD-KNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  127 bits (319), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 103/172 (59%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+VLA E+ +TSKLL     ++K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ KMY+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+K+ + G   Q+ +  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  127 bits (319), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 100/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ K+YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G   Q+ +  L+
Sbjct: 127 NSVRPFGVSTIFGGVD-KNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  125 bits (315), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 107/188 (56%), Gaps = 5/188 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  KDG+V A E+ +TSKLL     ++K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLL-VPHKNKK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQM---DYKD 182
             +RPFG+  I+ G D + G  LY   PSG Y G++  + G   QA +  L+    + K 
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELEKLIGNDKS 185

Query: 183 DLTFDDAI 190
           +L+  DA+
Sbjct: 186 ELSARDAV 193

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  125 bits (315), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 100/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ K+Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G   Q+ +  L+
Sbjct: 127 NSVRPFGVSTIFGGVD-KDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  125 bits (313), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 102/172 (59%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  ++++ +MY++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGVS I+ G D   G  LY   PSG+Y G+K  + G+  Q  +T L+
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELE 177

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  125 bits (313), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ K+Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGVS I+ G D + G  LY   PSG+Y G+K  + G   Q+ +  L+
Sbjct: 127 NSVRPFGVSTIFGGVD-KNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  124 bits (312), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ VTSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D    VN  R  A N+ K+Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGV+ I+ G D   G  LY   PSG Y G+K  + G   Q  +  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  124 bits (311), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 100/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TSKL+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  + ++ K+Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFG++ I+ G D   G  LY   PSG+Y G+K  + G   Q  +  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 103/188 (54%), Gaps = 5/188 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI  KDG+V A E+ +TSKLL     + K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVP-KKNVK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ KMY+  IP+     RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQM---DYKD 182
             +RPFGV+ I+ G D + G  LY   PSG   G+   + G   Q  +  L+     + D
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 DLTFDDAI 190
            LT  DA+
Sbjct: 186 GLTTRDAV 193

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 107/188 (56%), Gaps = 5/188 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ V+SKLL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ ++    +GL  D   LVN  R  AQ++ K + E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQM---DYKD 182
             +RPFGV+ I+ G D + G  LY   PSG + G+K  + G   Q  +  L+     + +
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELEKVIDQHPE 185

Query: 183 DLTFDDAI 190
            L+  DA+
Sbjct: 186 GLSAKDAV 193

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  122 bits (307), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+  KDGIVLA E+ VTSKLL     ++K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ ++  A +GL  D   LVN  R  A ++ K Y   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFG++ I  G D   G  LY   PSG Y G+K  + G   Q+ +  L+
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELE 177

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  122 bits (306), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 108/187 (57%), Gaps = 4/187 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI  +DG+V A E+ VTSKLL     ++K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ K+Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ--MDYKDD 183
             +RPFGV+ I+ G D + G  LY   PSG Y G+   + G   Q+ +  L+     K D
Sbjct: 127 NSVRPFGVTAIFGGVD-KDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELEKLATSKPD 185

Query: 184 LTFDDAI 190
           L+  +A+
Sbjct: 186 LSPREAV 192

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  122 bits (306), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  KDG+V A E+ + SKLL   + +EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  A ++ K+Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFG+  I+ G D   G  LY   PSG Y G+K  + G   Q+ +  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  121 bits (303), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI  KDG+V A E+ VTSKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  + ++ K+Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGV+ I+ G D   G  LY   PSG + G+K  + G   Q  +  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  120 bits (300), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 100/182 (54%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  K+ +VL  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK 119
            T S  ++ ++ +I +   G   DA  +    +  A  +   Y  +IPV VL +RL+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q YTQ   +RP GV   +   D   G  ++  +P+G Y+G+KA + G   Q + T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  120 bits (302), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 106/188 (56%), Gaps = 10/188 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDT---- 61
           YD   ++FSP+GR +QVEYA +++ +  T++G++ +DG+VLA E+ V SKLL + +    
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 62  ---SSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDI 118
              ++ K+  +  +I  A +GL  D   LVN AR  +Q + ++Y  +IP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDARYG-YQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
            Q +T +  +RPFGV+ I+ G D       LY   PSG Y G++  + G   Q+ +  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MDYKDD 183
             +  +DD
Sbjct: 188 KLISSRDD 195

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  119 bits (299), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  K   VL  ++KV  KLLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK 119
            T +  L+ +  +I +   G  ADA  +    R  A  +   Y  ++PV VL +R +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q YTQ   +RP GV   +   D   G  ++  +P+G Y+G+KA + G   Q + T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  119 bits (299), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI   DG+V A E+ ++SKLL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQH 125
           +  ++ +I    +GL  D   LVN  R  + N+ K+Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             +RPFGVS I+ G D+  G  LY   P+G + G+K  + G   Q+ +  L+
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  117 bits (292), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 98/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I +K   V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK 119
            T S  ++ +  +I     G   DA  +    +  A  +   Y  +IP  VL +R++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q YTQ   +RP G+   +  YD   G  ++  +P+G Y+G+KA + G   Q + + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  116 bits (291), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I      V+  ++KV  KLL+  T S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  ++P +VL +R+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
              +RP GV   +  YD   G  +Y ++P+G Y G+KA + G   Q + T L+  +K +
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKN 189

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  115 bits (288), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I   +  V+  ++KV  KLL+ +T S 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  ++PV+VL +R++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK 181
              +RP GV   +   D   G  +Y S+PSG Y G+KA + G   Q + T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  112 bits (281), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 96/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   D  V+  ++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK 119
            T S  L+ ++ +I +   G   DA      A+     Y   Y  ++P +VL +R++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q YTQ   +RP GV   +   D   G  +Y  +P+G Y G+KA + G   Q + + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  112 bits (280), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  KD  V+ +++KV  KLL+  T S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P +VL +R++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK 181
              +RP GV   +   D   G  +Y ++P+G Y G+KA + G   Q + T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  112 bits (280), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 99/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  K+  V+ +++KV  KLL+ +T S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P +VL +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK 181
              +RP GV   +   D   G  +Y ++P+G Y G+KA + G   Q + T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  112 bits (280), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 99/182 (54%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I   D  V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK 119
            T S  L++++ ++ +   G   DA      A+  A  Y   Y  ++P +VL +R++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q YTQ   +RP GV   +   D   G  +Y  +P+G Y G+KA + G   Q + + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  111 bits (278), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 98/181 (54%), Gaps = 2/181 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV  KLL+  T S 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++ ++ +   G   DA      A++ A  +   Y  ++P +VL +R++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDL 184
              +RP GV   +   D   G  +Y ++P+G Y G+KA + G   Q + T L+  +K   
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFKKKT 191

Query: 185 T 185
           T
Sbjct: 192 T 192

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  111 bits (278), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   D  V+  ++KV  KLL+ DT S 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  ++P +VL +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK 181
              +RP GV   +   D   G  +Y S+PSG Y G+K  + G   Q + T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFK 188

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  111 bits (278), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 96/173 (55%), Gaps = 2/173 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  K+  V+ +++KV  KLL+  T S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            +++++  I + + G   DA      A+     +   +  ++P +VL +R++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
              +RP GV   Y   D   G  +Y S+P+G + G+KA + G   Q + T L+
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLE 183

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  110 bits (275), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 101/190 (53%), Gaps = 6/190 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +     L A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKM-YNEEIPVEVLVRRLSDIK 119
           +  +K+ + +D++ +++AGL  DA +L N  R H  NY K+ YN E+ +E +   LSD  
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHC-NYSKLVYNRELSMEKIGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q  TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +Q  +T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLVGYD-KSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERV 175

Query: 180 YKDDLTFDDA 189
             D L  +DA
Sbjct: 176 MDDFLPVEDA 185

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  110 bits (276), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+ +++KV  KLL+  T S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPTTVS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P +VL +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK 181
              +RP GV   +   D   G  +Y ++P+G Y G+KA + G   Q + T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  110 bits (276), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+ +++KV  KLL+  T S 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P +VL +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK 181
              +RP GV   +   D   G  +Y ++P+G Y G+KA + G   Q + T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  109 bits (273), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 102/184 (55%), Gaps = 2/184 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +V+ +++KV  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK 119
           +T S  +++++ ++ +   G   DA      A+  A  +   Y  ++P +VL +R++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q YTQ   +RP GV   +   D   G  +Y  +P+G + G+KA + G   Q + T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDD 183
           +K +
Sbjct: 180 FKKN 183

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  109 bits (272), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 98/179 (54%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  ++  V+  ++KV  KLLE  T S 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  ++P +VL +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
              +RP GV   +   D   G  +Y ++P+G + G+KA + G   Q + T L+  +K++
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  108 bits (270), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 98/189 (51%), Gaps = 4/189 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  D  +L N  R        +YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +Q  +T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYD-NSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDLTFDDA 189
           +D L  DDA
Sbjct: 177 QDYLELDDA 185

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  108 bits (270), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  K+  V+  ++KV  KLL+  T S 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            +++++  I +   G   DA      A+  A  +   Y  ++P +VL +R++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYK 181
              +RP GV   +   D   G  +Y  +P+G Y G+KA + G   Q + T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  106 bits (265), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 96/181 (53%), Gaps = 2/181 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I  +   V+  ++KV  KLL+  T S 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  ++P +VL +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDL 184
              +RP GV   +   D   G  +Y S+P+G Y G+KA + G   Q + T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFKKSK 190

Query: 185 T 185
           T
Sbjct: 191 T 191

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  104 bits (260), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 96/189 (50%), Gaps = 4/189 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +KD  VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  DA +L N  R        +YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +Q  +T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDLTFDDA 189
            D L   DA
Sbjct: 177 DDYLAITDA 185

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 96/188 (51%), Gaps = 4/188 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  D  +L N  R        +YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +Q  +T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYD-NSGPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDLTFDD 188
            + L  +D
Sbjct: 177 NEYLEIED 184

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  102 bits (255), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 98/179 (54%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAKDGIVLAAERKVTSKLLEQDTSSE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  K+  V+  ++KV  KLL+  T S 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQ 124
            ++ ++ ++ +   G   DA      A+  A  +   Y  ++P + L +R++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDD 183
              +RP GV   +  +D   G  +Y ++P+G + G+KA + G   Q + T L+  +K +
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKN 189

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  100 bits (250), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 91/177 (51%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +A+AGL  DA +L N  R        +YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             TQ  G RP+GV  +  G+D   G  L    PSGN       ++GA +Q  +T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHD-NSGPHLLEFQPSGNTVELYGSAIGARSQGAKTYLE 173

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score =  100 bits (250), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 96/179 (53%), Gaps = 8/179 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKD-GIVLAAERKVTSKLLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ +K+   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKM-YNEEIPVEVLVRRLSDI 118
            +  +K+ + +D++ +++AGL  DA +L N  R    NY K+ +N ++ VE     LSD 
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSKLVFNRDLSVEKAGFLLSDK 115

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
            Q  TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +Q  +T L+
Sbjct: 116 AQKNTQSYGGRPYGVGLLVVGYD-KTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLE 173

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  100 bits (250), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 96/190 (50%), Gaps = 6/190 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA-KDGIVLAAERKVTSKLLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + K  +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  DTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIK 119
            +  +K+ + +D++ V++AGL  DA +L N  R        +YN ++ +E     LSD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMD 179
           Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +Q  +T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYD-NTGAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERV 175

Query: 180 YKDDLTFDDA 189
             D    +DA
Sbjct: 176 LDDFREIEDA 185

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  100 bits (249), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 93/177 (52%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K+  V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ R ++++ +++AGL  DA +L N  R        ++N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +Q  +T L+
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLE 173

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  102 bits (253), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 98/189 (51%), Gaps = 4/189 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++   +L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + +D++ +++AGL  DA +L N  R        +Y  ++ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +Q  +T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYD-NSGAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDDLTFDDA 189
           ++ L  +DA
Sbjct: 250 EEYLEIEDA 258

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  100 bits (248), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 91/177 (51%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  DA +L N  R        ++N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             TQ  G RP+GV  +  GYD + G  L    PSGN       S+GA +Q  +T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLE 173

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  100 bits (248), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 91/177 (51%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + +D++ +++AGL  DA +L N  R        ++N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +Q  +T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLE 173

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  100 bits (248), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 92/177 (51%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  DA +L N  R        ++N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             TQ  G RP+GV  +  GYD + G  L    PSGN +     ++GA +Q  +T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLE 173

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score = 99.8 bits (247), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 96/186 (51%), Gaps = 6/186 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VLAA ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  DA +L N  R        ++N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ--M 178
             TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +Q  +T L+  M
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYD-NSGAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 179 DYKDDL 184
           D   DL
Sbjct: 177 DNFVDL 182

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score = 99.8 bits (247), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 93/178 (52%), Gaps = 6/178 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKM-YNEEIPVEVLVRRLSDIK 119
           +  +K+ + ++++ +A+AGL  DA +L N  R    NY  M +N ++ VE     L D  
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQC-NYSDMVFNRKLSVEKAGHLLCDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
           Q  TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +Q  +T L+
Sbjct: 117 QKNTQSYGGRPYGVGLLIVGYD-KSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLE 173

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 99.8 bits (247), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 97/191 (50%), Gaps = 10/191 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA-KDGIVLAAERKVTSKLLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + K  +V+A +R         
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNA------D 54

Query: 60  DTSS--EKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSD 117
           D SS  +K+ + ++++ +++AGL  DA +L N  R        +YN ++ VE +   L D
Sbjct: 55  DLSSYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCD 114

Query: 118 IKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +Q  +T L+
Sbjct: 115 KAQKNTQSYGGRPYGVGLLVVGYD-NSGPHLLEFQPSGNVLELYGTAIGARSQGAKTYLE 173

Query: 178 MDYKDDLTFDD 188
              +  L  +D
Sbjct: 174 KTLEQFLEVED 184

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score = 97.8 bits (242), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 70/113 (61%), Gaps = 3/113 (2%)

Query: 80  LTADAEILVNTAR--LHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIY 137
           +  D  +L++ +R   H Q Y ++YNE  P ++LV  ++ I Q  TQ GG+RPFGVS + 
Sbjct: 1   MGPDFRVLIDKSRKVAHTQ-YKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLV 59

Query: 138 AGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           AGYD   G+ LY  +PSG+Y  WKA ++G    A +T L+  + D+L  +DAI
Sbjct: 60  AGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAI 112

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score = 99.0 bits (245), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 92/177 (51%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++  +VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  DA +L N  R        +YN  + +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +Q  +T L+
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLE 173

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 98.6 bits (244), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 91/177 (51%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + ++++ +++AGL  DA +L N  R        ++N ++ +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ 177
             TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +Q  +T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYD-KSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLE 173

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 96.7 bits (239), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 96/189 (50%), Gaps = 4/189 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +K   V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +   K+ + ++++ +++AGL  DA +L N  R        ++N ++ +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
             TQ  G RP+GV  +  G+D   G  L    PSGN       ++GA +Q  +T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHD-NSGPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDLTFDDA 189
           ++ L  +DA
Sbjct: 177 EEYLEIEDA 185

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 96.7 bits (239), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 94/188 (50%), Gaps = 4/188 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++   +L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120
           +  +K+ + + ++ +++AGL  DA +L N  R        +++ ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       S+GA +Q  +T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYD-NSGSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDDLTFDD 188
            D L  D+
Sbjct: 177 DDFLEIDN 184

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 90.1 bits (222), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 94/193 (48%), Gaps = 9/193 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMAKDGIVLAAERKVTSK 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ +K   VL A ++   +
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRL 115
           L    +   K+ + ++++ +++AGL  DA +L N  R        ++N ++ VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTL 175
            D  Q  TQ  G RP+GV  +  G+D + G  L    PSGN       ++GA +Q  +T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGHD-KSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDDLTFDD 188
           L+      L  +D
Sbjct: 177 LERTLDTFLEIED 189

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 102 YNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWK 161
           Y  ++P +VL +R++++ Q YTQ   +RP GV   +   D   G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTQAVQTLLQMDYK 181
           A + G   Q + T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 64.3 bits (155), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 3/110 (2%)

Query: 83  DAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
           D   LVN AR  A ++ K Y   I +  L  RL    Q +T +  +RPFG++ I  G D 
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQ--MDYKDDLTFDDAI 190
             G  LY   PSG+Y G+K  + G   Q+ +  L+  +  K D++  +A+
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAV 111

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 80/161 (49%), Gaps = 14/161 (8%)

Query: 34  TAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE----ILVN 89
           T +G+  K+G+V+AA+ + T   +  D +  KL+R++  I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 90  TARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
              LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NIELHS-----LYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLF 140

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           + +  G+      +S+G+ + A   +L+  +K DLT D+AI
Sbjct: 141 SIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAI 181

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 14/161 (8%)

Query: 34  TAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE----ILVN 89
           T +G+   DG+V+AA+ + T   +  D +  KL+R++  I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 90  TARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
              LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NIELHS-----LYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLF 140

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           + +  G+      +S+G+ + A   +L+  +K DLT D+A+
Sbjct: 141 SIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAV 181

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 14/168 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE- 85
           ++ S   T +G+   +G+V+AA+ + T   +  D +  KL+R++  I  A AG  AD E 
Sbjct: 24  KATSTGTTIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEA 83

Query: 86  ---ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
              ++ +   LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTQLIGSNIELHS-----LYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G  L++ +  G+      +S+G+ + A   +L+  +K DLT D+AI
Sbjct: 135 T-GSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAI 181

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 82/173 (47%), Gaps = 15/173 (8%)

Query: 23  EYALESISHAGTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLT 81
            YA    +  GT I G+  K G+V+AA+ + T   +  D +  KL+R+   I  A AG  
Sbjct: 19  SYAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTA 78

Query: 82  ADAE----ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIY 137
           AD E    ++ +   LH+     +Y E  P   +V  L  +KQ   ++ G    G   I 
Sbjct: 79  ADTEAVTQLIGSNIELHS-----LYTERAP--RVVSALQMLKQHLFKYQG--HIGAYLIV 129

Query: 138 AGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           AG D   G  L++ +  G+       ++G+ + A   +L+  +K DL+ +DAI
Sbjct: 130 AGVDPT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAI 181

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 79/161 (49%), Gaps = 14/161 (8%)

Query: 34  TAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE----ILVN 89
           T +G+   +G+V+AA+ + T   +  D +  KL+R++  I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 90  TARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
              LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NIELHS-----LYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLF 140

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           + +  G+      +S+G+ + A   +L+  +K DLT ++AI
Sbjct: 141 SIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAI 181

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 84/168 (50%), Gaps = 14/168 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE- 85
           ++ S   T +G+   +G+V+AA+ + T   +  D +  KL+R++  I  A AG  AD E 
Sbjct: 25  KATSTGTTIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEA 84

Query: 86  ---ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
              ++ +   LH+     +Y +  P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 85  VTQLIGSNVELHS-----LYAKRQP--RVVTALQMLKQHLFKYQG--HIGAYLIVAGTDP 135

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G  L++    G+      +S+G+ + A   +L+ ++K+DL+ ++AI
Sbjct: 136 T-GAHLFSVQAHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAI 182

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 20  YQVEYALESISHA--------GTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           YQ    L S SHA         T +G+   +G+V+AA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  NITVAVAGLTADAE----ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGG 127
            I  A AG  AD E    ++ +   LH+     +Y    P   +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNLELHS-----LYASREP--RVVSALQMLKQHLFKYQG 121

Query: 128 LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFD 187
               G   I AG D   G  L++ +  G+       S+G+ + A   +L+  +K DLT +
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKE 178

Query: 188 DAI 190
           +AI
Sbjct: 179 EAI 181

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 71/153 (46%), Gaps = 6/153 (3%)

Query: 32  AGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           AGT +GI  +D  VLA + + T+          K++   DNI ++  G  AD + LV   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTS 151
           +   + Y   +N+++ ++   R +  +  G      + P+ V  I AG D      +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 179

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 79/168 (47%), Gaps = 7/168 (4%)

Query: 24  YALESISHAGTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTA 82
           +A+   +  GT I G+    G+V+AA+ + T   +  D +  KL+R+   I  A AG  A
Sbjct: 20  HAVPKATSTGTTIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAA 79

Query: 83  DAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
           D E +      + + + +  N E  V   V  L  +KQ   ++ G    G   I AG D 
Sbjct: 80  DTEAVTQLIGSNLELHSQYANREPRV---VSALQMLKQHLFRYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G  L++    G+      +S+G+ + A    L+ ++K +LT D+A+
Sbjct: 135 T-GAHLFSVQAHGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAV 181

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 83/168 (49%), Gaps = 14/168 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE- 85
           ++ S   T +G+  +DG+V+AA+ + T   +  D +  KL+R++  I  A AG  AD E 
Sbjct: 25  KATSTGTTIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEA 84

Query: 86  ---ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
              ++ +   LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 85  VTQLIGSNIELHS-----LYTSRSP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 135

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G  L++ +  G+      +S+G+ + A   +L+  ++ +L+ ++AI
Sbjct: 136 T-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAI 182

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 86/183 (46%), Gaps = 22/183 (12%)

Query: 20  YQVEYALESISHA--------GTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           YQ    L + SHA         T +G+    G+V+AA+ + T   +  D + EKL+R++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  NITVAVAGLTADAE----ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGG 127
            I  A AG  AD E    ++ +   LH+     +Y    P   +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLIGSNIELHS-----LYTNREP--RVVSALQMLKQHLFKYQG 121

Query: 128 LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFD 187
               G   I AG D   G  L++ +  G+       S+G+ + A   +L+ ++K +L+ +
Sbjct: 122 --HVGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSRE 178

Query: 188 DAI 190
           +AI
Sbjct: 179 EAI 181

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 78/178 (43%), Gaps = 16/178 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           +S E R   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILVNTARLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQGYTQHG 126
           NI ++  G  AD E LV   +    N LK Y     ++++ +    R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
              P+ V  I AG D      +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 121 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 78/161 (48%), Gaps = 14/161 (8%)

Query: 34  TAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE----ILVN 89
           T +G+    G+V+AA+ + T   +  D +  KL+R+   I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 90  TARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
              LH+     +Y+   P   +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NIELHS-----LYSNREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLF 140

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           + +  G+       S+G+ + A   +L+ ++K DLT ++AI
Sbjct: 141 SIHAHGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAI 181

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 81/169 (47%), Gaps = 14/169 (8%)

Query: 26  LESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE 85
           +++ S   T +G+    G+V+AA+ + T   +  D +  KL+R++  I  A AG  AD E
Sbjct: 23  VKATSTGTTIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTE 82

Query: 86  ----ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYD 141
               ++ +   LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D
Sbjct: 83  AVTQLIGSNIELHS-----LYTNRSP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVD 133

Query: 142 ARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
              G  L++ +  G+       S+G+ + A   +L+  +K D+T ++AI
Sbjct: 134 PT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAI 181

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + + T+          K++   DNI ++  G  AD E LV  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYT 150
            +     Y   +N+++ ++   R +  +  G      + P+ V  I AG D      +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYSGWKAISVGANTQAVQTLL 176
            +P G+Y   +  + G+    +   L
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFL 168

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 79/172 (45%), Gaps = 22/172 (12%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI 86
           ++ S   T +G+   +G+++AA+ + T   +  D +  KL+R+   I  A AG  AD E 
Sbjct: 24  KATSTGTTIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEA 83

Query: 87  LV----NTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
           +     +   LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTQLVGSNLELHS-----LYTHREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 R----YGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
                +  Q + S   G Y      S+G+ + A   +L+ ++K DLT ++A+
Sbjct: 135 TGPHLFAVQAHGSTDVGFYH-----SLGSGSLAAMAVLETNWKQDLTKEEAM 181

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%), Gaps = 14/161 (8%)

Query: 34  TAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE----ILVN 89
           T +G+    G+++AA+ + T   +  D + EKL+R+   I  A AG  AD E    ++ +
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAVTQLISS 91

Query: 90  TARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
              LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 92  NIELHS-----LYTGREP--RVVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLF 141

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           + +  G+       S+G+ + A   +L+ ++  DL+ ++AI
Sbjct: 142 SIHAHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAI 182

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 82/186 (44%), Gaps = 19/186 (10%)

Query: 10  TTI---FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEK 65
           TTI   +S E     +E+A    + + GT +GI  +D  +LA + + T+          K
Sbjct: 2   TTISSEYSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPK 61

Query: 66  LYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQ 120
           ++   DNI ++  G  AD E LV   +    N LK Y     ++++ ++   R +  +  
Sbjct: 62  VFDCGDNIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLSMKSAARNIQHLLY 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QM 178
           G        P+ V  I AG D      +Y+ +P G+Y   +  + GA    +   L  Q+
Sbjct: 118 GKR----FFPYYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQV 173

Query: 179 DYKDDL 184
           ++K+  
Sbjct: 174 NFKNQF 179

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 77/178 (43%), Gaps = 16/178 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           +S E +   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  NITVAVAGLTADAEILVNTARLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQGYTQHG 126
           NI ++  G  AD E LV       QN LK Y     + ++ +    R +  +  G     
Sbjct: 88  NILISANGFAADGEALVK----RFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR--- 140

Query: 127 GLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
              P+ V  I AG D      +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 141 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 197

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 75/174 (43%), Gaps = 15/174 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           Y  E A + I H         GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILVNTARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRP 130
           NI ++  G  AD E LV   +   + Y   +N+ ++ ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           + V  I AG D      +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 84/168 (50%), Gaps = 14/168 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE- 85
           ++ S   T +G+  ++G+V+AA+ + T   +  + + EKL++++  I  A AG  AD + 
Sbjct: 24  QATSTGTTIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDA 83

Query: 86  ---ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
              ++ +   LH+     ++    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTGLIGSNLELHS-----LFTGREP--RVVSALQKLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G  L++ +  G+       S+G+ + A   +L+ ++K+ LT ++AI
Sbjct: 135 T-GAHLFSVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAI 181

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 83/183 (45%), Gaps = 22/183 (12%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  NITVAVAGLTADAE----ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGG 127
            I  A AG  AD E    ++ +   LH+   L    E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHS---LSTRRE----PRVVTTLQMLKQHLFRYQG 121

Query: 128 LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFD 187
               G   I AG D   G  L++ +  G+      +S+G+ + A   +L+  ++ D++ D
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKD 178

Query: 188 DAI 190
           +AI
Sbjct: 179 EAI 181

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNI 73
           P      +E+     S + GT +GI  +D  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  TVAVAGLTADAEILVNTARLHAQNYLKMYN-----EEIPVEVLVRRLSDIKQGYTQHGGL 128
            ++  G  AD+  LV   R    N LK Y+     + + +    R +  +  G       
Sbjct: 79  VISANGFAADSTALVKRFR----NSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----F 130

Query: 129 RPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
            P+ V  I AG D      +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 131 FPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 186

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 72/158 (45%), Gaps = 15/158 (9%)

Query: 32  AGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
            GT +GI  +D  V+A + + T+       +  K++   DNI ++  G  AD + LV   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKKF 88

Query: 92  RLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGY 146
           +    N LK Y     N+++ ++   R +  +  G      + P+ V  I AG D     
Sbjct: 89  K----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKG 140

Query: 147 QLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
            +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKN 178

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 73/176 (41%), Gaps = 15/176 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           Y  E A   I H         GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  NITVAVAGLTADAEILVNTARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRP 130
           NI ++  G  AD E LV   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKDDL 184
           + V  I AG D      +Y+ +P G+Y   +  + GA    +   L  Q+++K+  
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQF 179

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           +S E +   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  NITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGG-LRP 130
           NI ++  G  AD   LV       QN LK Y+ +   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVK----RFQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           + V  I AG D      +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 70/159 (44%), Gaps = 15/159 (9%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + + T+          K++   DNI ++  G  AD   LV  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGTALVK- 86

Query: 91  ARLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
                QN LK Y     ++++ ++   R +  +  G        P+ V  I AG D    
Sbjct: 87  ---RFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGK 139

Query: 146 YQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
             +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 140 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 70/162 (43%), Gaps = 13/162 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNE---EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
           + H + Y   Y E   E+   +      + K   T            I AGYD     Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           Y+    G+         G+ +  +      ++K+D+T ++ I
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETI 171

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 70/162 (43%), Gaps = 13/162 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNE---EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
           + H + Y   Y E   E+   +      + K   T            I AGYD     Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           Y+    G+         G+ +  +      ++K+D+T ++ I
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETI 171

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 80/168 (47%), Gaps = 14/168 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE- 85
           ++ S   T +G+    G+V+AA+ + T   +  + +  KL+R++  I  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
              ++ +   LH+     +Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHS-----LYASRAP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G  L++ +  G+       S+G+ + A   +L+  +K+D+  ++A+
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAM 181

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + + T+          K++   DNI ++  G  AD E LV  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D      +Y
Sbjct: 88  FKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           + +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 69/159 (43%), Gaps = 15/159 (9%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + + T+          K++   DNI ++  G  AD E LV  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGFAADGEALVKR 87

Query: 91  ARLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
            +    N +K Y     ++ + +    R +  +  G        P+ V  I AG D    
Sbjct: 88  FK----NSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGK 139

Query: 146 YQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
             +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 140 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 68/159 (42%), Gaps = 12/159 (7%)

Query: 35  AIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLH 94
           ++ +  KDG++L A+ + T+     +  ++KL R+++ I    +G  AD + + +  + H
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLKMYNE---EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTS 151
              Y   Y E   +    V      + K   T            I AGYD +   ++Y+ 
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELCYENKDNLT---------AGIIVAGYDEKNKGEVYSI 136

Query: 152 NPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
              G+    K    G+ +  +      ++KDD+T D+ +
Sbjct: 137 PLGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETV 175

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 80/168 (47%), Gaps = 14/168 (8%)

Query: 27  ESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE- 85
           ++ S   T +G+    G+++AA+ + T   +  + +  KL+R++  I  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
              ++ +   LH+     MY    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHS-----MYASREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGADP 134

Query: 143 RYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G  L++ +  G+       S+G+ + A   +L+ +++ DL  ++A+
Sbjct: 135 T-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAM 181

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 22/177 (12%)

Query: 20  YQVEYALESISH--------AGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLND 71
           YQ    L S SH          T +G+  + G+V+AA+ + T   +  + + EKL+R+  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  NITVAVAGLTADAE----ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGG 127
            I  A AG  AD E    ++ +   LH+     +Y    P   +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTWLIGSNLELHS-----LYTGREP--RVVSALQKLKQHLFKYQG 121

Query: 128 LRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDL 184
               G   I AG D   G  L++ +  G+    +  S+G+ + A   +L+  +++ +
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGM 175

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 15/164 (9%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + + T+          K++   D+I ++  G  AD E LV  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGFAADGEALVKR 86

Query: 91  ARLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
            +    N +K Y     ++++ +    R +  +  G        P+ V  I AG D    
Sbjct: 87  FK----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGK 138

Query: 146 YQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKDDLTFD 187
             +Y+ +P G+Y      + GA    +   L  Q+++K+  T D
Sbjct: 139 GAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPD 182

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 15/159 (9%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + +  +          K++   DNI ++  G  AD E LV  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARLHAQNYLKMY-----NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
            +    N +K Y     ++++ ++   R +  +  G        P+ V  I AG D    
Sbjct: 87  FK----NSIKWYHFDHNDKKLTMKSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGK 138

Query: 146 YQLYTSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
             +Y+ +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 139 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 20  YQVEYALESISHA---------GTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLN 70
           YQ   AL + SH+          T +G+   +G+++AA+ + T   +  + +  KL+R++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DNITVAVAGLTADAE----ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHG 126
             I  A AG  AD E    ++ +   LH+     +Y    P   +V  L  +KQ   ++ 
Sbjct: 69  PRIWCAGAGTAADTEAVTQLIGSNIELHS-----LYTSREP--RVVSALQMLKQHLFKYQ 121

Query: 127 GLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTF 186
           G    G   I AG D   G  L++ +  G+      +S+G+ + A   +L+  ++ +++ 
Sbjct: 122 G--HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSK 178

Query: 187 DDAI 190
           + A+
Sbjct: 179 EAAV 182

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 75/163 (46%), Gaps = 15/163 (9%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNE---EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
           + H + Y   Y E   ++   +      + K   T            I AGYD +   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISV-GANTQAVQTLLQMDYKDDLTFDDAI 190
           Y S P G     ++ S+ G+ +  +      +YK+D+T ++ I
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETI 171

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 5/147 (3%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + + T+          K++   DNI +   G  AD E LV  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D      +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLL 176
           + +P G+Y   +  + GA    +   L
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFL 172

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE--- 85
           I+H  T +    + GI++A + + T+       +  K+ R+N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 86  -ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT D+A+
Sbjct: 183 GPTVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEAL 228

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + +  +          K++   DNI ++  G  AD + LV  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D      +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           + +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + +  +          K++   DNI ++  G  AD + LV  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D      +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           + +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + +  +          K++   DN+ ++  G  AD + LV  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D      +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           + +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 71/155 (45%), Gaps = 6/155 (3%)

Query: 36  IGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHA 95
           + +  KDG++L A+ + T+     +  ++KL R++D +    +G  AD + + +      
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADI----V 56

Query: 96  QNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSG 155
           Q+YL++Y  +          S  K    ++      G+  I AG+D +   ++Y+    G
Sbjct: 57  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGFDDKNKGEVYSIPLGG 114

Query: 156 NYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           +    K    G+ +  +      ++K+D+T D+ I
Sbjct: 115 SVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETI 149

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/162 (20%), Positives = 70/162 (43%), Gaps = 13/162 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RLHAQNYLKMY---NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
           + H + Y   Y   + E    V      + K   T            I AGYD +   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           YT    G+         G+ +  +      +++D+++ ++ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETV 171

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT +DA+
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDAL 229

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    K GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH    LK  N  I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKN-RISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT ++A+
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEAL 229

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 71/161 (44%), Gaps = 11/161 (6%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T      +  ++KL R++D +    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADI- 77

Query: 92  RLHAQNYLKMYNEEIPVEVLVRRLSDIKQ--GYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
               Q YL +Y  +   E   R  + I Q   Y     L       I AGYD +   ++Y
Sbjct: 78  ---VQYYLDLYTAQYG-EPSTRTAAAIFQQLCYENKDALT---AGIIVAGYDEKNQGEVY 130

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           +    G+    K    G+ +  +      +YKD +T D+ +
Sbjct: 131 SIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETV 171

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    K GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELR----EKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT ++A+
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEAL 229

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 67/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + GT +GI  +D  VLA + +  +          K++   D I ++  G  AD + LV  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARLHAQNYLKMYNE-EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D      +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLL--QMDYKD 182
           + +P G+Y   +  + GA    +   L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 70/162 (43%), Gaps = 13/162 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RLHAQNYLKMY---NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
           + H + Y   Y   + E    V      + K   T            I AGYD +   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           YT    G+         G+ +  +      +++++++ ++ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETV 171

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 72/159 (45%), Gaps = 7/159 (4%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++DNI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADI- 77

Query: 92  RLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTS 151
               Q YL MY  +          +  K    Q+      G+  I AGYD +   ++Y+ 
Sbjct: 78  ---VQYYLDMYEGQFGEPDTYTAANMFKTLCYQNKDALTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
              G+         G+ +  +      +++++++ D+ I
Sbjct: 133 PLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETI 171

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 69/159 (43%), Gaps = 7/159 (4%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTS 151
           + H   Y   Y E   V       S I   Y     L       I AGYD +   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
              G+         G+ +  +      ++K++++ ++ I
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETI 171

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 70/162 (43%), Gaps = 13/162 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RLHAQNYLKMY---NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
           + H + Y   Y   + E    V      + K   T            I AGYD +   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           YT    G+         G+ +  +      +++++++ ++ +
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETV 171

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELR----EKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DL+ +DA+
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDAL 229

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELR----EKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DL+ +DA+
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDAL 229

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNE 104
           + H + Y   Y E
Sbjct: 79  QYHLELYDSQYGE 91

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELR----EKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DL+ +DA+
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDAL 229

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L    RLH    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DL+ ++A+
Sbjct: 184 GPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEAL 229

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELR----EKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DL+ +DA+
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDAL 229

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 70/163 (42%), Gaps = 14/163 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R+ D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNE---EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGY-Q 147
           +   + Y   + E   ++   +      D K   +            I AG+D +    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           +Y+    G+    K    G+ +  +      ++KDD+T D+ +
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETV 172

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE--- 85
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L    RLH    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +Y+ DL+ +DA+
Sbjct: 182 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDAL 227

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L    RLH    LK   + I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT +DA+
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDAL 229

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/162 (19%), Positives = 70/162 (43%), Gaps = 13/162 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMY---NEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
           + H + Y   Y   + E    +      + K   T            I AGYD +   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           YT    G+         G+ +  +      +++++++ ++ +
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETV 171

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           ++H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L    RLH    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT ++A+
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEAL 229

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 74/159 (46%), Gaps = 7/159 (4%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  +DG++L A+ + T+     +  ++KL R+++ +    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADI- 77

Query: 92  RLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQLYTS 151
               Q+YL++Y  +          S  K    ++      G+  I AGYD +   ++Y+ 
Sbjct: 78  ---VQHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
              G+    K    G+ +  +      +YK++++ D+ +
Sbjct: 133 PLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETV 171

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH    LK     I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT D+A+
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEAL 229

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 73/160 (45%), Gaps = 8/160 (5%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGY-DARYGYQLYT 150
           + H    L +Y+ +          S  K    ++      G+  I AG+ DA    ++Y+
Sbjct: 79  QYH----LDIYSTQFGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDATNKGEVYS 132

Query: 151 SNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
               G+    K    G+ +  +      ++KDD+T D+ +
Sbjct: 133 VPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETV 172

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMY 102
           + H + Y   Y
Sbjct: 79  QYHLELYESQY 89

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/162 (20%), Positives = 65/162 (40%), Gaps = 4/162 (2%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILV 88
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGYQL 148
                  + Y     + I V    + L+++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           Y  +  G         VG+       +L  +YK DL+ +DA+
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDAL 229

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T      +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNEEIP 107
           + H + Y   Y   IP
Sbjct: 79  QYHLEVYTSQYG--IP 92

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    K GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 129 TWLGSQCRLHELR----EKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 180

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +Y+ DL+ ++A+
Sbjct: 181 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEAL 226

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 69/166 (41%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI-- 86
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 87  --LVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH    LK   E I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DL+ ++A+
Sbjct: 183 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEAL 228

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 70/163 (42%), Gaps = 14/163 (8%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R+ D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMYNE---EIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGY-Q 147
           +   + Y   + E   ++   +      D K   +            I AG+D +    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           +Y+    G+    K    G+ +  +      +YK+++T D+ +
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETV 172

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 73/161 (45%), Gaps = 10/161 (6%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  KDG++L A+ + T+     +  ++KL R++D +    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADI- 77

Query: 92  RLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGY--DARYGYQLY 149
               Q YL +Y  +          S  K    ++      G+  I AG+  D + G ++Y
Sbjct: 78  ---VQYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDDTKKG-EVY 131

Query: 150 TSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           +    G+    K    G+ +  +      ++K+D+T D+ I
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETI 172

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE--- 85
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L    RLH    LK   E I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT ++A+
Sbjct: 182 GPTIYYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEAL 227

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 70/166 (42%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE--- 85
           I+H  T +    + GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L +  RLH    LK   + I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DLT ++A+
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEAL 229

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 33  GTAI-GIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  +DG++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADM- 77

Query: 92  RLHAQNYLKMYN 103
               Q+YL++Y 
Sbjct: 78  ---VQHYLELYT 86

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 35.4 bits (80), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 69/166 (41%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE--- 85
           I+H  T +    + GI++A + + ++       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L    RLH    LK   E I V    + L ++   Y  +G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK DL+ ++A+
Sbjct: 184 GPTVYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEAL 229

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 33  GTAIGIMAKDG-IVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTA 91
           GT+I  +  DG ++L A+ + T+     +  ++KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RLHAQNYLKMY 102
           + H + Y   Y
Sbjct: 79  QYHLELYTSQY 89

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 68/166 (40%), Gaps = 12/166 (7%)

Query: 29  ISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAE--- 85
           I+H  T +    + GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY 144
             L    RLH    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           G  +Y  +  G         VG+       +L  +YK +L  ++A+
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEAL 229

>KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa]
           {ON} highly similar to uniprot|P22141 Saccharomyces
           cerevisiae YER012W PRE1 20S proteasome beta-type subunit
           localizes to the nucleus throughout the cell cycle
          Length = 195

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 69/159 (43%), Gaps = 9/159 (5%)

Query: 36  IGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHA 95
           +GI  KD ++LA+ + VT  +     S +K  +L  +  ++ +G   D        + + 
Sbjct: 5   LGIRVKDSVILASSKAVTRGISILKDSDDKTRQLLPHTLMSFSGEAGDTVQFAEYIQANM 64

Query: 96  QNYLKMYNEEIPVEV---LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARY-GYQLYTS 151
           Q YL   N E+        VR  +++ +        +PF V+ +  GYD +    +LY  
Sbjct: 65  QLYLIRENYELSPHAASSFVR--TELAKSLRSR---KPFQVNVLIGGYDTKNEKAELYQI 119

Query: 152 NPSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           +  G        + G       +LL   Y++DLT D+A+
Sbjct: 120 DYLGTKVELPYAAHGYAGFYTFSLLDRHYREDLTVDEAL 158

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  +  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>KAFR0D03050 Chr4 complement(602858..603301) [444 bp, 147 aa] {ON}
           Anc_2.449 YKL122C
          Length = 147

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 43  GIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEI 86
           G+ +  +RK+T KLL  D +S+K+  +N   TV ++   A+ ++
Sbjct: 77  GVTIIPKRKITKKLLHADKTSKKIKTIN---TVGLSAFMANTKV 117

>ZYRO0B03146g Chr2 complement(254858..255475) [618 bp, 205 aa] {ON}
           highly similar to uniprot|P25451 Saccharomyces
           cerevisiae YER094C PUP3 Beta subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit C10
          Length = 205

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 5/118 (4%)

Query: 28  SISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEIL 87
           S  + G  + +  KD + +A + ++  + L    + EK+++   ++ + + GL  D   L
Sbjct: 5   STINGGVCVAMTGKDCVAIACDLRLGMQSLGVSNNFEKIFKYG-HVFLGLTGLATDVTTL 63

Query: 88  VNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
             T R     Y    +  I  E   + +S     Y +  G  PF V  I AG +++ G
Sbjct: 64  SETFRYKTNLYNLKEDRPIEPETFTQLVS--SSLYERRFG--PFFVGPIVAGINSKTG 117

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 15/92 (16%)

Query: 77  VAGLTADAEILVNTAR--LHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVS 134
           +  L A  EI V ++   L    + +M       + L++ L D K+    HGGL     +
Sbjct: 664 INDLKAKVEIYVESSSEPLDVHQFKRMLKR---ADELIKELEDAKE--VTHGGLASINET 718

Query: 135 FIYAGYD-----ARYGYQLYTSNPSGNYSGWK 161
           F  AGY+     A+     Y SNP    SGW+
Sbjct: 719 FNQAGYNSQQEFAKINLPHYISNP---LSGWQ 747

>TBLA0I00480 Chr9 (82662..83279) [618 bp, 205 aa] {ON} Anc_7.383
           YER094C
          Length = 205

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 48/115 (41%), Gaps = 5/115 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + G  + +  KD + +A + ++ S+ L    + EK++    ++   + GL  D   L   
Sbjct: 8   NGGVVVAMTGKDCVAIACDLRLGSQSLGVSNNFEKIFHYG-HVFFGITGLATDVTTLNEL 66

Query: 91  ARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
            R     Y    N  I  E     +S     Y++  G  P+ V  + AG +++ G
Sbjct: 67  FRYKTNMYKLKENRSIEPETFTNLVSSTL--YSKRFG--PYFVGPVVAGLNSKTG 117

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
          similar to uniprot|P30657 Saccharomyces cerevisiae
          YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%)

Query: 20 YQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAG 79
          Y   +  + I    + I +  KDG+++AA+R  +   L + +  E+L+ +  N  V ++G
Sbjct: 29 YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80 LTADAEILVN 89
            +D + L N
Sbjct: 89 DISDMQHLEN 98

>Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W
           (PRE1) - 22.6 kDa proteasome subunit [contig 135] FULL
          Length = 195

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 69/158 (43%), Gaps = 5/158 (3%)

Query: 35  AIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLH 94
            +GI  +D ++LA  + VT  +    ++ +K  +L+++  +A  G   D        + +
Sbjct: 4   VLGIRVQDTVILATSKAVTRGISILKSTDDKTRQLSEHTLMAYTGEAGDTVQFAEYVQAN 63

Query: 95  AQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLR-PFGVSFIYAGYDA-RYGYQLYTSN 152
            Q Y    N E+  + +    S ++Q   +    R P+ V+ +  GYD  +   +LY  +
Sbjct: 64  MQLYTIRENYELSPQAVS---SFVRQELAKSIRSRKPYQVNVLIGGYDIHKEKPELYQID 120

Query: 153 PSGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
             G        + G +     +LL   Y+ D+T D+ +
Sbjct: 121 YLGTKVELPYAAHGYSGFYTFSLLDRHYRPDMTLDEGL 158

>NDAI0A01690 Chr1 (376192..376809) [618 bp, 205 aa] {ON} Anc_7.383
           YER094C
          Length = 205

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 51/115 (44%), Gaps = 5/115 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + G  + +  KD + +A + ++ S+ L    + EK++    ++ + + GL  D   L  T
Sbjct: 8   NGGIVVAMAGKDCVAIACDLRLGSQSLGVSNNFEKIFHYG-HVFLGITGLATDVTTLSET 66

Query: 91  ARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
            R  +  Y    +  I  E   + +S     Y +  G  P+ V  + AG +++ G
Sbjct: 67  FRYKSNLYELKEDRAIEPETFTQLVSSTL--YEKRFG--PYFVGPVVAGINSKSG 117

>KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highly
           similar to uniprot|P22141 Saccharomyces cerevisiae
           YER012W PRE1 20S proteasome beta-type subunit localizes
           to the nucleus throughout the cell cycle
          Length = 195

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 71/157 (45%), Gaps = 5/157 (3%)

Query: 36  IGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHA 95
           +GI  ++ ++LA  + VT  +       +K  +L++++ +A +G   DA       + + 
Sbjct: 5   LGIRVQNTVILATSKAVTRGISVLKADDDKTRQLSEHVLMAYSGEAGDAVQFSEYIQANI 64

Query: 96  QNYLKMYNEEIPVEVLVRRLSDIKQGYTQH-GGLRPFGVSFIYAGYDA-RYGYQLYTSNP 153
           Q Y    N E+  + +    S ++Q   +     RP+ V+ +  GYDA +   +LY  + 
Sbjct: 65  QLYSIRENYELSPKAVS---SFVRQELAKSIRSRRPYQVNVLIGGYDAHQKKPELYQIDY 121

Query: 154 SGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
            G        + G +     +LL   Y+ D+T ++ +
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTVEEGL 158

>AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER012W (PRE1)
          Length = 195

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 68/157 (43%), Gaps = 5/157 (3%)

Query: 36  IGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHA 95
           +GI  +D ++LA  + VT  +       +K  +L+ +  ++ +G   DA       + + 
Sbjct: 5   LGIRVQDSVILATSKAVTRGISVLKADDDKTRQLSPHSLMSFSGEPGDAVQFSEYIQANM 64

Query: 96  QNYLKMYNEEIPVEVLVRRL-SDIKQGYTQHGGLRPFGVSFIYAGYDARY-GYQLYTSNP 153
           Q Y+   N E+  +     + S++ +        +PF V+ +  GYD R    +LY  + 
Sbjct: 65  QLYMIRENYELSPQAQASYVRSELAKSLRSR---KPFQVNVLIGGYDTRAEKPELYQIDY 121

Query: 154 SGNYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
            G        + G +     +LL   Y+ D+T ++ +
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTTEEGL 158

>ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL042C
          Length = 435

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 85  EILVNTARLHAQNYLKM-YNEEIPVEV-LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142
           EIL N+AR H +N+    Y+ E P+EV +VR   D++      GG  P  V       D 
Sbjct: 302 EILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVE------DR 355

Query: 143 RYGYQLYTSNPSGNYSGWKA 162
            + Y   TS      +G  A
Sbjct: 356 MFDYSYTTSEKDAKDTGMSA 375

>Suva_5.213 Chr5 complement(323441..324058) [618 bp, 205 aa] {ON}
           YER094C (REAL)
          Length = 205

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 49/115 (42%), Gaps = 5/115 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + G  + +  KD + +A + ++ S+ L      EK++    ++ + + GL +D   L  T
Sbjct: 8   NGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYG-HVFLGITGLASDVTTLNET 66

Query: 91  ARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
            R     Y       I  E   + +S     Y +  G  P+ V  + AG +++ G
Sbjct: 67  FRYKTNLYKLKEERAIEPETFTQLVS--SSLYEKRFG--PYFVGPVVAGINSKSG 117

>TDEL0C01640 Chr3 (287368..287985) [618 bp, 205 aa] {ON} Anc_7.383
           YER094C
          Length = 205

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + G  + +  KD + +A++ ++ S+ L      EK++    ++ + + GL  D   L  T
Sbjct: 8   NGGIVVAMAGKDCVAIASDLRLGSQSLGVSNKFEKIFHYG-HVFLGITGLATDVTTLSET 66

Query: 91  ARLHAQNYLKMYNEEIPVE 109
            R +  N  K+  E+ P+E
Sbjct: 67  FR-YKTNLYKL-REDRPIE 83

>NCAS0A14350 Chr1 complement(2826776..2827393) [618 bp, 205 aa] {ON}
          Length = 205

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + G  + +  KD + +A + ++ S+ L    + EK++    ++ + + GL  D   L  T
Sbjct: 8   NGGIVVAMTGKDCVAIACDLRLGSQSLGVSNNFEKIFHYG-HVFLGLTGLATDVTTLSET 66

Query: 91  ARLHAQNYLKMYNEEIPVE 109
            R +  N  K+  E+ P+E
Sbjct: 67  FR-YKTNLYKL-KEDRPIE 83

>Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W
           (REAL)
          Length = 198

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 69/169 (40%), Gaps = 29/169 (17%)

Query: 36  IGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNTARLHA 95
           +GI  +D ++LA+ + VT  +     S +K  +L+ +  ++ AG   D        + + 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANI 64

Query: 96  QNYLKMYNEEIP---VEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYGY-QLYTS 151
           Q Y    + E+    V   VR     K+        RP+ V+ +  GYD R    +LY  
Sbjct: 65  QLYSIREDYELSPQAVSSFVR-----KELAKSIRSRRPYQVNVLIGGYDKRRNKPELYQI 119

Query: 152 N--------PSG--NYSGWKAISVGANTQAVQTLLQMDYKDDLTFDDAI 190
           +        P G   YSG+   S          LL   Y+ D+T ++ +
Sbjct: 120 DYLGTKVELPYGAHGYSGFYTFS----------LLDRHYRPDMTTEEGL 158

>SAKL0F12210g Chr6 complement(950838..951430,951636..951660) [618
           bp, 205 aa] {ON} highly similar to uniprot|P25451
           Saccharomyces cerevisiae YER094C PUP3 Beta subunit of
           the 20S proteasome involved in ubiquitin-dependent
           catabolism human homolog is subunit C10
          Length = 205

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 49/113 (43%), Gaps = 5/113 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + G  + +  KD + +A + ++ S+ L    + EK++    ++ + + GL  D   L  T
Sbjct: 8   NGGIVVAMTGKDCVAIACDLRLGSQSLGVSNNFEKIFHYG-HVFLGLTGLATDVTTLSET 66

Query: 91  ARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDAR 143
            R     Y    +  I  E   + +S     Y +  G  P+ V  + AG +++
Sbjct: 67  FRYKTNLYKLREDRSIEPETFAQLISSTL--YQKRFG--PYFVGPVVAGINSK 115

>KLTH0C06886g Chr3 (598854..598878,599007..599599) [618 bp, 205 aa]
           {ON} highly similar to uniprot|P25451 Saccharomyces
           cerevisiae YER094C PUP3 Beta subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit C10
          Length = 205

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 49/115 (42%), Gaps = 5/115 (4%)

Query: 31  HAGTAIGIMAKDGIVLAAERKVTSKLLEQDTSSEKLYRLNDNITVAVAGLTADAEILVNT 90
           + G  + +  KD + +A + ++ S+ L    + EK++    ++ + + GL  D   L  T
Sbjct: 8   NGGIVVAMTGKDCVAIACDLRLGSQSLGVANNFEKIFHYG-HVFLGLTGLATDVTTLSET 66

Query: 91  ARLHAQNYLKMYNEEIPVEVLVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDARYG 145
            R     Y    +  I  E   + +S     Y +  G  P+    + AG ++R G
Sbjct: 67  FRYKTNMYKLKEDRFIEPETFTQLVSSTL--YEKRFG--PYFTGPVVAGINSRTG 117

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,749,891
Number of extensions: 906174
Number of successful extensions: 3056
Number of sequences better than 10.0: 259
Number of HSP's gapped: 2811
Number of HSP's successfully gapped: 259
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 64 (29.3 bits)