Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR317C3.498ON32832814360.0
Ecym_12313.498ON3293355265e-64
Kwal_47.188953.498ON4432514483e-51
SAKL0F02552g3.498ON4782554443e-50
KLTH0G02398g3.498ON4622444406e-50
ZYRO0D09768g3.498ON4602304311e-48
KLLA0E03939g3.498ON4352473942e-43
TDEL0D056603.498ON4422333908e-43
Kpol_480.113.498ON4632293873e-42
TPHA0A056903.498ON4782533866e-42
KNAG0A079703.498ON3882313161e-32
YPR152C (URN1)3.498ON4652273122e-31
KAFR0G037203.498ON4092253082e-31
Skud_16.4463.498ON4562203032e-30
Suva_16.4803.498ON4522182911e-28
Smik_16.4043.498ON4602222778e-27
NCAS0F035803.498ON4132232601e-24
CAGL0L08404g3.498ON4102272106e-18
TBLA0D029303.498ON2761702004e-17
NDAI0B059003.498ON5221981913e-15
KLTH0C06468g7.401ON143857685.9
AER397C7.401ON142857686.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR317C
         (328 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   557   0.0  
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   207   5e-64
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   177   3e-51
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   175   3e-50
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   174   6e-50
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   170   1e-48
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   156   2e-43
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   154   8e-43
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   153   3e-42
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   153   6e-42
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   126   1e-32
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   124   2e-31
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   123   2e-31
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   121   2e-30
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   116   1e-28
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   111   8e-27
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   104   1e-24
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...    86   6e-18
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    82   4e-17
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...    78   3e-15
KLTH0C06468g Chr3 (563097..567413) [4317 bp, 1438 aa] {ON} simil...    31   5.9  
AER397C Chr5 complement(1392748..1397034) [4287 bp, 1428 aa] {ON...    31   6.7  

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/328 (85%), Positives = 281/328 (85%)

Query: 1   MVWKRAKSEDGKAXXXXXXXXXXXWDKPDAVEPSDGEERGDERARPQLIQGYXXXXXXXX 60
           MVWKRAKSEDGKA           WDKPDAVEPSDGEERGDERARPQLIQGY        
Sbjct: 1   MVWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEERGDERARPQLIQGYESSSSDEE 60

Query: 61  XXXXXXXXXXXXXGSDLGGGAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFESA 120
                        GSDLGGGAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFESA
Sbjct: 61  EADEATEPEDAAEGSDLGGGAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFESA 120

Query: 121 KISGDAAFYAVGDDEARQELFEQWCARKIADEGNXXXXXXXXXXXXXXXPTRFHYLAHIV 180
           KISGDAAFYAVGDDEARQELFEQWCARKIADEGN               PTRFHYLAHIV
Sbjct: 121 KISGDAAFYAVGDDEARQELFEQWCARKIADEGNAVLEDGEEAEEVELVPTRFHYLAHIV 180

Query: 181 SKSTVRPDTVYSDVRREHKELFDQLEVDILDKKEQRRFVAGLLFYYKKMDAALRGEVFRK 240
           SKSTVRPDTVYSDVRREHKELFDQLEVDILDKKEQRRFVAGLLFYYKKMDAALRGEVFRK
Sbjct: 181 SKSTVRPDTVYSDVRREHKELFDQLEVDILDKKEQRRFVAGLLFYYKKMDAALRGEVFRK 240

Query: 241 LLHAHRAAITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEI 300
           LLHAHRAAITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEI
Sbjct: 241 LLHAHRAAITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEI 300

Query: 301 KYYVLGVKDKLVVMKEVLREMLSENLAK 328
           KYYVLGVKDKLVVMKEVLREMLSENLAK
Sbjct: 301 KYYVLGVKDKLVVMKEVLREMLSENLAK 328

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  207 bits (526), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 172/335 (51%), Gaps = 29/335 (8%)

Query: 1   MVWKRAKSEDGKAXXXXXXXXXXXWDKPDAVEPSDGEERGDERARPQLIQGYXXXXXXXX 60
           MVWKRAK+ +G+            W++P+  E               L++GY        
Sbjct: 1   MVWKRAKTGEGEFYYYETVSGEKTWERPETFEEETV------MGAVGLVKGYSSSSEEEE 54

Query: 61  XXXXXXXXXXXX--XGSDLGGGAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFE 118
                          G D+                D + A   ALF+R EL+PYS+W  +
Sbjct: 55  EEEEEQQQQQQEQQHGVDISKPLDVRVG------YDSEHARFIALFDRYELNPYSSWSLQ 108

Query: 119 SAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNXXXXXXX----------XXXXXXX 168
           S K+  D  FY + DDE R+ELFE WC  K+A  G                         
Sbjct: 109 SRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSASLTGEEEEEEDDDDDEDESL 168

Query: 169 XPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD-ILDKKEQRRFVAGLLFYYK 227
            P +FHYL+HIVSKST++P TV+SDV+ E+K LF    +D    K+EQR+FV+ LLFYYK
Sbjct: 169 EPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNIDETHPKQEQRQFVSSLLFYYK 228

Query: 228 KMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCI 287
           K  +  R E+F+ LL           + N+ QL+++L+ + LP D+Y IE+ L  +EK I
Sbjct: 229 KKSSKERVEIFKNLLDTK----VKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYI 284

Query: 288 GLHGALSKLQSEIKYYVLGVKDKLVVMKEVLREML 322
           G+H +L +LQ +IKYYV+GV+DK +++KE LR M+
Sbjct: 285 GMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMV 319

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  177 bits (448), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 142/251 (56%), Gaps = 15/251 (5%)

Query: 80  GAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQE 139
           G      D  ND      AE  +LF +  +DPYS W  +S KI  D  FY + +D  R+E
Sbjct: 200 GTVLPEHDYSND------AEFISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKE 253

Query: 140 LFEQWCARKIADEGNXXXXXXXXXXXX-------XXXPTRFHYLAHIVSKSTVRPDTVYS 192
           LFE WC  + +++                        P+R+HYLAHIVSKS +   T+  
Sbjct: 254 LFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSLEPSRYHYLAHIVSKSKITSSTLPK 313

Query: 193 DVRREHKELFDQLEV-DILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITA 251
           D+R + KELF Q  + D L K+EQ  F++ LLFYYK+M    R  +F++ L   + A+  
Sbjct: 314 DIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEGKKKALKK 373

Query: 252 AFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKL 311
             L+N  +L  +L    LPQ++Y+IET L I+E CI  HG+ + LQ +++YYVLG+KDK 
Sbjct: 374 G-LKNQERLSTILSTPSLPQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKT 432

Query: 312 VVMKEVLREML 322
           V ++++L++++
Sbjct: 433 VALRDILKDLI 443

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  175 bits (444), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 138/255 (54%), Gaps = 31/255 (12%)

Query: 97  KAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNXX 156
           K     LF++  LDPYS W F+S KI+ D  FY V +  +R++LFEQWC   IA+  +  
Sbjct: 224 KNRFTILFDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAI 283

Query: 157 XXXXXXXXXX-----------------------------XXXPTRFHYLAHIVSKSTVRP 187
                                                     PTRFHYL+HI+SKS++  
Sbjct: 284 SDANINENDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQ 343

Query: 188 DTVYSDVRREHKELFDQLEV-DILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHR 246
            T++ D+++E+K LF    +   L KK+Q  F + LLFYYK+MD   R  +F+KLL + +
Sbjct: 344 TTIFLDIKKENKALFKTFRIKSSLKKKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLS-K 402

Query: 247 AAITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLG 306
             I  + L N  +LR++      P DSY+IET L ++E C+ +HG LS LQ E+ YY+LG
Sbjct: 403 LDIIRSNLRNVEKLRDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILG 462

Query: 307 VKDKLVVMKEVLREM 321
           +KDK + +K+ L++ 
Sbjct: 463 IKDKTIQLKQFLQKF 477

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  174 bits (440), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 130/244 (53%), Gaps = 13/244 (5%)

Query: 93  TDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADE 152
            +  K    +LF+  +LDPYS W  +S KI  +  FY V  D  R+ELFE WC  K+  E
Sbjct: 219 NEATKQMFTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLE 278

Query: 153 -----------GNXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKEL 201
                       +               PTR+HYLAHIVSK+ V P T+  D+R E K+L
Sbjct: 279 DVIEDPAHQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQL 338

Query: 202 FDQLEV-DILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQL 260
           F Q ++ + L KK+Q  F++ LLFYYK M    R EV  K L   R  I   F  N  QL
Sbjct: 339 FKQFKIKESLGKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGF-RNIEQL 397

Query: 261 RELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVLRE 320
             +L   +LP   ++IE+ L  +E CI +HG    LQ E++YYVLG+K K   +KE L++
Sbjct: 398 ESVLSQQDLPTSGFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFLKQ 457

Query: 321 MLSE 324
           + SE
Sbjct: 458 LNSE 461

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  170 bits (431), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 131/230 (56%), Gaps = 5/230 (2%)

Query: 95  GKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIAD--- 151
           G K  LW LF R +L+PYSAW FE  KI  D  F  V DD  R+++FE+WCA  I+    
Sbjct: 228 GDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQV 287

Query: 152 EGNXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD--I 209
           E                 PT++HYLAHIVSKS + P T++ D++ ++K  F +  +   +
Sbjct: 288 EPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFL 347

Query: 210 LDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDEL 269
             KK+Q  FV+ LLFYYK+M    R EVF +LL  +   I      +  ++R  L  +  
Sbjct: 348 TSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEID 407

Query: 270 PQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVLR 319
             D Y++ET LF +EK +GL G LS L  E KYY+LG++DK++ + + L+
Sbjct: 408 SNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLK 457

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 140/247 (56%), Gaps = 20/247 (8%)

Query: 89  GNDETDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARK 148
            N E + K      L    +LDPYS W  ++ +I  D  +Y +  ++ R ELF+ WC+++
Sbjct: 198 NNTEIESK---FIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQ 254

Query: 149 IADEG--------NXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKE 200
           + +          +               PT++HYLAHI+SK+ + P+T++S++++E+K 
Sbjct: 255 LNNSNNDNENNAQDSAENSDEEDSDVTLEPTKYHYLAHIISKANITPETLFSNIKKENKS 314

Query: 201 LFDQLEVD-ILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQ 259
           LF +LE++  L KKEQ +F + ++ YYK+MD   R E+F+K++          F     +
Sbjct: 315 LFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNK-----LRFPPISEK 369

Query: 260 LRELLEYDELPQDSYSIETDLFIVEKCIGLHGAL--SKLQSEIKYYVLGVKDKLVVMKEV 317
           L +L+  +E P DS+ +ET L  +E  + +   L  S +Q+EI YY+LG+KDKL  +KE+
Sbjct: 370 LSQLM-LEETPSDSFKLETQLLQLENALLILDNLQNSYMQNEIMYYILGIKDKLAALKEI 428

Query: 318 LREMLSE 324
           LR+  S+
Sbjct: 429 LRDQYSK 435

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  154 bits (390), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 123/233 (52%), Gaps = 11/233 (4%)

Query: 97  KAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKI------- 149
           + + + L +R + DPYS W  ++ KI  D  FY + DD  R+ +FE+WC + I       
Sbjct: 206 RNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQ 265

Query: 150 --ADEGNXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEV 207
              DE N               P  FHYLAHIVSK+ + P T++ D++ ++K  F + ++
Sbjct: 266 DLVDEDNLDDDSREEEEEDELEPLPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKI 325

Query: 208 D--ILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLE 265
              +  K +Q  FV+ LLFYYKK     R E+F  LL +H  +I     +    +R  L 
Sbjct: 326 KQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLS 385

Query: 266 YDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVL 318
            +    D+Y+IET L  +E  IGL   + +L ++ KYYVLG+KDK++ +   L
Sbjct: 386 EEAGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYL 438

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  153 bits (387), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/229 (34%), Positives = 126/229 (55%), Gaps = 11/229 (4%)

Query: 103 LFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARK-------IADEGNX 155
           LFE  +LDPYS+W  +  KI     ++ + D+  R+ELFE WC+ K       + +    
Sbjct: 237 LFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTNFEGE 296

Query: 156 XXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD--ILDKK 213
                         PT+FHYLAHI+SK+ +  DT++ D++  +K LF + ++   I  KK
Sbjct: 297 DEETLTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLFKEFKIKDFIKSKK 356

Query: 214 EQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQDS 273
           +Q  F + LLF+YKK     R  +F +LL  +   I      N   +R +++ D    ++
Sbjct: 357 DQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIVRHIIKND--VDEA 414

Query: 274 YSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVLREML 322
           Y IET L  +EK IGL   L  L ++ KYY+LG+KDKL+++KE L++ +
Sbjct: 415 YEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYLKDKI 463

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  153 bits (386), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 138/253 (54%), Gaps = 27/253 (10%)

Query: 94  DGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARK----- 148
           +  K + + LFE+ +L+ +S W  +S  +  D  FY + D+  R+++FE+WC+RK     
Sbjct: 227 NASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHN 286

Query: 149 ------------------IADEGNXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTV 190
                              A++                 PT++HYL+HI+SK+ + PDT+
Sbjct: 287 SITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTI 346

Query: 191 YSDVRREHKELFDQLEVD--ILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAA 248
           + D+++++K+LF Q +++  I  K++   F + L+FYYKK D + R ++F  +L  ++ A
Sbjct: 347 FQDIKKDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTA 406

Query: 249 ITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVK 308
           I    +E+  ++ E L  +    + +  ET L  +E  +GL G+L KL ++ KYY+LG+K
Sbjct: 407 INKHVVEHSDKVLETL--NTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIK 464

Query: 309 DKLVVMKEVLREM 321
           DKL  +K  LR +
Sbjct: 465 DKLECLKNYLRNL 477

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  126 bits (316), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 113/231 (48%), Gaps = 26/231 (11%)

Query: 92  ETDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIAD 151
           +TD  +   + LF    LD YS W  ES KIS D  F+ + DD  R+E+FE+WC   + D
Sbjct: 177 DTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVD 236

Query: 152 EGNXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEV-DIL 210
           +                 PT++HYL+ IV+KSTV P T++ D+++E   LF Q  +   L
Sbjct: 237 DSE---DEGYSSGDDDLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFL 293

Query: 211 DKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELP 270
            K+EQ +FV+ LLFYYKK     R ++F K +   R     +                 P
Sbjct: 294 SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVPSPTS--------------P 339

Query: 271 QDSYS---IETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVL 318
            DS +   IET+L  +E     H   + L + + YY L +K K  V+  +L
Sbjct: 340 ADSATPEDIETNLLQMES----HLPPTVLDNTV-YYTLDIKTKQSVLHRML 385

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  124 bits (312), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 122/227 (53%), Gaps = 21/227 (9%)

Query: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARK----IADEGNX 155
            + LF+R +LD +S W  +S KI  D  FY + DD  R+ LFE+WC  +     A+E + 
Sbjct: 219 FFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESD- 277

Query: 156 XXXXXXXXXXXXXXPTRFHYLAHIVSKS-TVRPDTVYSDVRREHKELFDQLEVD--ILDK 212
                         PT++HYLA IV+ + T+ PDT+  D+R++ K L+   ++   I  K
Sbjct: 278 -SEDNSEDDSEVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSK 336

Query: 213 KEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLE-YDEL-- 269
           ++Q +FV+ LLFYYK  D   R E+F   L  H    T A +E+  Q +EL++ +  L  
Sbjct: 337 RDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGA-VESLRQDKELIDRWQTLLK 395

Query: 270 -PQDSYSIETDLFIVEK--CIGLHGALSKLQSEIKYYVLGVKDKLVV 313
            P DS SIE  L  +E   C+        + +E +YYV+G+ +K VV
Sbjct: 396 APADSSSIEDILLSIEHRCCVS-----PIVVTEPRYYVVGILEKTVV 437

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  123 bits (308), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 118/225 (52%), Gaps = 18/225 (8%)

Query: 95  GKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCA----RKIA 150
           G KA+   LF+R  LD +S W  E  K+S D  FY V DD+ R++LFE+WC+       +
Sbjct: 185 GDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTS 244

Query: 151 DEGNXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD-- 208
           DE                 PT+FHYL+ IVSKS +R  T++ D++R++K LF + ++   
Sbjct: 245 DEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIKDF 304

Query: 209 ILDKKEQRRFVAGLLFYYKKMDAAL-RGEVFRKLLHAHRAAITAAFLENDAQLRELLEYD 267
           I   KEQ +FV+ LLFYYK       R + F   L    A  T+      + +  L E+ 
Sbjct: 305 IESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSM-----SDMNTLSEHI 359

Query: 268 ELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLV 312
           +   D+Y+IET L  +E C      L    S+++YY+L +K K +
Sbjct: 360 K-RNDTYAIETTLLQIE-CNFPQDVL----SDVRYYILDLKQKTI 398

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  121 bits (303), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 110/220 (50%), Gaps = 12/220 (5%)

Query: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNXXXXX 159
            + LF+R ELD +S W  +S KI  D  FY +GDD  R+  FE+WC  + +D        
Sbjct: 215 FFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCGHEHSDSA-AAEAS 273

Query: 160 XXXXXXXXXXPTRFHYLAHIVSKS-TVRPDTVYSDVRREHKELFDQLEVD--ILDKKEQR 216
                     PT++HYLA I++K+ T+ PD V  D+R++ KEL+    +   +  K+EQ 
Sbjct: 274 GSEDVGDVLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQD 333

Query: 217 RFVAGLLFYYKKMDAALRGEVFRKLLHAHR---AAITAAFLENDAQLRELLEYDELPQDS 273
           +FV+ LLFYYK      R E+F+  L  H    A    +       + +     E P D 
Sbjct: 334 KFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADG 393

Query: 274 YSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVV 313
            S+E  L  +E    +  A     ++ +YYV+G+ DK +V
Sbjct: 394 ASVEEVLLNIEYRCNIVVA-----ADPRYYVVGILDKTMV 428

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  116 bits (291), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 110/218 (50%), Gaps = 13/218 (5%)

Query: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWC-ARKIADEGNXXXX 158
            + L +R ELD +S W  +  KI  D  FY VGD   R+ LFE+WC +   +  GN    
Sbjct: 213 FFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFEEWCASASASASGN---E 269

Query: 159 XXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD--ILDKKEQR 216
                      PT+FHYLA IV+K+ + PD +  D+R++ K LF    +   +  K++Q 
Sbjct: 270 SEDEDDADLLEPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQD 329

Query: 217 RFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAF--LENDAQLRELLEYDELPQ--D 272
           RFV+ LLFYYK      R E+F++ L  H      A   L  D  L    +    P   D
Sbjct: 330 RFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAAD 389

Query: 273 SYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDK 310
             S+E  L  +E   G+ GA++   ++ +YYVLG+ DK
Sbjct: 390 GASVEDALLSIEHRCGV-GAIA--LADPRYYVLGILDK 424

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  111 bits (277), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 111/222 (50%), Gaps = 19/222 (8%)

Query: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNXXXXX 159
            + L +R +LD +S W  +S KI  D  FY + DD  R+ LFE+WC +  A E +     
Sbjct: 222 FFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESD----- 276

Query: 160 XXXXXXXXXXPTRFHYLAHIVSKS-TVRPDTVYSDVRREHKELFDQLEVD--ILDKKEQR 216
                     PT++HYLA IV+K+  + PD +  D+R+  K L+    +   +  K+EQ 
Sbjct: 277 -SEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQD 335

Query: 217 RFVAGLLFYYKKMDAALRGEVFRKLLHAHR---AAITAAFLENDAQLRELLEYDELPQDS 273
           RFV+ LLFYYK  +   R  +F+  L  H        A+  +++  +       E P D 
Sbjct: 336 RFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDG 395

Query: 274 YSIETDLFIVEK--CIGLHGALSKLQSEIKYYVLGVKDKLVV 313
            SIE  L  +E   C+      + + ++ +YYV+G+ +K VV
Sbjct: 396 TSIEDVLLSIENRCCVS-----AIVVADPRYYVVGILEKTVV 432

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 107/223 (47%), Gaps = 17/223 (7%)

Query: 97  KAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNXX 156
           K  L+ LFE   LD YS W  +S KIS  A ++ V DD  R+E+FE WCA K+A      
Sbjct: 187 KDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVA----QL 242

Query: 157 XXXXXXXXXXXXXPTRFHYLAHIVS--KSTVRPDTVYSDVRREHKELFDQLEVD--ILDK 212
                        PT++HYL+ I+   +  +  DTV  D+ R H+ LF Q  +   I D+
Sbjct: 243 PEDESEAEDDDYEPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPDR 302

Query: 213 KEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQD 272
           +E R  V+ LLFYYK+  A  R  VF   +      +    ++ND         D     
Sbjct: 303 RELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLLPGEDVDND---------DAGSLS 353

Query: 273 SYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMK 315
              +ET +   E+     G  S   + ++YYV+G+++K + ++
Sbjct: 354 GEQMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLR 396

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score = 85.5 bits (210), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 111/227 (48%), Gaps = 23/227 (10%)

Query: 97  KAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNXX 156
           K   +ALF + EL+ YS W  ES K+S D  FY + DD  R+ +FE+WC     +     
Sbjct: 205 KDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESN--- 261

Query: 157 XXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVDILDKKEQR 216
                        PT++HYL+ +V+   ++PDT+  D+ ++ K +      D   K EQR
Sbjct: 262 -EESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPEDIIKDKKLIKKYRIKDYTTKSEQR 320

Query: 217 RFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQDSYSI 276
           +F++ +L +YK M    R ++F+  +   R  +   + + D+  +E             +
Sbjct: 321 QFLSKMLAWYKHMSLEDRKQMFQTYI--DRIPV-GKYTDIDSDAQE------------DV 365

Query: 277 ETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVLREMLS 323
           E+ L  +E  +G+  +    +++++YY + ++ K  ++   +R  ++
Sbjct: 366 ESQLLELENQLGIPTS----ENDLEYYCIDLRSKRDILLSTIRNRVN 408

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 81.6 bits (200), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 83/170 (48%), Gaps = 10/170 (5%)

Query: 87  DRGNDETDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCA 146
           D   DE   K+ + + L +R+ +D YS W  E+ KIS D  FY +  D  R++LFEQWC 
Sbjct: 62  DASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCY 121

Query: 147 RKIADEGNXXXXXXXXXXXXXXXPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLE 206
            K+    +               P  +H LA ++    ++ +T+Y D+R+ +K++  Q++
Sbjct: 122 GKL----HSREEETTQPQLALALP--YHDLAEMICCFDIQSNTIYKDIRKANKKMVRQID 175

Query: 207 VDILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAH---RAAITAAF 253
             I  K EQ +F   LL   K  D A    +F ++L  +   R  +  +F
Sbjct: 176 EKI-SKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSF 224

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 86/198 (43%), Gaps = 27/198 (13%)

Query: 75  SDLGGGAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFESAKI-SGDAAFYAVGD 133
           ++L     +   D  N      K   + L ++ +LD YS W  +S +I      FY++ +
Sbjct: 234 NNLTSKGGEEGEDNINASVQKVKQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISN 293

Query: 134 DEARQELFEQWCARKIADEG----------------------NXXXXXXXXXXXXXXXPT 171
           D  R+E+FE WC  ++   G                                      PT
Sbjct: 294 DSEREEIFEDWCRNRVHSTGLYSSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPT 353

Query: 172 RFHYLAHIVSK--STVRPDTVYSDVRREHKELFDQLEVD--ILDKKEQRRFVAGLLFYYK 227
           ++HYL+ ++ K   ++   +++ D++R+ K LF    +   I DKKE  + V+ LLFYYK
Sbjct: 354 KYHYLSELIFKLRDSINERSIFQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYK 413

Query: 228 KMDAALRGEVFRKLLHAH 245
           K+    R + F++ +  H
Sbjct: 414 KLSEQERCDKFQEYVTKH 431

>KLTH0C06468g Chr3 (563097..567413) [4317 bp, 1438 aa] {ON} similar to
            uniprot|P38181 Saccharomyces cerevisiae YBL079W NUP170
            Abundant subunit of the nuclear pore complex (NPC),
            required for proper localization of specific nucleoporins
            within the NPC, involved in nuclear envelope permeability
            and in chromosome segregation
          Length = 1438

 Score = 30.8 bits (68), Expect = 5.9,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 224  FYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQ-DSYSIETD 279
            FYY   +     +    +       +   + E+D +LR+L+ YDE+    +YSIETD
Sbjct: 1369 FYYLLKNLIETADSVNNIYKKEMTWLIKEWYESDVKLRDLVSYDEIRNLKNYSIETD 1425

>AER397C Chr5 complement(1392748..1397034) [4287 bp, 1428 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YBL079W
            (NUP170) and YER105C (NUP157)
          Length = 1428

 Score = 30.8 bits (68), Expect = 6.7,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 224  FYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQ-DSYSIETD 279
             YY   D     E    +     A +   + ++D +LR+++ YD+L   D YSIETD
Sbjct: 1359 LYYVLKDLIETSESVNTVYKREIAWLIKYWYQSDRKLRDIITYDDLRNLDEYSIETD 1415

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,941,783
Number of extensions: 1057632
Number of successful extensions: 2778
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2784
Number of HSP's successfully gapped: 27
Length of query: 328
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 218
Effective length of database: 40,868,139
Effective search space: 8909254302
Effective search space used: 8909254302
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)