Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR315C3.496ON77773918e-51
Ecym_12333.496ON87711541e-14
Kpol_1017.43.496ON184441364e-11
TPHA0D033003.496ON196411356e-11
Suva_16.4793.496ON212681313e-10
YPR151C (SUE1)3.496ON206721305e-10
KNAG0A079603.496ON177641286e-10
KAFR0G037103.496ON79451219e-10
Smik_16.4033.496ON203411271e-09
ZYRO0D09812g3.496ON185441251e-09
Skud_16.4453.496ON215411252e-09
KLTH0F14938g3.496ON229671234e-09
Kwal_55.212483.496ON222421218e-09
SAKL0F02618g3.496ON253391229e-09
TDEL0D056403.496ON124431171e-08
TBLA0D029403.496ON71411131e-08
NCAS0F035703.496ON230651157e-08
NDAI0B058903.496ON278451094e-07
KLLA0E03983g3.496ON191451078e-07
CAGL0L08426g3.496ON14043996e-06
Kpol_1066.443.62ON47928876e-04
AAL087C8.682ON18936830.002
KNAG0J017608.682ON25836800.004
YPL159C (PET20)8.682ON25330800.005
Skud_16.1238.682ON25530790.007
Smik_6.3568.682ON25330790.007
Suva_16.1518.682ON25330780.008
TBLA0B085103.62ON50143770.011
TDEL0E007103.62ON47628760.018
TPHA0G015708.682ON25536750.021
KAFR0H023808.682ON22061750.024
SAKL0H06380g8.682ON21930740.030
Ecym_35273.62ON48730730.047
KLLA0D06061g8.682ON24930710.070
Ecym_23908.682ON22731700.11
KLTH0D11396g8.682ON22540690.13
ZYRO0F07480g8.682ON23670690.17
TDEL0A062708.682ON24230680.19
Kwal_26.88288.682ON22331680.20
NDAI0A061103.62ON49028680.20
KNAG0K023503.62ON49128660.36
Kpol_1072.128.682ON22231660.37
KLLA0F12452g8.157ON143351660.45
Suva_14.443.62ON52528660.46
Kpol_1013.98.682ON26130650.51
KLTH0A01364g3.62ON47628640.77
KLLA0A07447g3.62ON48628640.81
Skud_14.423.62ON52428630.97
Smik_14.363.62ON52468631.1
Kwal_23.52773.62ON47028621.5
NCAS0A099403.62ON49448611.7
Smik_7.1486.127ON64454611.7
ZYRO0C02244g3.62ON46028602.3
SAKL0C12342g3.62ON55228593.3
TBLA0B038008.682ON32431593.4
YNL264C (PDR17)1.91ON35067584.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR315C
         (77 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...   155   8e-51
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    64   1e-14
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...    57   4e-11
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...    57   6e-11
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...    55   3e-10
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...    55   5e-10
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...    54   6e-10
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    51   9e-10
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...    54   1e-09
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...    53   1e-09
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...    53   2e-09
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...    52   4e-09
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...    51   8e-09
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...    52   9e-09
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    50   1e-08
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    48   1e-08
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    49   7e-08
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...    47   4e-07
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...    46   8e-07
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    43   6e-06
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    38   6e-04
AAL087C Chr1 complement(190118..190687) [570 bp, 189 aa] {ON} Sy...    37   0.002
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    35   0.004
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    35   0.005
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    35   0.007
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    35   0.007
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    35   0.008
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    34   0.011
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    34   0.018
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    33   0.021
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    33   0.024
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    33   0.030
Ecym_3527 Chr3 (1001629..1003092) [1464 bp, 487 aa] {ON} similar...    33   0.047
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    32   0.070
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    32   0.11 
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    31   0.13 
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    31   0.17 
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    31   0.19 
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    31   0.20 
NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa] ...    31   0.20 
KNAG0K02350 Chr11 complement(468252..469727) [1476 bp, 491 aa] {...    30   0.36 
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    30   0.37 
KLLA0F12452g Chr6 complement(1152209..1156510) [4302 bp, 1433 aa...    30   0.45 
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    30   0.46 
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    30   0.51 
KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly...    29   0.77 
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    29   0.81 
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    29   0.97 
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    29   1.1  
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    28   1.5  
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    28   1.7  
Smik_7.148 Chr7 complement(268831..270765) [1935 bp, 644 aa] {ON...    28   1.7  
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    28   2.3  
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    27   3.3  
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    27   3.4  
YNL264C Chr14 complement(145563..146615) [1053 bp, 350 aa] {ON} ...    27   4.7  

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score =  155 bits (391), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%)

Query: 1  MSRQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPA 60
          MSRQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPA
Sbjct: 1  MSRQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPA 60

Query: 61 ESTKRDDGSRGNTSARG 77
          ESTKRDDGSRGNTSARG
Sbjct: 61 ESTKRDDGSRGNTSARG 77

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 63.9 bits (154), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%)

Query: 5  QFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTK 64
          +  R LPRVP+TQ+L  +++R DI FS +RP+ YPV QNPL R    +L           
Sbjct: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILESSIGKGLGRD 67

Query: 65 RDDGSRGNTSA 75
          +D G+ GN  +
Sbjct: 68 KDKGNAGNGCS 78

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
          (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score = 57.0 bits (136), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 32/44 (72%)

Query: 4  QQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47
          +  FR LPRVP+TQ L +  +  DILFS +RP+TYPV +NPL R
Sbjct: 33 EHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFR 76

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
          Anc_3.496 YPR151C
          Length = 196

 Score = 56.6 bits (135), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 33/41 (80%)

Query: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47
          F+ LPRVP+T++L + K+  DILFS +RP+TYPV +NPL R
Sbjct: 51 FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFR 91

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score = 55.1 bits (131), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 5/68 (7%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR--RRPALLSFLAD---PAE 61
           FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R  ++ +L   LA    PA 
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121

Query: 62  STKRDDGS 69
             K  + S
Sbjct: 122 EAKATEKS 129

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score = 54.7 bits (130), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 6/72 (8%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR--RRPALLSFLA----DPA 60
           FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R  +R +L + L       A
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114

Query: 61  ESTKRDDGSRGN 72
           E+   D+    N
Sbjct: 115 EAKTIDEKKHKN 126

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa]
          {ON} Anc_3.496 YPR151C
          Length = 177

 Score = 53.9 bits (128), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 6  FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTKR 65
           FR LP+VP T++L   ++  DIL+S +RP+ YPV +NPL R    L++ ++ P   T+ 
Sbjct: 31 MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMA-ISHPEHDTEG 89

Query: 66 DDGS 69
           +G+
Sbjct: 90 TEGT 93

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 51.2 bits (121), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 35/45 (77%)

Query: 10 LPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLS 54
          LPRVP+T++L   K+++DIL++ +RP+ YP+ +NPL+ R+   L+
Sbjct: 11 LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELA 55

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa]
          {ON} YPR151C (REAL)
          Length = 203

 Score = 53.5 bits (127), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47
          FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R
Sbjct: 53 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR 93

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 185

 Score = 52.8 bits (125), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (72%)

Query: 6  FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRR 49
           FR +PRVP+TQ L + ++  DILFS +RP+ YPV +NPL + R
Sbjct: 24 IFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKER 67

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score = 52.8 bits (125), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47
           FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR 102

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
          {ON} weakly similar to uniprot|Q06524 Saccharomyces
          cerevisiae YPR151C SUE1 Mitochondrial protein required
          for degradation of unstable forms of cytochrome c
          Length = 229

 Score = 52.0 bits (123), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 10/67 (14%)

Query: 5  QFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTK 64
          + FR LP+VP+TQ+L   ++  DIL+S +RP+ YPV +NPL +          +    T+
Sbjct: 21 EIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFK----------EAGWKTQ 70

Query: 65 RDDGSRG 71
          R  G RG
Sbjct: 71 RLRGERG 77

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa]
          {ON} YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score = 51.2 bits (121), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 6  FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47
           FR LP+VP+TQ+L   ++  DIL+S +RP+ YPV +NPL +
Sbjct: 22 IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFK 63

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
          Mitochondrial protein required for degradation of
          unstable forms of cytochrome c
          Length = 253

 Score = 51.6 bits (122), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 30/39 (76%)

Query: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPL 45
          FR+LP+VP+TQ L   ++  DILFS +RP+TYPV +NP 
Sbjct: 23 FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPF 61

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa]
          {ON} Anc_3.496 YPR151C
          Length = 124

 Score = 49.7 bits (117), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (69%)

Query: 6  FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRR 48
           FR LPRVP+T+ L   ++  DILFS +RP+ YPV +NPL  R
Sbjct: 30 LFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGR 72

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 48.1 bits (113), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (70%)

Query: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47
           R LPRVP+T++L   ++  DI FS +RP+ YPV +NPL R
Sbjct: 16 LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 48.9 bits (115), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 6   FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTKR 65
            FR LP+VP T++L   ++  +ILF+ ++P+ YPV +NPL +        L    E  KR
Sbjct: 117 IFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK--------LKIKQEDAKR 168

Query: 66  DDGSR 70
           ++G+ 
Sbjct: 169 ENGNE 173

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score = 46.6 bits (109), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (68%)

Query: 3   RQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47
           +   FR +P+VP T++L   ++  D+L+S +RP+ YPV +NPL R
Sbjct: 125 QNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFR 169

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 191

 Score = 45.8 bits (107), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (66%)

Query: 5  QFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRR 49
          Q +R LPRVP+T+ L   ++  DILFS +RP+  P+  NPL + +
Sbjct: 10 QMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAK 54

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 42.7 bits (99), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 30/43 (69%)

Query: 4  QQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLI 46
           + FR LP+VP T++L    +  D+L++ +RP+ YP+ +NPL+
Sbjct: 5  NEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLL 47

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 38.1 bits (87), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 24/28 (85%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           +LPRVPST+++P ++V+ D LF+ +RPL
Sbjct: 73  ILPRVPSTENIPVEEVQTDGLFAGYRPL 100

>AAL087C Chr1 complement(190118..190687) [570 bp, 189 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL159C
          Length = 189

 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 2   SRQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLT 37
           +R++ +   P  PSTQHL  + + L  LFSR RP+T
Sbjct: 80  ARKRDYSWFPVAPSTQHLTNEDIALSNLFSRQRPIT 115

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 35.4 bits (80), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 27/36 (75%), Gaps = 1/36 (2%)

Query: 2   SRQQF-FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           +R+++ +  LP VPSTQH+ A+ +  ++L+S +RPL
Sbjct: 87  TRKKYRYHPLPSVPSTQHIEANDMCTELLYSGYRPL 122

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 35.4 bits (80), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           F  LPRVPST HL    +  ++L+S +RPL
Sbjct: 100 FSWLPRVPSTSHLKQSDMTTNVLYSGYRPL 129

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 35.0 bits (79), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           F  LPRVPST HL    +  ++L+S +RPL
Sbjct: 100 FSWLPRVPSTSHLKHTDMTTNVLYSGYRPL 129

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 35.0 bits (79), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           F  LP+VPST HL    +  ++L+S +RPL
Sbjct: 100 FSWLPKVPSTSHLKQSDMTTNVLYSGYRPL 129

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 34.7 bits (78), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           F  LPRVPST HL    +  ++L+S +RP+
Sbjct: 100 FSWLPRVPSTSHLKHSDMTTNVLYSGYRPI 129

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 34.3 bits (77), Expect = 0.011,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 31/43 (72%), Gaps = 2/43 (4%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPA 51
           ++PRV ST+ +P+ +V++D LF+ +RPL   + ++ + RRR A
Sbjct: 89  LVPRVASTEDIPSHEVQVDGLFAGYRPLF--LGESSIKRRRKA 129

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 33.9 bits (76), Expect = 0.018,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 22/28 (78%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           +LPRVPST ++P  +V+ + LF+ +RPL
Sbjct: 74  LLPRVPSTDYIPNTEVQTEGLFAGYRPL 101

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 33.5 bits (75), Expect = 0.021,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 23/36 (63%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQ 42
           +  LP+ P+T HL + +   D+ +S +RPL+  V+Q
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQ 138

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 33.5 bits (75), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 3   RQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAES 62
           R+  +  LPRVPST ++   ++  ++LFS +RPL+  +  +        +  FL  P +S
Sbjct: 84  RRYKYSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSDS-----STMYEFLMAPDQS 138

Query: 63  T 63
           T
Sbjct: 139 T 139

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 33.1 bits (74), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           +  LP+ PST+HL   ++  D+ +S +RP+
Sbjct: 80  YSWLPKAPSTEHLKLREISTDVFYSGYRPI 109

>Ecym_3527 Chr3 (1001629..1003092) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii AEL203W
          Length = 487

 Score = 32.7 bits (73), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 22/30 (73%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           + ++P V ST H+P +++  + LF+R+RPL
Sbjct: 91  YLLVPTVASTDHVPLEEIATEELFARYRPL 120

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 32.0 bits (71), Expect = 0.070,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 22/30 (73%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           +  LPRVP+T+H+  ++   D+L+S +RP+
Sbjct: 109 YSWLPRVPTTEHILREEFNSDMLYSGYRPI 138

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 31.6 bits (70), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLT 37
           +   P  P T+HL    + +D+L+S +RPL+
Sbjct: 86  YSWFPVAPKTEHLKEGDIAVDLLYSGYRPLS 116

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 31.2 bits (69), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 3   RQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQ 42
           R+  F  LP+ PST HL    V   +L+S +RP     S+
Sbjct: 78  RKTDFSWLPKAPSTDHLKHRDVSTTLLYSGYRPFVLNSSE 117

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 31.2 bits (69), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 29/70 (41%), Gaps = 19/70 (27%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTKRD 66
           +  LPRVPST +L    +   IL+S +RPL                  FL +P E     
Sbjct: 85  YSWLPRVPSTNYLRPRDMSSKILYSGYRPL------------------FL-NPDELKTSQ 125

Query: 67  DGSRGNTSAR 76
           DG   N  AR
Sbjct: 126 DGGNANNGAR 135

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 30.8 bits (68), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           +  LPRVPST +L    + + +L+S +RPL
Sbjct: 93  YSWLPRVPSTGNLKPRDMSMKVLYSGYRPL 122

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 30.8 bits (68), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLT 37
           F  LP+ PST HL    V   +L+S +RP  
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFV 112

>NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa]
          {ON} Anc_3.62 YNL295W
          Length = 490

 Score = 30.8 bits (68), Expect = 0.20,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 9  MLPRVPSTQHLPADKVRLDILFSRHRPL 36
          M+PRV  T H+P ++V+ + LF+ ++PL
Sbjct: 66 MVPRVGETDHIPVNEVQTEGLFAGYKPL 93

>KNAG0K02350 Chr11 complement(468252..469727) [1476 bp, 491 aa] {ON}
           Anc_3.62 YNL295W
          Length = 491

 Score = 30.0 bits (66), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           ++PRV  T H+ AD +  + LF+ +RPL
Sbjct: 119 IVPRVQPTDHIGADTIHTEGLFAGYRPL 146

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 30.0 bits (66), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLT 37
           +  LP+VPS + L    +  DI +S  RPL+
Sbjct: 94  YSWLPKVPSNKRLTHQDITTDIFYSGFRPLS 124

>KLLA0F12452g Chr6 complement(1152209..1156510) [4302 bp, 1433 aa]
           {ON} some similarities with uniprot|P53094 Saccharomyces
           cerevisiae YGL197W MDS3 Protein with an N-terminal
           kelch- like domain putative negative regulator of early
           meiotic gene expression required with Pmd1p for growth
           under alkaline conditions
          Length = 1433

 Score = 30.0 bits (66), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 20  PADKVRLDILFSRHRPLTYPV-SQNPLIRRRPALLSFLADPAESTKRDDGS 69
           P  +  LD  FSRHRP    V S  P + R+ A L F   P+ S   +D S
Sbjct: 591 PTSQGSLDTFFSRHRPSAQSVQSSTPPMERKSACL-FFNTPSTSKLTNDNS 640

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 30.0 bits (66), Expect = 0.46,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           ++P+V ST H+P  +V  + LF+ +RPL
Sbjct: 111 LVPKVASTDHIPKKEVNTEGLFAGYRPL 138

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 29.6 bits (65), Expect = 0.51,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPL 36
           +  LP+VPST++L   ++R   L+S +RP+
Sbjct: 109 YSWLPKVPSTENLNHREIRTSALYSGYRPI 138

>KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 476

 Score = 29.3 bits (64), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           ++P+V ST H+  D++  + LF+ ++PL
Sbjct: 85  LVPKVHSTDHIKQDEIHTEGLFAGNKPL 112

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 29.3 bits (64), Expect = 0.81,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           ++P+VPST +LP + +  + LF+ ++PL
Sbjct: 89  LVPQVPSTDYLPREDLETEGLFAGYKPL 116

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 28.9 bits (63), Expect = 0.97,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           ++P+V ST+++P  +V  + LF+ +RPL
Sbjct: 110 LVPKVASTEYIPIKEVHTEGLFAGYRPL 137

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 28.9 bits (63), Expect = 1.1,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 31/68 (45%)

Query: 2   SRQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAE 61
           SR     ++P+V ST H+   +V  + LF+ +RPL    S  P   R+      L D   
Sbjct: 103 SRPSLHLLVPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFPSDARKGKNFHELGDVLP 162

Query: 62  STKRDDGS 69
           + +  D S
Sbjct: 163 NIQVIDAS 170

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 28.5 bits (62), Expect = 1.5,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           + P+V ST HL  D+V  + LF+ ++PL
Sbjct: 79  LFPKVHSTDHLKQDEVHTEGLFAGNKPL 106

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 28.1 bits (61), Expect = 1.7,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 30/48 (62%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFL 56
           ++P+VP+T ++P+ +++ + LF+ ++PL       P+ ++ P  L  L
Sbjct: 69  IVPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKKQLPEELKAL 116

>Smik_7.148 Chr7 complement(268831..270765) [1935 bp, 644 aa] {ON}
          YGL124C (REAL)
          Length = 644

 Score = 28.1 bits (61), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 1/54 (1%)

Query: 2  SRQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSF 55
          SR      +P V ST   P   V LD  F +  PL  P+S N  I +  ++ S 
Sbjct: 20 SRSGNLECIPIVASTSE-PTTSVNLDETFFKKAPLAVPISDNRSISKSASINSL 72

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 27.7 bits (60), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 9  MLPRVPSTQHLPADKVRLDILFSRHRPL 36
          ++PRVP T ++ A +++ + LF+ +RPL
Sbjct: 57 VVPRVPPTDYISAPEIQTEGLFAGYRPL 84

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 27.3 bits (59), Expect = 3.3,   Method: Composition-based stats.
 Identities = 9/28 (32%), Positives = 21/28 (75%)

Query: 9   MLPRVPSTQHLPADKVRLDILFSRHRPL 36
           ++P VP+T ++P  +++ + LF+ ++PL
Sbjct: 160 LVPHVPNTDYIPHSEIQTEGLFAGYKPL 187

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 27.3 bits (59), Expect = 3.4,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLT 37
           +  LP+VP+ ++L    V  ++L+S +RPL+
Sbjct: 164 YSWLPKVPTLKNLKQRDVMTNVLYSGYRPLS 194

>YNL264C Chr14 complement(145563..146615) [1053 bp, 350 aa] {ON}
          PDR17Phosphatidylinositol transfer protein (PITP),
          downregulates Plb1p-mediated turnover of
          phosphatidylcholine, found in the cytosol and
          microsomes, homologous to Pdr16p, deletion affects
          phospholipid composition
          Length = 350

 Score = 26.9 bits (58), Expect = 4.7,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 11 PRVPSTQHLPADKVRLDILFSR-HRPLTYPVSQNPLIRRRPALLSFLAD----PAESTKR 65
          P VP  + +P DK+ LD      + PL  P+S++   + R  L  F  D    P      
Sbjct: 12 PAVPKEKLIPCDKIFLDPPAKYGNAPLLEPISEDQNEKYRAVLRHFQDDDLKLPENLNDL 71

Query: 66 DDGSRGN 72
          D+G+  N
Sbjct: 72 DNGTHAN 78

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,946,547
Number of extensions: 268425
Number of successful extensions: 559
Number of sequences better than 10.0: 59
Number of HSP's gapped: 558
Number of HSP's successfully gapped: 59
Length of query: 77
Length of database: 53,481,399
Length adjustment: 49
Effective length of query: 28
Effective length of database: 47,862,765
Effective search space: 1340157420
Effective search space used: 1340157420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)