Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR314W3.495ON1551558261e-115
Ecym_12343.495ON1611505926e-79
KLLA0E04027g3.495ON1581533572e-43
NDAI0G009103.495ON1631623531e-42
TDEL0D056303.495ON1501533423e-41
Smik_6.2293.495ON1651613322e-39
YGR133W (PEX4)3.495ON1831613307e-39
Kpol_480.133.495ON1571533287e-39
TBLA0C045003.495ON1651613288e-39
Suva_7.4213.495ON1651613271e-38
Skud_7.4443.495ON1621613243e-38
TPHA0D042603.495ON1581523218e-38
ZYRO0D09878g3.495ON1531533182e-37
KNAG0B007803.495ON1531553172e-37
NCAS0E007803.495ON1711693165e-37
SAKL0F02706g3.495ON1611563157e-37
KLTH0F14894g3.495ON1661523114e-36
KAFR0C019903.495ON1511563042e-35
Kwal_55.212463.495ON1601523026e-35
CAGL0I10450g3.495ON1621682957e-34
Suva_2.2183.308ON1481452591e-28
Skud_4.3143.308ON1481452591e-28
YDR059C (UBC5)3.308ON1481452591e-28
Smik_4.2973.308ON1481452572e-28
Suva_4.3263.308ON1481442531e-27
Ecym_74313.308ON1471452521e-27
KLTH0E14300g3.308ON1471452521e-27
SAKL0B06512g3.308ON1471452521e-27
AER173C3.308ON1471452521e-27
CAGL0E04752g3.308ON1471442512e-27
Kpol_1052.23.308ON1481452512e-27
KLLA0E12563g3.308ON1481452512e-27
Skud_2.2073.308ON1481442503e-27
Smik_2.2193.308ON1481442503e-27
YBR082C (UBC4)3.308ON1481442503e-27
TDEL0F021003.308ON1471452469e-27
TPHA0A038503.308ON1481452461e-26
ZYRO0G12870g3.308ON1471432451e-26
NCAS0A108003.308ON1481442442e-26
NDAI0A054903.308ON1471442442e-26
TBLA0I021303.308ON1481452442e-26
KAFR0C002703.308ON1471412443e-26
ADR169C8.375ON2111422432e-25
KNAG0J023403.308ON1611262392e-25
Kwal_27.124013.308ON2361272424e-25
Smik_15.5177.54ON1561352331e-24
NDAI0A011608.375ON2161422362e-24
CAGL0E00671g8.375ON2131422353e-24
Suva_8.3897.54ON1561392295e-24
Ecym_60388.375ON2111422326e-24
KLLA0C18656g8.375ON2281502321e-23
TDEL0B065702.569ON1651532271e-23
CAGL0M07568g2.569ON1651562252e-23
Skud_4.4418.375ON2151412292e-23
Suva_2.3438.375ON2151412292e-23
Smik_4.4258.375ON2151412292e-23
YDR177W (UBC1)8.375ON2151412292e-23
SAKL0A00396g8.375ON2151422292e-23
ZYRO0C03784g8.375ON2181412283e-23
ABR059W2.569ON1651572244e-23
Kpol_1065.127.54ON1591292234e-23
Skud_15.5047.54ON1561392226e-23
Kpol_1030.108.375ON2151412241e-22
KLTH0A07546g8.375ON2151512232e-22
TBLA0H031308.375ON2141412222e-22
KNAG0A048108.375ON2141412213e-22
NDAI0B015202.569ON1651532183e-22
Kwal_23.64858.375ON2151512213e-22
KAFR0A021602.569ON1651602166e-22
TPHA0L008508.375ON2161422197e-22
NCAS0B031508.375ON2141422188e-22
TBLA0F024406.109ON1741402159e-22
TDEL0F049908.375ON2171412171e-21
NCAS0A127402.569ON1651562122e-21
ZYRO0E06358g2.569ON1651532123e-21
Smik_13.1862.569ON1651602104e-21
YOR339C (UBC11)7.54ON1561352104e-21
KAFR0B060608.375ON2131422134e-21
Ecym_45782.569ON1651522104e-21
Skud_13.1762.569ON1651602104e-21
CAGL0I00352g6.109ON1671402105e-21
Kpol_461.86.109ON1671402105e-21
ZYRO0C04950g6.109ON1681402105e-21
Suva_13.1892.569ON1651602096e-21
Smik_7.2226.109ON1711402096e-21
TDEL0G036106.109ON1691402096e-21
Suva_7.2136.109ON1731402096e-21
KLLA0C05632g6.109ON1641402096e-21
SAKL0A07260g6.109ON1691402097e-21
YMR022W (UBC7)2.569ON1651602097e-21
AAR156C6.109ON1701402097e-21
Ecym_30776.109ON1701402097e-21
YGL058W (RAD6)6.109ON1721402098e-21
TPHA0J017506.109ON1691402081e-20
NCAS0D032206.109ON1711402071e-20
TPHA0I024602.569ON1671602071e-20
YDL064W (UBC9)4.249ON1571482062e-20
TDEL0H039707.54ON1561372042e-20
SAKL0D13552g2.569ON1651522044e-20
Smik_4.1714.249ON1571482034e-20
Kwal_26.82242.569ON1651562035e-20
KLTH0D07986g2.569ON1651532036e-20
ZYRO0D04466g7.54ON1591372026e-20
KNAG0M021502.569ON1701532027e-20
KAFR0H012303.308ON1101041987e-20
Skud_7.2226.109ON1701402027e-20
KLLA0E07745g2.569ON1651602019e-20
Suva_4.1864.249ON1571482001e-19
Kpol_1056.52.569ON1651531992e-19
KLTH0H06732g6.109ON1601401974e-19
NDAI0E038707.54ON1641371974e-19
TBLA0H026102.569ON1651571965e-19
Skud_4.1914.249ON1571481922e-18
TPHA0O009201.436ON2261131962e-18
CAGL0M03399g1.436ON2141131952e-18
KAFR0H029601.436ON1871131915e-18
Kwal_14.18286.109ON1521051887e-18
NCAS0G031301.436ON2311131911e-17
NDAI0I016506.109ON1761401881e-17
KNAG0H018701.436ON2101131891e-17
YEL012W (UBC8)1.436ON2181131901e-17
Ecym_32704.249ON1571481861e-17
KAFR0A047006.109ON1531051861e-17
KNAG0F025706.109ON1511051851e-17
ZYRO0B12386g4.249ON1571481861e-17
Kwal_34.161741.436ON2131121892e-17
CAGL0D00814g4.249ON1571481852e-17
Smik_5.981.436ON2151131882e-17
TDEL0B056701.436ON2031131872e-17
Suva_5.531.436ON2151131882e-17
KNAG0D043904.249ON1571481842e-17
KLLA0A11198g1.436ON2021131863e-17
TPHA0B007704.249ON1571541834e-17
NDAI0D011401.436ON2451131875e-17
ZYRO0E03806g1.436ON2091131855e-17
Kpol_1030.181.436ON2231131856e-17
TBLA0A012901.436ON2191131848e-17
TBLA0I029604.249ON1571481818e-17
Skud_5.871.436ON2101121848e-17
Kwal_26.70097.54ON1611361819e-17
SAKL0H03058g4.249ON1571481801e-16
SAKL0D10560g1.436ON2071131821e-16
SAKL0B10582g7.54ON1611361801e-16
KAFR0G032404.249ON1571481782e-16
AER056C4.249ON1571481782e-16
KLTH0H13816g1.436ON2331131813e-16
Kpol_483.164.249ON1221191743e-16
KLTH0D01760g7.54ON1611291773e-16
KLTH0D14344g4.249ON1571481755e-16
NDAI0D043804.249ON1571481748e-16
AEL045W1.436ON2111041752e-15
TDEL0E012204.249ON1571481712e-15
Kpol_1075.1b8.230ON1521101694e-15
NCAS0A024904.249ON1571481685e-15
Ecym_13481.436ON2111131707e-15
CAGL0G08063g8.230ON1491071678e-15
KLLA0E05039g4.249ON1571491652e-14
SAKL0H17930g8.230ON1531011652e-14
KNAG0H029808.230ON1521101652e-14
AGR121C8.230ON1541001642e-14
ZYRO0B11682g8.230ON1511301642e-14
Kwal_23.42274.249ON1221141614e-14
Ecym_55638.230ON1641081634e-14
YDR092W (UBC13)8.230ON1531011624e-14
Suva_2.2538.230ON1431011614e-14
Skud_4.3528.230ON1431011614e-14
TDEL0A013408.230ON1571051625e-14
Smik_4.3358.230ON1431011615e-14
Kwal_56.234828.230ON1491401616e-14
KAFR0A024208.230ON1471011591e-13
KLTH0G14366g8.230ON1491081581e-13
KLLA0C17622g8.230ON159991582e-13
TPHA0B034108.230ON1521011572e-13
KLLA0C17248g4.49ON1841091583e-13
NDAI0J015408.230ON1541101563e-13
NCAS0B040108.230ON1531081554e-13
TBLA0F037908.230ON151991539e-13
Smik_4.2903.301ON2971631431e-10
Skud_4.3063.301ON2971631431e-10
KNAG0J022803.301ON2171551411e-10
NDAI0A055303.301ON2731211422e-10
YDR054C (CDC34)3.301ON2951631422e-10
NCAS0A059404.49ON193941392e-10
Suva_10.4014.49ON187931392e-10
Suva_2.2113.301ON2971631412e-10
NDAI0A075703.301ON2391631393e-10
Smik_12.3894.49ON1871031364e-10
Kwal_27.104443.301ON2781501394e-10
NCAS0A107703.301ON2731631385e-10
NDAI0D029104.49ON1891081356e-10
TDEL0D032603.301ON2891631378e-10
KLTH0C04818g3.301ON2751631361e-09
SAKL0D02530g3.301ON2721631361e-09
ZYRO0G12650g3.301ON2851431361e-09
KNAG0H010403.301ON2961431361e-09
Skud_12.3894.49ON187971331e-09
AGL203C3.301ON2701631361e-09
KLLA0D09196g3.301ON2921631361e-09
Kpol_1065.453.301ON3231631352e-09
Ecym_26693.301ON2681631352e-09
CAGL0D06468g4.49ON1871021322e-09
TBLA0G032703.301ON3301501352e-09
CAGL0E04598g3.301ON2951381333e-09
TBLA0E015704.49ON1941071313e-09
KAFR0H012703.301ON2871631333e-09
NCAS0I014303.301ON2581501315e-09
TPHA0M012803.301ON4351511316e-09
TPHA0F003904.49ON1931031288e-09
YLR306W (UBC12)4.49ON188851278e-09
KNAG0I029404.49ON197941233e-08
ZYRO0G19910g4.49ON179991224e-08
SAKL0H24112g4.49ON1851111181e-07
ADL035C4.49ON200861182e-07
KAFR0F030404.49ON169861153e-07
TDEL0E055604.49ON1871241154e-07
KLTH0H09504g4.49ON184841155e-07
Kpol_414.2singletonOFF1921091147e-07
Kpol_YGOB_414.24.49ON1931091147e-07
Ecym_83714.49ON267971042e-05
CAGL0H03157g6.187ON139120994e-05
YGL087C (MMS2)6.187ON137119985e-05
Suva_7.1826.187ON137119986e-05
KLLA0E19119g6.187ON139119890.001
Smik_7.1966.187ON10088870.001
Smik_5.2467.392ON250155880.003
CAGL0I05478g7.392ON246120880.003
YER100W (UBC6)7.392ON250120870.003
Skud_5.2257.392ON250155860.005
KLLA0E20395g7.392ON251119850.007
TDEL0G015806.187ON138120820.009
TBLA0D006007.392ON256119820.016
TPHA0J022506.187ON137118800.017
KLTH0H04796g6.187ON13894800.017
Ecym_46837.392ON243120820.017
Ecym_22306.187ON13899790.023
NDAI0A016507.392ON251120810.023
Skud_7.1956.187ON10088770.026
Suva_5.2197.392ON249120800.028
Kwal_27.111826.187ON10186770.032
ZYRO0G08228g6.187ON138120780.037
NDAI0E041707.392ON257155780.053
KAFR0C021406.187ON13894760.055
NCAS0A143907.392ON240120780.060
SAKL0A05192g6.187ON14091760.068
KLTH0C06688g7.392ON246119770.074
KAFR0L017507.392ON251121770.083
AFL064W6.187ON13888750.097
NCAS0E026007.392ON255158750.13
Kpol_1002.656.187ON10154720.13
KNAG0F021306.187ON138120730.16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR314W
         (155 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   322   e-115
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   232   6e-79
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   142   2e-43
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   140   1e-42
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   136   3e-41
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   132   2e-39
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   131   7e-39
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   130   7e-39
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   130   8e-39
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   130   1e-38
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   129   3e-38
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   128   8e-38
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   127   2e-37
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   126   2e-37
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   126   5e-37
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   125   7e-37
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   124   4e-36
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   121   2e-35
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   120   6e-35
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   118   7e-34
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...   104   1e-28
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...   104   1e-28
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...   104   1e-28
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...   103   2e-28
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...   102   1e-27
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...   101   1e-27
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...   101   1e-27
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...   101   1e-27
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...   101   1e-27
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...   101   2e-27
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...   101   2e-27
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...   101   2e-27
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...   100   3e-27
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...   100   3e-27
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...   100   3e-27
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    99   9e-27
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    99   1e-26
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    99   1e-26
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    99   2e-26
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    99   2e-26
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    99   2e-26
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    99   3e-26
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    98   2e-25
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    97   2e-25
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    98   4e-25
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    94   1e-24
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      96   2e-24
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    95   3e-24
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    93   5e-24
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    94   6e-24
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    94   1e-23
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    92   1e-23
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    91   2e-23
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    93   2e-23
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    93   2e-23
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    93   2e-23
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    93   2e-23
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    93   2e-23
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    92   3e-23
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    91   4e-23
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    91   4e-23
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    90   6e-23
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    91   1e-22
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    91   2e-22
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    90   2e-22
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    90   3e-22
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    89   3e-22
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    90   3e-22
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    88   6e-22
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    89   7e-22
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      89   8e-22
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    87   9e-22
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    88   1e-21
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    86   2e-21
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    86   3e-21
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    86   4e-21
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    86   4e-21
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    87   4e-21
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    86   4e-21
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    86   4e-21
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    86   5e-21
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    86   5e-21
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    86   5e-21
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    85   6e-21
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    85   6e-21
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    85   6e-21
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    85   6e-21
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    85   6e-21
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    85   7e-21
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    85   7e-21
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    85   7e-21
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    85   7e-21
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    85   8e-21
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    85   1e-20
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      84   1e-20
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    84   1e-20
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    84   2e-20
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    83   2e-20
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    83   4e-20
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    83   4e-20
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    83   5e-20
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    83   6e-20
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    82   6e-20
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    82   7e-20
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    81   7e-20
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    82   7e-20
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    82   9e-20
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    82   1e-19
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    81   2e-19
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    80   4e-19
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    80   4e-19
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    80   5e-19
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    79   2e-18
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    80   2e-18
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    80   2e-18
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    78   5e-18
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    77   7e-18
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                78   1e-17
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      77   1e-17
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    77   1e-17
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    78   1e-17
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    76   1e-17
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    76   1e-17
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    76   1e-17
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    76   1e-17
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    77   2e-17
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    76   2e-17
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    77   2e-17
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    77   2e-17
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    77   2e-17
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    75   2e-17
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    76   3e-17
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    75   4e-17
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    77   5e-17
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    76   5e-17
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    76   6e-17
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    75   8e-17
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    74   8e-17
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    75   8e-17
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    74   9e-17
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    74   1e-16
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    75   1e-16
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    74   1e-16
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    73   2e-16
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    73   2e-16
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    74   3e-16
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    72   3e-16
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    73   3e-16
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    72   5e-16
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    72   8e-16
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    72   2e-15
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    70   2e-15
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    70   4e-15
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    69   5e-15
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    70   7e-15
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    69   8e-15
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    68   2e-14
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    68   2e-14
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    68   2e-14
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    68   2e-14
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    68   2e-14
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    67   4e-14
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    67   4e-14
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    67   4e-14
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    67   4e-14
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    67   4e-14
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    67   5e-14
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    67   5e-14
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    67   6e-14
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    66   1e-13
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    65   1e-13
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    65   2e-13
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    65   2e-13
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    65   3e-13
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    65   3e-13
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    64   4e-13
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    64   9e-13
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    60   1e-10
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    60   1e-10
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    59   1e-10
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    59   2e-10
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    59   2e-10
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     58   2e-10
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    58   2e-10
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    59   2e-10
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    58   3e-10
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    57   4e-10
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    58   4e-10
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    58   5e-10
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       57   6e-10
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    57   8e-10
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    57   1e-09
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    57   1e-09
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    57   1e-09
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                57   1e-09
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    56   1e-09
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    57   1e-09
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    57   1e-09
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    57   2e-09
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    57   2e-09
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    55   2e-09
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    57   2e-09
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    56   3e-09
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    55   3e-09
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                56   3e-09
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                55   5e-09
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    55   6e-09
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    54   8e-09
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    54   8e-09
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    52   3e-08
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    52   4e-08
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    50   1e-07
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    50   2e-07
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    49   3e-07
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    49   4e-07
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    49   5e-07
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    49   7e-07
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    49   7e-07
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    45   2e-05
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    43   4e-05
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    42   5e-05
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    42   6e-05
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    39   0.001
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    38   0.001
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    39   0.003
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    39   0.003
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    38   0.003
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    38   0.005
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    37   0.007
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    36   0.009
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    36   0.016
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    35   0.017
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    35   0.017
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    36   0.017
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    35   0.023
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    36   0.023
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    34   0.026
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    35   0.028
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    34   0.032
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    35   0.037
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    35   0.053
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    34   0.055
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    35   0.060
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    34   0.068
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    34   0.074
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    34   0.083
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    33   0.097
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    33   0.13 
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    32   0.13 
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    33   0.16 
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    33   0.16 
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    33   0.17 
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    33   0.22 
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    32   0.44 
Smik_3.74 Chr3 complement(104188..105348) [1161 bp, 386 aa] {ON}...    32   0.51 
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    31   0.53 
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    31   0.89 
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    31   1.1  
Smik_16.218 Chr16 complement(395725..397194) [1470 bp, 489 aa] {...    31   1.3  
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    30   1.4  
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    30   1.9  
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    30   2.0  
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    30   2.2  
KAFR0B02920 Chr2 complement(600352..615153) [14802 bp, 4933 aa] ...    30   3.2  
Kwal_56.23928 s56 complement(782315..783268) [954 bp, 317 aa] {O...    30   3.3  
CAGL0K08008g Chr11 (794594..797266) [2673 bp, 890 aa] {ON} simil...    30   3.8  
Smik_6.327 Chr6 (516002..517693) [1692 bp, 563 aa] {ON} YPL128C ...    29   4.0  

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  322 bits (826), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV
Sbjct: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP
Sbjct: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQP 155
           GVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQP
Sbjct: 121 GVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQP 155

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  232 bits (592), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 124/150 (82%), Gaps = 1/150 (0%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L EYKQ+++QL  H ++L L P G+  G L +WEA F GPENTPYA FTFTL I +PE
Sbjct: 11  RMLAEYKQIREQLQSHESILMLCPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGV 122
            YPNEPP C FPP+HICHPNIKWSTGEVCLDLLKHE WSP+YNLLQVVEAI TLLAEPGV
Sbjct: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129

Query: 123 DSPLDVDLSRLYTTDRAAYDGVVNYRLRTR 152
           DSPLDVDL++LY+ D+ AY G+V YRL +R
Sbjct: 130 DSPLDVDLAKLYSVDKQAYQGLVTYRLCSR 159

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  142 bits (357), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 99/153 (64%), Gaps = 7/153 (4%)

Query: 1   MRRILREYKQLQKQLAL--HPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58
           M RI++EY  LQK+L       +  LAPV  ++ DL  W   FQGP  +P+ GF   L I
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPV--DDDDLSEWVCRFQGPSESPFEGFELGLNI 58

Query: 59  NVP-ETYP-NEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTL 116
            +  E YP +  P+  F P  + HPN+KW TGE+CLDLLK +AW+P+Y LL VV AI  L
Sbjct: 59  TIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDL 117

Query: 117 LAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           LA+PG+DSPLD+D++++Y  D  AY  +V YRL
Sbjct: 118 LADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  140 bits (353), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 104/162 (64%), Gaps = 11/162 (6%)

Query: 1   MRRILREYKQLQKQL---------ALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAG 51
           M RI++EYK +QKQL           +  ++SLAP+ + + DL +WEA  +GP+ TPY G
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPI-DPDQDLTKWEAVIKGPQGTPYYG 59

Query: 52  FTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVE 111
           F F L I +P+ YP  PP   F P  + H N+ ++TGE+CLD+LK + W+PV+NL+  ++
Sbjct: 60  FNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLK 119

Query: 112 AISTLLAEPGVDSPLDVDLSRLYT-TDRAAYDGVVNYRLRTR 152
           AI  LL +P  +SPL+VDL+ L    D +AY+G++NY L   
Sbjct: 120 AIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLNIN 161

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  136 bits (342), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 70/153 (45%), Positives = 99/153 (64%), Gaps = 5/153 (3%)

Query: 1   MRRILREYKQLQKQLALHPA-VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRIN 59
           M RI REYK +Q  L    + V+SL P+   +GDL RW    +GP  TPY G TF+LR+ 
Sbjct: 1   MARIAREYKHIQATLGSESSLVVSLEPI---DGDLSRWAGEIRGPTGTPYEGHTFSLRLV 57

Query: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119
           + + YP  PP+ +F    + H N+ + TG +CL++L  E WSP ++LL V+EAI  LL++
Sbjct: 58  LGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSD 117

Query: 120 PGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRT 151
           P  DSPLD+DL+  L   DR+AY G+VNY L++
Sbjct: 118 PEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 11/161 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVL--------SLAPVGEENGDLHRWEAHFQGPENTPYAGF 52
           M RI +EY+ + K LA    ++        SL P+ E   DL RWEA   GP +TPY  +
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDE--TDLSRWEAKIYGPSHTPYENY 58

Query: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112
            F + I+VP +YP  PP+ +F  + I H N+K +TGE+CLD+LK E W+PV++LL  V A
Sbjct: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHA 118

Query: 113 ISTLLAEPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRLRTR 152
           +  LL EP  DSPLDVD+  +    D +AY G+V Y L  R
Sbjct: 119 VWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAER 159

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  131 bits (330), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 96/161 (59%), Gaps = 11/161 (6%)

Query: 1   MRRILREYKQLQKQLA--------LHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGF 52
           M RI++EYK + K LA            + SL P+ E   DL +WEA   GP +TPY   
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDE--TDLSKWEAIISGPSDTPYENH 76

Query: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112
            F + I VP +YP  PPK SF  ++I H N+K +TGE+CL++LK E W+PV++LL  V A
Sbjct: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136

Query: 113 ISTLLAEPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRLRTR 152
           +  LL EP  DSPLDVD+  +    D +AY G+V Y L  R
Sbjct: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAER 177

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  130 bits (328), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 102/153 (66%), Gaps = 4/153 (2%)

Query: 2   RRILREYKQLQKQLALHPAVLS-LAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           RR+L+EY+ ++K+L  H  ++S L P+  ++ DL  W A   GP NTPY G +F LRI++
Sbjct: 4   RRLLKEYQVVKKELGNHKNIISSLEPI--DSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
              YP +PP+ +F  + + H NI++ TG++CL++L +  WSPV+NLL VV AI  LL++P
Sbjct: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121

Query: 121 GVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRTR 152
             DSPL++DLS  L   D +AY G++ Y L  +
Sbjct: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNK 154

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  130 bits (328), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 10/161 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M RI++EY  ++K  AL   + +L PV     DL  W +   GP+++PY   +F L I++
Sbjct: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60

Query: 61  PETYPNEPP-----KCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAIST 115
           P  YP+ PP     K S PPH  C  N+ ++TGE+CL++LK+E WSPV+NLL  V+AI  
Sbjct: 61  PTEYPSIPPVIKFNKNSIPPH--C--NVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQ 116

Query: 116 LLAEPGVDSPLDVDLSRLYT-TDRAAYDGVVNYRLRTRPQP 155
           LLA P   SPL++DLSRL T  D  AY+ ++ Y L   P+P
Sbjct: 117 LLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKP 157

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  130 bits (327), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (60%), Gaps = 11/161 (6%)

Query: 1   MRRILREYKQLQKQLA-----LHP---AVLSLAPVGEENGDLHRWEAHFQGPENTPYAGF 52
           M RI +EY+ ++K LA     ++P    + SL P  E   DL +WEA   GPE+TPY  +
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDE--TDLSKWEATICGPEHTPYERY 58

Query: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112
            F + I+VP++YP  PPK  F    I H NI  STGE+CLD+LK + W+PV++LL  V A
Sbjct: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHA 118

Query: 113 ISTLLAEPGVDSPLDVDLSRLYTT-DRAAYDGVVNYRLRTR 152
           +  LL EP  DSPLDVD+  +    D+ AY G+V Y L  R
Sbjct: 119 VWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAER 159

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  129 bits (324), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 95/161 (59%), Gaps = 11/161 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVL--------SLAPVGEENGDLHRWEAHFQGPENTPYAGF 52
           M RI +EY  +QK LA +  ++        SL P+ E   DL +WEA   GP +TPY  +
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDET--DLSKWEAIIIGPTHTPYEHY 58

Query: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112
            F + I+VP +YP  PP   F  ++I H NIK  TGE+CLD+LK E W+PV++LL  V A
Sbjct: 59  RFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHA 118

Query: 113 ISTLLAEPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRLRTR 152
           I  LL EP  DSPLDVD+  +    D  AY G++ Y L  R
Sbjct: 119 IWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  128 bits (321), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 102/152 (67%), Gaps = 4/152 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSL-APVGEENGDLHRWEAHFQGPENTPYAGFTFTLRIN 59
           ++R+L+E + ++K+L+ +   + L  PV  EN    +W A  +GP NTPY   +F L I 
Sbjct: 3   LKRLLKEKRLIEKELSGYSESIELLEPVAFEN--FLKWRAVLKGPVNTPYHKHSFKLLIE 60

Query: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119
           +P  YP  PP  +F P+ + H N+++STG++CL++L+HE WSPV+NL+ V+ A+  LL E
Sbjct: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120

Query: 120 PGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLR 150
           P VDSPL++DL+  L   D +AY G++NY L+
Sbjct: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQ 152

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  127 bits (318), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 92/153 (60%), Gaps = 2/153 (1%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEE-NGDLHRWEAHFQGPENTPYAGFTFTLRIN 59
           M R  +EYK + K L     V S   VG E   DL RWEA  +GP  TPY G  F L ++
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60

Query: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119
           +P+ YP  PP   F P+ + H N+ + TGE+CLD+L  + WSP ++LL VV+AI  LL E
Sbjct: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120

Query: 120 PGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRT 151
           P   SPL+VD++  L   D  AY G+V+Y +++
Sbjct: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  126 bits (317), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 91/155 (58%), Gaps = 17/155 (10%)

Query: 2   RRILREYKQL------QKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFT 55
           +R+LREY++L        +  LHP          +  DL  WEA  +GP+ TPY G +F 
Sbjct: 3   QRVLREYRRLVAAGGAANESNLHPT---------DPADLTHWEATLEGPQGTPYEGHSFP 53

Query: 56  LRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAIST 115
           LR+ VP+ YP  PP   FP   + HPN+KW TGEVCLD L    W+PV +L   V A+  
Sbjct: 54  LRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRR 112

Query: 116 LLAEPGVDSPLDVDLSRLYT-TDRAAYDGVVNYRL 149
           LLAEP  +SPL+++L+ L    D  AYDG++ YRL
Sbjct: 113 LLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRL 147

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  126 bits (316), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 98/169 (57%), Gaps = 16/169 (9%)

Query: 1   MRRILREYKQLQKQLA-------------LHPAVLSLAPVGEENGDLHRWEAHFQGPENT 47
           M R+L+EYK++Q  L+              +  +  L P+     DL  W+A  +GP+ T
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS--TSDLTHWQAQIKGPQGT 58

Query: 48  PYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLL 107
           PYA   F L+I  P TYP EPP   F P  + H N+ + TG +CLD+L+ + W+P +NL+
Sbjct: 59  PYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118

Query: 108 QVVEAISTLLAEPGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRTRPQP 155
             ++AI  LL +P  DSPL+VD++  L   D++AY+G++NY L   P P
Sbjct: 119 TTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSP 167

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  125 bits (315), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 9/156 (5%)

Query: 1   MRRILREYKQLQKQLALHPA---VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLR 57
           ++RI +E+K ++K LA  P+   +L L P  ++ G+++ W A   GP  TPYA   F L 
Sbjct: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEP--KDTGNMYHWIADISGPPETPYASAVFALD 60

Query: 58  INVPETYPNEPPKCSFPP---HHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAIS 114
           + +P  YP EPP+  F P   ++ICH N+ + TGE+CLD+L  E WSPV++L+ V+ AI 
Sbjct: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120

Query: 115 TLLAEPGVDSPLDVDLSR-LYTTDRAAYDGVVNYRL 149
            LL EP  +SPL+VD++  L   D  AY+G++ Y +
Sbjct: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  124 bits (311), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 2   RRILREYKQLQKQLALHPA---VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58
           +R+ +EY+ L K L   P    ++SLAPV EEN  L +WE+   GP +TPY G  FTL+I
Sbjct: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEEN--LRKWESLITGPPDTPYFGHEFTLQI 60

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLA 118
              E YP EPPK  F    + H N+ + +G +CL +L    W+P ++LL VV AI  LLA
Sbjct: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120

Query: 119 EPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRL 149
            P  DSPLDVDL+ L    DR+A++ ++ Y L
Sbjct: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  121 bits (304), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 94/156 (60%), Gaps = 12/156 (7%)

Query: 3   RILREYK---QLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRIN 59
           RIL+EYK    LQ Q      +L+L P+  +  DL  WE   +GP ++P+A  TF LRI+
Sbjct: 4   RILKEYKDSRSLQSQY-----ILALDPISTD--DLTHWECTIKGPLHSPFANHTFKLRID 56

Query: 60  VPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAE 119
           +P+TYP   P C F P  + HPN+ + TGE+CLD+L    WSPV+N+  +VEAI  LL E
Sbjct: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNE 115

Query: 120 PGVDSPLDVDLSRLYT-TDRAAYDGVVNYRLRTRPQ 154
           P   SPL++DL+ L    D  AY  +++Y L    +
Sbjct: 116 PNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  120 bits (302), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 6/152 (3%)

Query: 2   RRILREYKQLQKQLALHPA---VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58
           +R+ +EYK L K L   PA   +  L PV ++N  L+ WEA   GP +TPY G  F+L I
Sbjct: 3   QRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDN--LYVWEADITGPSDTPYQGHEFSLLI 60

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLA 118
            +P  YP EPPK  F    + H N+ + +G +C++LL+   WSP ++LL +V AI  LLA
Sbjct: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLA 120

Query: 119 EPGVDSPLDVDLSRL-YTTDRAAYDGVVNYRL 149
            P  DSPLDVDL+ L    D +A++G+V Y L
Sbjct: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYL 152

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  118 bits (295), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 19/168 (11%)

Query: 1   MRRILREYKQLQKQLALHPA--VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58
           M RI +E  +++K L    +  ++ LAPV  ++ DL RW A  +GP  TPY  + F L I
Sbjct: 1   MARISKELLKIRKALEHGDSEFLVDLAPV--DDSDLSRWFAVIKGPAETPYYPYEFKLAI 58

Query: 59  NVPETYPNEPPKCSF----------PPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQ 108
            VP +YP  PP   F          PPH  C  N+   TGE+CLD+LK E WSP++++L 
Sbjct: 59  EVPASYPMVPPTIKFVSDAKAGIRVPPH--C--NVDRRTGEICLDILKPEGWSPIWDILH 114

Query: 109 VVEAISTLLAEPGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRTRPQP 155
           VV+AI  LL EP  DSPLDVD++  L   D +AY+G++ Y L     P
Sbjct: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score =  104 bits (259), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 9/145 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L +     PA  S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLGRD---PPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK +F    I HPNI  S+G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKVNF-TTKIYHPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVVN 146
            D PL  +++++Y TD+A Y+    
Sbjct: 116 PDDPLVPEIAQIYKTDKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score =  104 bits (259), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 9/145 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L +     PA  S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLGRD---PPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK +F    I HPNI  S+G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKVNF-TTKIYHPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVVN 146
            D PL  +++++Y TD+A Y+    
Sbjct: 116 PDDPLVPEIAQIYKTDKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score =  104 bits (259), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 9/145 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L +     PA  S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLGRD---PPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK +F    I HPNI  S+G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKVNF-TTKIYHPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVVN 146
            D PL  +++++Y TD+A Y+    
Sbjct: 116 PDDPLVPEIAQIYKTDKAKYEATAK 140

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score =  103 bits (257), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 85/145 (58%), Gaps = 9/145 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L +     PA  S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLGRD---PPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK +F    I HPNI  S+G +CLD+LK + WSP   L +V+ ++ +LL +  
Sbjct: 59  TDYPFKPPKVNF-TTKIYHPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSVCSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVVN 146
            D PL  +++++Y TD+A Y+    
Sbjct: 116 PDDPLVPEIAQIYKTDKAKYEATAK 140

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score =  102 bits (253), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 9/144 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L++     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLERD---PPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVV 145
            D PL  +++ +Y TDR+ Y+   
Sbjct: 116 PDDPLVPEIAHIYKTDRSKYEATA 139

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score =  101 bits (252), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ 
Sbjct: 3   LKRITKELNDLGRD---PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 57  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 113

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ +Y TDRA Y+   
Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEATA 138

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score =  101 bits (252), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ 
Sbjct: 3   LKRITKELNDLGRD---PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 57  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 113

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ +Y TDRA Y+   
Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEATA 138

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score =  101 bits (252), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ 
Sbjct: 3   LKRITKELNDLGRD---PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 57  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 113

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ +Y TDRA Y+   
Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEATA 138

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score =  101 bits (252), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ 
Sbjct: 3   LKRITKELNDLGRD---PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 57  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 113

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ +Y TDRA Y+   
Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEATA 138

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score =  101 bits (251), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 82/144 (56%), Gaps = 9/144 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L +     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 4   KRIAKELSDLGRD---PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFP 57

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 58  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 114

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVV 145
            D PL  +++ +Y TDRA Y+   
Sbjct: 115 PDDPLVPEIAHIYKTDRAKYEATA 138

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score =  101 bits (251), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   D++ W+A   GP ++PYAG  F L I+ 
Sbjct: 4   LKRITKELNDLGRD---PPTSCSAGPVGD---DVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 58  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 114

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ LY TDRA Y+   
Sbjct: 115 NPDDPLVPEIAHLYKTDRAKYEATA 139

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score =  101 bits (251), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   D++ W+A   GP ++PYAG  F L I+ 
Sbjct: 4   LKRITKELNDLGRD---PPTSCSAGPVGD---DVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 58  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 114

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ LY TDRA Y+   
Sbjct: 115 NPDDPLVPEIAHLYKTDRAKYEATA 139

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score =  100 bits (250), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 82/144 (56%), Gaps = 9/144 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L++     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLERD---PPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVV 145
            D PL  +++ +Y TDR  Y+   
Sbjct: 116 PDDPLVPEIAHIYKTDRPKYEATA 139

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score =  100 bits (250), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 82/144 (56%), Gaps = 9/144 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L++     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLERD---PPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVV 145
            D PL  +++ +Y TDR  Y+   
Sbjct: 116 PDDPLVPEIAHIYKTDRPKYEATA 139

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score =  100 bits (250), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 82/144 (56%), Gaps = 9/144 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L++     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRIAKELSDLERD---PPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVV 145
            D PL  +++ +Y TDR  Y+   
Sbjct: 116 PDDPLVPEIAHIYKTDRPKYEATA 139

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 99.4 bits (246), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 83/145 (57%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   D++ W+A   GP ++PYAG  F L I+ 
Sbjct: 3   LKRITKELNDLGRD---PPTSCSAGPVGD---DIYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK +F    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 57  PTDYPFKPPKIAF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 113

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ +Y TDRA Y+   
Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEATA 138

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 99.4 bits (246), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 82/145 (56%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   D++ W+A   GP ++PYAG  F L I+ 
Sbjct: 4   LKRITKELNDLGRD---PPTSCSAGPVGD---DIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 58  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 114

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ LY TDR  Y+   
Sbjct: 115 NPDDPLVPEIAHLYKTDRPKYEATA 139

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 99.0 bits (245), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 83/143 (58%), Gaps = 9/143 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   D++ W+A   GP ++PYAG  F L I+ 
Sbjct: 3   LKRITKELNDLGRD---PPTSCSAGPVGD---DVYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK +F    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 57  PTDYPFKPPKIAF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 113

Query: 121 GVDSPLDVDLSRLYTTDRAAYDG 143
             D PL  +++ +Y TDRA Y+ 
Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEA 136

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 98.6 bits (244), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 81/144 (56%), Gaps = 9/144 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   + +     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 5   KRITKELSDMGRD---PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFP 58

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 59  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVV 145
            D PL  +++ +Y TDR  Y+   
Sbjct: 116 PDDPLVPEIAHIYKTDRPKYEATA 139

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 98.6 bits (244), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 81/144 (56%), Gaps = 9/144 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   + +     P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P
Sbjct: 4   KRITKELSDMGRD---PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFP 57

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 58  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 114

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVV 145
            D PL  +++ +Y TDR  Y+   
Sbjct: 115 PDDPLVPEIAHIYKTDRPKYEATA 138

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 98.6 bits (244), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 82/145 (56%), Gaps = 9/145 (6%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++RI +E   L +     P   S  PVG+   D++ W+A   GP ++PYAG  F L I+ 
Sbjct: 4   LKRITKELNDLGRD---PPTSCSAGPVGD---DIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK SF    I HPNI  + G +CLD+LK + WSP   + +V+ +I +LL + 
Sbjct: 58  PTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDA 114

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVV 145
             D PL  +++ +Y TDR  Y+   
Sbjct: 115 NPDDPLVPEIAHIYKTDRPKYEATA 139

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 98.6 bits (244), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 81/141 (57%), Gaps = 9/141 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI +E   L+K         S  PVG+   DL  W+A   GP ++PYAG  F L I+ P
Sbjct: 4   KRISKELNDLRKDPI---TSFSAGPVGD---DLFHWQASIMGPPDSPYAGGVFFLSIHFP 57

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK SF    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +  
Sbjct: 58  TDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 114

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            D PL  +++ +Y TDR+ Y+
Sbjct: 115 PDDPLVPEIAHIYKTDRSKYE 135

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 98.2 bits (243), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 80/142 (56%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K++Q       A +SLA V E   D+H  +  F GP  TPY G TF + I V
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLAFVSES--DIHHLKGTFLGPPGTPYHGGTFIVDIQV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPNI   TG +CLD+LK+ +WSPV  L   + ++  LL  P
Sbjct: 59  PLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKN-SWSPVLTLKTSLISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ Y +DRA++D
Sbjct: 117 EPNDPQDAEVAKHYLSDRASFD 138

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 96.7 bits (239), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (59%), Gaps = 6/126 (4%)

Query: 20  AVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHIC 79
           +  S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P  YP +PPK SF    I 
Sbjct: 33  SSFSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIY 88

Query: 80  HPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRA 139
           HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  +++ +Y TDR+
Sbjct: 89  HPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRS 146

Query: 140 AYDGVV 145
            Y+   
Sbjct: 147 KYEATA 152

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 97.8 bits (242), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 75/127 (59%), Gaps = 6/127 (4%)

Query: 19  PAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHI 78
           P   S  PVG+   DL+ W+A   GP ++PYAG  F L I+ P  YP +PPK SF    I
Sbjct: 107 PTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KI 162

Query: 79  CHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDR 138
            HPNI  + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  +++ +Y TDR
Sbjct: 163 YHPNIN-ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDR 220

Query: 139 AAYDGVV 145
           A Y+   
Sbjct: 221 AKYEATA 227

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 94.4 bits (233), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 5/135 (3%)

Query: 9   KQLQKQLA--LHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPN 66
           K+LQ +L   L  A  S++    ++ DL  W  +  GP+ TPY+G  F + +N PE YP 
Sbjct: 11  KRLQNELLQLLSSATQSISAFPVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPF 70

Query: 67  EPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPL 126
            PPK  F    + HPN+   +G +CLD+LK E WS VYN+  ++ ++ +LL EP   SPL
Sbjct: 71  HPPKIKF-VSPMWHPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPL 127

Query: 127 DVDLSRLYTTDRAAY 141
           +   + L+ T+   Y
Sbjct: 128 NAVAAELWDTNMVEY 142

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 95.5 bits (236), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 76/142 (53%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+LQ       A + L  V E   D+H  +  F GP  TPY G  F + I V
Sbjct: 1   MSRAKRIMKELQAVKDDPTAKIGLEFVNE--SDIHHLKGSFFGPPGTPYEGGQFIIDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ Y  DRA++D
Sbjct: 117 EPNDPQDAEVAQHYLKDRASFD 138

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 95.1 bits (235), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 76/142 (53%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+LQ       A +SL  V E   D+H  +  F GP  TPY G  F + I V
Sbjct: 1   MSRAKRIMKELQAVKDDPEANISLEFVSE--SDIHHLKGSFLGPPGTPYEGGKFIVDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPKMKF-DSKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ Y  DR ++D
Sbjct: 117 EPNDPQDAEVAQHYLRDRQSFD 138

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 92.8 bits (229), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 5/139 (3%)

Query: 9   KQLQKQLA--LHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPN 66
           K+LQ +L   L     S++   E++ DL  W  +  GP+ TPY+   F + +N PE+YP 
Sbjct: 11  KRLQNELLQLLSSTTRSISAFPEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPF 70

Query: 67  EPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPL 126
            PPK  F    + HPN+  S G +CLD+LK E WS VYN+  ++ ++ +LL EP   SPL
Sbjct: 71  HPPKVKF-VSPMWHPNVDMS-GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPL 127

Query: 127 DVDLSRLYTTDRAAYDGVV 145
           +   + L+  D   Y   V
Sbjct: 128 NAVAAELWDKDMEEYKKKV 146

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 94.0 bits (232), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 79/142 (55%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K++Q       A +SL+ V E   D+H  +  F GP  TPY G  F + I V
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLSFVSE--SDIHHLKGTFLGPPGTPYHGGKFVVDIQV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPNI   TG +CLD+LK+ +WSPV  L   + ++  LL  P
Sbjct: 59  PLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKN-SWSPVLTLKTSLISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ Y +DR+++D
Sbjct: 117 EPNDPQDAEVAKHYLSDRSSFD 138

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 94.0 bits (232), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 81/150 (54%), Gaps = 7/150 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RIL+E + +++      A + L  V E   D+H  +  F GP  TPY G  F + IN+P
Sbjct: 5   KRILKEIQAVKED---PEAQIELKFVNE--SDIHHMKGSFIGPSGTPYEGGKFVVDINIP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PP+  F    + HPN+   TG +CLD+LK+ AW+PV  L   + ++  LL  P 
Sbjct: 60  VEYPYKPPQMKFDT-KVYHPNVSSVTGAICLDILKN-AWTPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYDGVVNYRLRT 151
            + P D  +++ Y TD+ ++D       RT
Sbjct: 118 PNDPQDAQVAKHYLTDKKSFDETAALWTRT 147

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 92.0 bits (227), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 87/153 (56%), Gaps = 19/153 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR+L+EY+QL +     P +L+ AP  E N  L  W+   QGP +TPY G  F  R++ P
Sbjct: 7   RRLLKEYQQLIRDPP--PGILA-APKSESN--LFLWDCLIQGPPDTPYEGGIFNARLDFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           + ++ ++L+EP ++S  +VD   L+  +R  ++
Sbjct: 120 LLSVMSMLSEPNIESGANVDACILWRDNRPEFE 152

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 91.3 bits (225), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 85/156 (54%), Gaps = 16/156 (10%)

Query: 6   REYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65
           R YK+LQ+ +   P  +   P  ++N  L  W+   QGP +TPYAG  F  ++  P+ YP
Sbjct: 8   RLYKELQQLIKDSPPGIVAGPKSDDN--LFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYP 65

Query: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDLL------------KHEAWSPVYNLLQVVEAI 113
             PPK +F P  I HPNI +  GEVC+ +L              E WSPV ++ +++ ++
Sbjct: 66  LSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSV 123

Query: 114 STLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
            ++L+EP ++S  ++D   L+  +RA ++  V   +
Sbjct: 124 MSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSI 159

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 92.8 bits (229), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++   A H   ++L  V E   D+H  +  F GP  TPY G  F + I VP
Sbjct: 5   KRIMKEIQAVKDDPAAH---ITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  DR +++
Sbjct: 118 PNDPQDAEVAQHYLRDRESFN 138

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 92.8 bits (229), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++   A H   ++L  V E   D+H  +  F GP  TPY G  F + I VP
Sbjct: 5   KRIMKEIQAVKDDPAAH---ITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  DR +++
Sbjct: 118 PNDPQDAEVAQHYLRDRESFN 138

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 92.8 bits (229), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++   A H   ++L  V E   D+H  +  F GP  TPY G  F + I VP
Sbjct: 5   KRIMKEIQAVKDDPAAH---ITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  DR +++
Sbjct: 118 PNDPQDAEVAQHYLRDRESFN 138

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 92.8 bits (229), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++   A H   ++L  V E   D+H  +  F GP  TPY G  F + I VP
Sbjct: 5   KRIMKEIQAVKDDPAAH---ITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  DR +++
Sbjct: 118 PNDPQDAEVAQHYLRDRESFN 138

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 92.8 bits (229), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 78/142 (54%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K++Q       A ++L+ V E   D+H  +  F GP  TPY G  F + I V
Sbjct: 1   MSRAKRIIKEIQAAKDDPEANITLSFVSE--SDIHHLKGSFYGPPGTPYEGGNFIVDIQV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ +  D++++D
Sbjct: 117 EPNDPQDAEVAQHFIRDKSSFD 138

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 92.4 bits (228), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 76/141 (53%), Gaps = 4/141 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+LQ       A ++L  + E   D+HR +  F GP  TPY G  F + I V
Sbjct: 1   MSRAKRLMKELQAVRDDPAANITLEFISE--SDIHRLKGSFLGPPETPYQGGRFIIDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAY 141
             + P D ++++ Y  D+ ++
Sbjct: 117 EPNDPQDAEVAQHYLRDKESF 137

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 90.9 bits (224), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 16/157 (10%)

Query: 6   REYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65
           R  K+LQ+ L   P  +   PV E+N  L  W+   +GP ++PY G  F  R+  P  YP
Sbjct: 8   RLMKELQQLLRDSPDGIVAGPVSEDN--LFLWDCLIEGPADSPYEGGVFNARLQFPRDYP 65

Query: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDLL------------KHEAWSPVYNLLQVVEAI 113
             PPK +F P  I HPN+ +  GEVC+ +L              E WSPV ++ +++ ++
Sbjct: 66  LSPPKLTFTP-SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSV 123

Query: 114 STLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLR 150
            ++L+EP V+S  ++D   L+  +RA ++  V   +R
Sbjct: 124 MSMLSEPNVESGANIDACILWRDNRADFERQVQESVR 160

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 90.5 bits (223), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (56%), Gaps = 6/129 (4%)

Query: 14  QLALHPA-VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCS 72
           QL + P   LS  P  EEN  L +W     GP+++PYAG  F + +  P+ YP EPPK  
Sbjct: 23  QLIMSPTPGLSAFPDHEEN--LTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVK 80

Query: 73  FPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSR 132
           F    + HPN+  S G +CLD+LK E WS VYN+  ++ ++  LL EP   SPL+   + 
Sbjct: 81  F-VSPMWHPNVDLS-GNICLDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNAIAAE 137

Query: 133 LYTTDRAAY 141
           L+  D+  Y
Sbjct: 138 LWDGDKEEY 146

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 90.1 bits (222), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 74/139 (53%), Gaps = 5/139 (3%)

Query: 9   KQLQKQLA--LHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPN 66
           K+LQ +L   L     S+     ++ DL  W  +  GP+ TPY+   F + +N PE YP 
Sbjct: 11  KRLQNELLQLLSSTTQSIGAFPVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPF 70

Query: 67  EPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPL 126
            PPK  F    + HPN+   +G +CLD+LK E WS VYN+  ++ ++ +LL EP   SPL
Sbjct: 71  HPPKVKF-VSPMWHPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPL 127

Query: 127 DVDLSRLYTTDRAAYDGVV 145
           +   + L+  D   Y   V
Sbjct: 128 NAVAAELWDKDMEGYKKKV 146

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 90.9 bits (224), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++   A   A ++L  V E   D+H  +  F GP  TPY G  F + I VP
Sbjct: 5   KRIMKEMQAVKDDPA---ANINLEFVSE--SDIHHLKGSFLGPPETPYQGGRFIVDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  DR +++
Sbjct: 118 PNDPQDAEVAQHYLRDRESFN 138

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 90.5 bits (223), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 78/151 (51%), Gaps = 4/151 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+LQ       A + L  V E   D+H  +  F GP  TPY    F + I V
Sbjct: 1   MSRAKRVMKELQAIKDDPEAKVDLQLVNE--NDIHLLKGSFLGPPGTPYENGKFIVDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPN+   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPKMKF-DTKVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVVNYRLRT 151
             + P D ++++ +  D+A++D    +  +T
Sbjct: 117 EPNDPQDAEVAQHFLRDKASFDKTAAFWTKT 147

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 90.1 bits (222), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 78/141 (55%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++   A   A ++L  V E   D+H  +  F GP  TPY G  F + I VP
Sbjct: 5   KRIMKEMQAVKDDPA---ANITLDFVNE--SDIHHLKGSFLGPPGTPYEGGRFMIDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  D+  ++
Sbjct: 118 PNDPQDAEVAQHYLKDKEGFN 138

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 89.7 bits (221), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 78/141 (55%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++     H   ++L  V E   D+H  +  FQGP  TPY    F + I VP
Sbjct: 5   KRIMKEMQAVKDDPEAH---ITLEFVNE--SDIHHLKGTFQGPPETPYDRGQFVVDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPN+   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  DR +++
Sbjct: 118 PNDPQDAEVAQHYLKDRESFN 138

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 88.6 bits (218), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 82/153 (53%), Gaps = 19/153 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR+L+E +QL K     P  +   P  E N  L  W+   QGP +T Y G  F  R++ P
Sbjct: 7   RRLLKELQQLNKD---SPPGIVAGPANENN--LFVWDCLVQGPPDTAYEGGIFNARLDFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           + ++ ++L+EP ++S  ++D   L+  +R  ++
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDNRKEFE 152

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 89.7 bits (221), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 78/151 (51%), Gaps = 4/151 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+LQ       A + L  V E   D+H  +  F GP  TPY    + + I V
Sbjct: 1   MSRAKRVMKELQAIKDDPEARVDLQLVNE--NDIHLLKGSFLGPPGTPYENGKYIVDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPN+   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPKMKFQT-KVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYDGVVNYRLRT 151
             + P D ++++ Y  D+A++D    +  +T
Sbjct: 117 EPNDPQDAEVAQHYIRDKASFDKTAAFWTKT 147

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 87/160 (54%), Gaps = 19/160 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL K     P  +   P  E+N  + +W+   QGP ++PY G  F  +++ P
Sbjct: 7   KRLLKELQQLMKD---SPPGIVAGPKTEDN--IFQWDCLVQGPPDSPYEGGVFNAQLDFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           + ++ ++L+EP ++S  ++D   L+  +R  ++  V   +
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDNRKEFERQVKLNI 159

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 89.0 bits (219), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 75/142 (52%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+++       A + L  V E   D+H  +  F GP  TPY G  F + I V
Sbjct: 1   MSRAKRIMKEMEAVRDDPEANIDLEFVSE--ADIHHLKGSFLGPPETPYEGGKFIVDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PPK  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ Y  DR +++
Sbjct: 117 EPNDPQDAEVAQHYLRDRESFN 138

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 88.6 bits (218), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 74/142 (52%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+LQ       A + L  V E   D+H  +  F GP  TPY G  F + I V
Sbjct: 1   MSRAKRIMKELQAVKDDPEARIELEFVNE--SDIHHLKGSFLGPPGTPYEGGQFIVDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PP   F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPMMKFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ Y  DR +++
Sbjct: 117 EPNDPQDAEVAQHYLKDRESFN 138

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 87.4 bits (215), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 82/140 (58%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K+++      P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRIKSD---SPPGISASPLPD---NVMLWNAMIIGPSDTPYEDGTFRLVLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVSSILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   RA Y
Sbjct: 118 PASPANVEAATLFKDHRAQY 137

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 88.2 bits (217), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E + ++   A   A ++L  V E   D+H  +  F GP  TPY G  F + I VP
Sbjct: 5   KRIMKEMQAVKDDPA---AKINLEFVTE--SDIHHLKGSFLGPPGTPYDGGLFIVDIEVP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
             YP +PPK  F    + HPN+   TG +CLD+LK+ AWSPV  L   + ++  LL  P 
Sbjct: 60  MEYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQSPE 117

Query: 122 VDSPLDVDLSRLYTTDRAAYD 142
            + P D ++++ Y  D+ +++
Sbjct: 118 PNDPQDAEVAQHYLRDKDSFN 138

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 82/156 (52%), Gaps = 19/156 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR+L+E +QL K     P  +   P  E N  L  W+   QGP +T Y G  F  R+  P
Sbjct: 7   RRLLKELQQLTKD---SPPGIVACPKNENN--LFIWDCLVQGPPDTAYEGGIFNARLEFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
           + ++ ++L+EP ++S  ++D   L+  +R  ++  V
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDNREEFERQV 155

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 86.3 bits (212), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 82/153 (53%), Gaps = 19/153 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL K  +     +   P  E   DL  W+   QGP +TPY G  F  ++  P
Sbjct: 7   KRLLKELQQLMKDSS---TGIVAGPRSE--NDLFVWDCLIQGPPDTPYEGGIFNAKLEFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           + ++ ++L+EP V+S  +VD   L+  +R  ++
Sbjct: 120 LLSVMSMLSEPNVESGANVDACILWRDNRPEFE 152

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 85.5 bits (210), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 84/160 (52%), Gaps = 19/160 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL K     P  +   P  E N  +  W+   QGP +TPYA   F  ++  P
Sbjct: 7   KRLLKELQQLIKD---SPPGIVAGPKSENN--IFVWDCLIQGPPDTPYADGVFNAKLEFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           + ++ ++L+EP ++S  ++D   L+  +R  ++  V   +
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDNRPEFEKQVKLSI 159

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 85.5 bits (210), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 74/135 (54%), Gaps = 5/135 (3%)

Query: 9   KQLQKQLA--LHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPN 66
           K+LQ +L   L     S++    ++ DL  W  +  GP++TPY+G  F + +  P+ YP 
Sbjct: 11  KRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPF 70

Query: 67  EPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPL 126
            PP   F    + HPN+   +G +CLD+LK E WS VYN+  ++ ++ +LL EP   SPL
Sbjct: 71  HPPMIKF-LSPMWHPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPL 127

Query: 127 DVDLSRLYTTDRAAY 141
           +   + L+  D   Y
Sbjct: 128 NAVAAELWDADMEEY 142

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 86.7 bits (213), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 75/142 (52%), Gaps = 4/142 (2%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           M R  R  K+LQ       A ++L  V E   D+H  +  F GP  TPY    F + I V
Sbjct: 1   MSRAKRIMKELQAVKDDPEAKITLEFVIE--SDIHHLKGSFIGPPGTPYENGAFVVDIEV 58

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           P  YP +PP+  F    + HPNI   TG +CLD+LK+ AWSPV  L   + ++  LL  P
Sbjct: 59  PMEYPFKPPQMKFDT-KVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQSP 116

Query: 121 GVDSPLDVDLSRLYTTDRAAYD 142
             + P D ++++ Y  DR +++
Sbjct: 117 EPNDPQDAEVAQHYLRDRESFN 138

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 85.5 bits (210), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 81/152 (53%), Gaps = 19/152 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+++E +QL K     P  +   PV EEN  +  W+    GP ++PY G  F  R+  P
Sbjct: 7   KRLMKEMQQLLKDC---PEGIVAGPVNEEN--MFLWDCLIAGPPDSPYEGGIFNARLQFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL------------KHEAWSPVYNLLQV 109
             YP  PPK +F P  I HPN+ +  GEVC+ +L              E WSPV ++ ++
Sbjct: 62  TDYPLSPPKLTFTP-SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           + ++ ++L+EP V+S  ++D   L+  +R  +
Sbjct: 120 LLSVMSMLSEPNVESGANIDACILWRDNRPDF 151

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 85.5 bits (210), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 84/160 (52%), Gaps = 19/160 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL K     P  +   P  E N  +  W+   QGP +TPYA   F  ++  P
Sbjct: 7   KRLLKELQQLIKD---SPPGIVAGPKSENN--IFVWDCLIQGPPDTPYADGIFNAKLEFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           + ++ ++L+EP ++S  ++D   L+  +R  ++  V   +
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDNRPEFEKQVKLSI 159

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 85.5 bits (210), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKED---SPPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EDYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 85.5 bits (210), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-VSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 85.5 bits (210), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 85.1 bits (209), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 84/160 (52%), Gaps = 19/160 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL K     P  +   P  E N  +  W+   QGP +TPYA   F  ++  P
Sbjct: 7   KRLLKELQQLIKD---SPPGIVAGPKSENN--IFVWDCLIQGPPDTPYADGVFNTKLEFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           + ++ ++L+EP ++S  ++D   L+  +R  ++  V   +
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDNRPEFERQVKLSI 159

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 85.1 bits (209), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 85.1 bits (209), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 85.1 bits (209), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 85.1 bits (209), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKED---SPPGVSASPLPD---NVMIWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFQDHKSQY 137

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 85.1 bits (209), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 85.1 bits (209), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 84/160 (52%), Gaps = 19/160 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL K     P  +   P  E N  +  W+   QGP +TPYA   F  ++  P
Sbjct: 7   KRLLKELQQLIKD---SPPGIVAGPKSENN--IFIWDCLIQGPPDTPYADGVFNAKLEFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           + ++ ++L+EP ++S  ++D   L+  +R  ++  V   +
Sbjct: 120 LLSVMSMLSEPNIESGANIDACILWRDNRPEFERQVKLSI 159

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 85.1 bits (209), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 85.1 bits (209), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 85.1 bits (209), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 84.7 bits (208), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 83/140 (59%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSGSPLPD---NVMIWNAMIIGPSDTPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-ISEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 82/140 (58%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP  TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPAETPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 83/160 (51%), Gaps = 19/160 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+EY+QL ++    P  +   P  E N  +  W+    GP  TPY    F   +  P
Sbjct: 9   KRLLKEYQQLIRE---SPPGIVAGPSDENN--MFEWDCLISGPPETPYENGVFNATLLFP 63

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PPK +F P  + HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 64  KDYPLSPPKLTFTP-SLLHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 121

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           + ++ ++L+EP ++S  ++D S LY  +R  ++  V   +
Sbjct: 122 LLSVMSMLSEPNIESGANIDASILYRDNRPEFERQVKLSI 161

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 84.0 bits (206), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 76/148 (51%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      PV + +G  DL +WEA   G E T +AG  + + +
Sbjct: 6   LQRLQEERKKWRKD---HPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITV 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P  YP++PPK  F P    HPN+ + +G +CL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++A YD  V
Sbjct: 121 DSPNPNSPAQEPAWRSFSRNKAEYDKKV 148

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 83.2 bits (204), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 74/137 (54%), Gaps = 9/137 (6%)

Query: 9   KQLQK---QLALHPA-VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETY 64
           K+LQ    QL + P   LS  P  E+  DL +W     GPE TPY    F L +   + Y
Sbjct: 12  KRLQNELVQLMMSPTPGLSAFPASED--DLTQWFGVIVGPEGTPYENLKFRLSLKFTDQY 69

Query: 65  PNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDS 124
           P +PPK +F    + HPN+  S G +CLD+LK + WS VYN+  ++ ++  LL EP   S
Sbjct: 70  PYQPPKVTF-VSPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQALLEEPNNGS 126

Query: 125 PLDVDLSRLYTTDRAAY 141
           PL+   + L+ TD   Y
Sbjct: 127 PLNAIAAELWDTDMDEY 143

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 83.2 bits (204), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 81/152 (53%), Gaps = 19/152 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL +     P  +   P  E+N  L  W+    GP ++PY G  F   +  P
Sbjct: 7   KRLLKELQQLARD---SPEGIVAGPKSEDN--LFLWDCLITGPPDSPYEGGVFNAMLEFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
           + YP  PP+ +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  KDYPLSPPRLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           + +++++L+EP V+S  ++D   L+  +R  Y
Sbjct: 120 LLSVTSMLSEPNVESGANIDACILWRDNRPEY 151

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 82.8 bits (203), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 75/148 (50%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      PV + +G  DL +WEA   G E T +AG  + + +
Sbjct: 6   LQRLQEERKKWRKD---HPFGFYAKPVKKSDGSMDLQKWEAGIPGKEGTNWAGGVYPISV 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P  YP++PPK  F P    HPN+ + +G +CL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++  YD  V
Sbjct: 121 DSPNPNSPAQEPAWRSFSRNKTEYDKKV 148

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 82.8 bits (203), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 80/156 (51%), Gaps = 16/156 (10%)

Query: 6   REYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65
           R +K+LQ+ L   P  +   P  E+N  L  W+    GP ++PY G  F   +  P+ YP
Sbjct: 8   RLFKELQQLLKDSPEGIVAGPKSEDN--LFVWDCLISGPPDSPYQGGVFNATLEFPKDYP 65

Query: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQVVEAI 113
             PPK  F P  I HPNI +  GEVC+ +            L  E WSPV ++ +++ ++
Sbjct: 66  LSPPKLLFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSV 123

Query: 114 STLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
            ++L+EP V+S  ++D   L+  +R  ++  V   +
Sbjct: 124 MSMLSEPNVESGANIDACILWRDNRPEFERQVKLSI 159

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 82.8 bits (203), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 6   REYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65
           R +K+LQ+ L   P  +   P  E+N  L  W+    GP ++PY G  F   +  P+ YP
Sbjct: 8   RLFKELQQLLKDSPEGIVAGPRSEDN--LFLWDCLISGPPDSPYQGGVFNATLEFPKDYP 65

Query: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQVVEAI 113
             PPK  F P  I HPNI +  GEVC+ +            L  E WSPV ++ +++ ++
Sbjct: 66  LSPPKLLFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSV 123

Query: 114 STLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVN 146
            ++L+EP V+S  ++D   L+   R  ++  V 
Sbjct: 124 MSMLSEPNVESGANIDACILWRDSREEFEKQVK 156

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 82.4 bits (202), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 9/137 (6%)

Query: 9   KQLQK---QLALHPA-VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETY 64
           K+LQ    QL + P   LS  P  E+  DL  W     GPE TPY    F + ++ P++Y
Sbjct: 15  KRLQSELVQLMMSPTPGLSAFPNNED--DLRDWSGMIVGPEGTPYESLKFKISLHFPDSY 72

Query: 65  PNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDS 124
           P  PPK  F    + HPN+  S G +CLD+LK + WS VYN+  ++ ++ +L  EP   S
Sbjct: 73  PYVPPKVKF-ISPMWHPNVDMS-GNICLDILK-DQWSAVYNVQTILLSLQSLFEEPNNSS 129

Query: 125 PLDVDLSRLYTTDRAAY 141
           PL+   + L+  D   Y
Sbjct: 130 PLNAVAAELWDKDMVEY 146

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 82/153 (53%), Gaps = 19/153 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR+L+E +QL +     P  +   P  ++  DL  W+   QGP ++PY G  F  ++  P
Sbjct: 7   RRLLKELQQLMRD---PPPGIVAGP--QDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
             YP  PPK +F P  + HPN+ +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  RDYPLSPPKLTFVP-SVLHPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           + ++ ++L+EP V+S  ++D   L+  +R  ++
Sbjct: 120 LLSVVSMLSEPNVESGANIDACVLWRDNRPEFE 152

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 80.9 bits (198), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 62/104 (59%), Gaps = 3/104 (2%)

Query: 42  QGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWS 101
            GP ++PYAG  F L I+ P  YP +PPK SF    I HPNI  + G +CLD+LK + WS
Sbjct: 1   MGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WS 57

Query: 102 PVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
           P   L +V+ +I +LL +   D PL  +++ +Y TDR  Y+   
Sbjct: 58  PALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATA 101

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 82/140 (58%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP +T Y   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPADTSYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 82.0 bits (201), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 87/160 (54%), Gaps = 19/160 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E ++L K     P  +  +P+ + N  L +W+    GP ++ Y G  F  R++ P
Sbjct: 7   KRLLKELEKLTKD---SPEGILASPIDDSN--LFQWDCLIMGPPDSCYEGGVFNARLDFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL----------KHEA--WSPVYNLLQV 109
           + YP  PPK +F P  I HPNI +  GEVC+ +L          +HE   WSPV ++  +
Sbjct: 62  KDYPLNPPKLTFQP-SILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           + ++ ++L+EP ++S  ++D   L+  +R  ++  V   L
Sbjct: 120 LLSVMSILSEPNIESGANIDACILWRDNRPEFERQVKLNL 159

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 81.6 bits (200), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 75/148 (50%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      PV + +G  DL +WEA   G E T +AG  + + +
Sbjct: 6   LQRLQEERKKWRKD---HPFGFYAKPVKKADGSMDLQKWEAGIPGREGTNWAGGVYPITV 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P  YP++PPK  F P    HPN+ + +G +CL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++  YD  V
Sbjct: 121 DSPNPNSPAQEPAWRSFSRNKTEYDKKV 148

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 79/153 (51%), Gaps = 19/153 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EY+QL +     P  +   P  E   DL  W+   QGP +TPY    F  ++  P
Sbjct: 7   KRLFKEYQQLIRD---SPPGIVAGPANE--NDLFLWDCLIQGPPDTPYEHGVFNAQLRFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDL------------LKHEAWSPVYNLLQV 109
             YP  PP  +F P  I HPNI +  GEVC+ +            L  E WSPV ++ ++
Sbjct: 62  RDYPLSPPTLTFTP-AILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           + ++ ++L+EP V+S  ++D   L+  +R  ++
Sbjct: 120 LLSVMSMLSEPNVESGANIDACILWRDNRPEFE 152

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 78/140 (55%), Gaps = 13/140 (9%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K         P  +S +P+ +   ++  W A   GP  TPY   TF L +   
Sbjct: 7   RRLMRDFKDA-------PPGVSASPLPD---NVMVWNAMIIGPAETPYEDGTFRLLLEFD 56

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YPN+PP   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 57  EEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 113

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 114 PASPANVEAATLFKDHKSQY 133

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 72/137 (52%), Gaps = 9/137 (6%)

Query: 9   KQLQK---QLALHPA-VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETY 64
           K+LQ    QL + P   LS  P  EE  DL  W A   GP++TPY G  F L     ++Y
Sbjct: 19  KRLQSELMQLMMSPTPGLSAFPNDEE--DLTHWSAIITGPKDTPYDGLRFKLSFQFSDSY 76

Query: 65  PNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDS 124
           P  PP   F    + HPN+  S G +CLD+LK + WS VYN+  ++ ++  LL EP   S
Sbjct: 77  PYAPPLVKF-ISPMWHPNVDMS-GNICLDILKDQ-WSAVYNVETILLSLQALLEEPNNSS 133

Query: 125 PLDVDLSRLYTTDRAAY 141
           PL+   + L+  D   Y
Sbjct: 134 PLNAVAAELWDDDMNEY 150

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 80.1 bits (196), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 81/157 (51%), Gaps = 19/157 (12%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+L+E +QL +     P  +  AP  E   DL  W+    GP +TPYAG  F  ++  P
Sbjct: 7   KRLLKELQQLTRD---PPPGIIAAPKTE--SDLFTWDCLVAGPPDTPYAGGLFNCQLQFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLK------------HEAWSPVYNLLQV 109
             YP  PP  +F P  I HPN+ +  GEVC+ +L              E WSPV ++ ++
Sbjct: 62  TDYPLSPPTLTFTP-SILHPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSVEKI 119

Query: 110 VEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVN 146
           + ++ ++L+EP V+S  ++D   L+   R  ++  V 
Sbjct: 120 LLSVVSMLSEPNVESGANIDACILWRDHRDDFNKKVK 156

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (50%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      PV + +G  DL +WEA   G + T +AG  + + +
Sbjct: 6   LQRLQEERKKWRKD---HPFGFYAKPVKKADGSMDLQKWEAGIPGKDATNWAGGVYPITV 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P  YP++PPK  F P    HPN+ + +G +CL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPNEYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++  Y+  V
Sbjct: 121 DSPNPNSPAQEPAWRSFSRNKTEYEKKV 148

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 66/113 (58%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F GP++TPY G  + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 28  NDNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+LL ++E  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 87  CLDVI-NSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAGLQLHDKKIYE 138

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 3/113 (2%)

Query: 34  LHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLD 93
           +  +   F GP++TPY G  + L + +P+ YP + P   F  + I HPNI  ++G +CLD
Sbjct: 30  MQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 88

Query: 94  LLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
           ++ +  WSP+Y+LL +VE  +  LL EP    PL+ + + L   D+  Y+  V
Sbjct: 89  VI-NSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKV 140

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 78.2 bits (191), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 65/113 (57%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  NDNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDVASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 85  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKVLYE 136

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 77.0 bits (188), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 37  WEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLK 96
           W A   GP  TPY   TF L +   E YPN+PP   F    I HPN+ ++ GE+CLD+L+
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEIFHPNV-YANGEICLDILQ 78

Query: 97  HEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           +  W+P Y++  ++ +I +L  +P   SP +V+ + L+   ++ Y
Sbjct: 79  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQY 122

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N  +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 49  NNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 107

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+LL +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 108 CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYE 159

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 79/140 (56%), Gaps = 9/140 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           RR++R++K++++     P  +S +P+ +   ++  W A   GP  TPY   TF L +   
Sbjct: 7   RRLMRDFKRMKEDA---PPGVSASPLPD---NVMVWNAMIIGPAETPYEDGTFRLLLEFD 60

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           E YP   P   F    + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I +L  +P 
Sbjct: 61  EEYPINRPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPN 117

Query: 122 VDSPLDVDLSRLYTTDRAAY 141
             SP +V+ + L+   ++ Y
Sbjct: 118 PASPANVEAATLFKDHKSQY 137

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 77.4 bits (189), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N  +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 27  NDSMQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSI 85

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+LL +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 86  CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKMYE 137

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N  +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 85  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 136

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  +E+G  +L +WEA   G E T +    + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDAVYPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   + Q++  +  LL
Sbjct: 63  EYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  DSP      R Y  +   Y+  V
Sbjct: 121 TSPNPDSPAQEPAWRAYAKNVQEYEKKV 148

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 37  WEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLK 96
           W A   GP +TPY   TF L +   E YPN+PP   F    + HPN+ ++ GE+CLD+L+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 78

Query: 97  HEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           +  W+P Y++  ++ +I +L  +P   SP +V+ + L+   ++ Y
Sbjct: 79  NR-WTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFKDHKSQY 122

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 75.9 bits (185), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 37  WEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLK 96
           W A   GP +TPY   TF L +   E YPN+PP   F    + HPN+ ++ GE+CLD+L+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 78

Query: 97  HEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           +  W+P Y++  ++ +I +L  +P   SP +V+ + L+   ++ Y
Sbjct: 79  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDYKSQY 122

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  + +G  +L +WEA   G E T +    + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFYAKPCKKADGSMNLQKWEAGIPGKEGTIWQDGVYPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   L Q+   +  LL
Sbjct: 63  EYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R +  +RA YD  V
Sbjct: 121 DSPNPNSPAQEPAWRAFLRNRADYDKKV 148

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F GP  TPY G  + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 14  NDNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           CLD++ + AWSP+Y+LL ++E  I  LL EP    PL+ + + L    +  Y
Sbjct: 73  CLDVI-NSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELY 123

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 73/148 (49%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P    +G  +L +WEA   G E T +    F + +
Sbjct: 6   LQRLQEERKKWRKD---HPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPITV 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++A Y+  V
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNKAEYEKKV 148

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N  +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 85  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 136

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 65/113 (57%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F+GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 14  NDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSI 72

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L  +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 73  CLDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 124

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N  +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 85  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 136

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 75.5 bits (184), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 74/148 (50%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  + +G  DL RWEA   G + T +A   + L I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFFAKPTRKPDGTMDLQRWEAGIPGKQGTLWADGLYPLTI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK    P +  HPN+ + +G +CL +L  +  W P   L Q+   I  LL
Sbjct: 63  EYPDEYPSKPPKVKL-PANFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++A Y+  V
Sbjct: 121 DSPNPNSPAQEPAWRAFSRNKAEYEKKV 148

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 34  LHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLD 93
           +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +CLD
Sbjct: 30  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLD 88

Query: 94  LLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
           ++ +  WSP+Y+LL +VE  I  LL EP    PL+ + + L   D+  Y+  +
Sbjct: 89  VI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKI 140

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 74/154 (48%), Gaps = 8/154 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P+ + +G  DL  WEA   G   T +A   + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFSFFAKPLKKADGTMDLQHWEAGIPGKAGTLWADAVYPISI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRT 151
             P  +SP      R ++ ++  Y   V  + + 
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNKEEYQKKVASQAKA 154

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 76.6 bits (187), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 44  NDNMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 102

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+LL +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 103 CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELKDKKLYE 154

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 75.9 bits (185), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 28  NDNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L  +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 87  CLDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 138

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 75.9 bits (185), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 27  NDNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 85

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+LL +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 86  CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAGLQLHDKTLYE 137

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 75.5 bits (184), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N ++  +   F GP+ TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  NDNMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   D+  Y+
Sbjct: 85  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAGLQLRDKKLYE 136

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 74.3 bits (181), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 75/148 (50%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  + +G  +L  WEA   G E+T + G  + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFFAKPTKKVDGSMNLQLWEAGIPGKESTIWHGALYPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ +++ Y+  V
Sbjct: 121 DTPNPNSPAQEPAWRAFSKNKSEYEKRV 148

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 75.5 bits (184), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N  +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 25  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 83

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           CLD++ +  WSP+Y+L+ ++E  I  LL EP    PL+ + + L   D+  Y
Sbjct: 84  CLDVI-NSTWSPLYDLINILEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLY 134

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 74.3 bits (181), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 73/136 (53%), Gaps = 7/136 (5%)

Query: 9   KQLQK---QLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65
           K+LQ    QL + P+   L+   E   DL +W     GP+ TPY G  F + +   +TYP
Sbjct: 17  KRLQSELVQLMMSPSP-GLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYP 75

Query: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSP 125
              PK  F    + HPN+  S G +CLD+LK + WS VYN+  ++ ++ +LL EP   SP
Sbjct: 76  YTAPKVRF-VSPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSP 132

Query: 126 LDVDLSRLYTTDRAAY 141
           L+   + L+ TD   Y
Sbjct: 133 LNAVAAELWDTDMQEY 148

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  + +G  +L +WEA   G E T +    + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFWAKPTRKADGSMNLQKWEAGIPGKEGTIWKEGVYPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  DSP      R ++ +   Y+  V
Sbjct: 121 NSPNPDSPAQEPAWRAFSKNIKEYEKKV 148

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           N  +  +   F GP++TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 14  NDSMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   ++  Y+
Sbjct: 73  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNKELYE 124

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 74/136 (54%), Gaps = 7/136 (5%)

Query: 9   KQLQK---QLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65
           K+LQ    QL + P+   L+   E   DL +W     GP+ TPY G  F + +  P++YP
Sbjct: 17  KRLQSELVQLMMSPSP-GLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYP 75

Query: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSP 125
              P+ +F    + HPN+  S G +CLD+LK + WS VYN+  ++ ++ +LL EP   SP
Sbjct: 76  YTAPRVTF-VSPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSP 132

Query: 126 LDVDLSRLYTTDRAAY 141
           L+   + L+  +   Y
Sbjct: 133 LNAVAAELWDKNMEEY 148

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 73/148 (49%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  +++G  +L RWEA   G E T +    + L I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFFAKPTKKQDGSLNLQRWEAGIPGKEGTLWHEGVYPLTI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK    P    HPN+ + +G +CL +L  +  W P   L Q+   I  LL
Sbjct: 63  EYPDEYPSKPPKVKL-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++A Y+  +
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNKAEYEKKI 148

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (48%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  +E+G  +L +WEA   G E T +    + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PP+  F P    HPNI + +G VCL +L  +  W P   + Q++  +  LL
Sbjct: 63  EYPDDYPSKPPRVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R Y  +   Y+  V
Sbjct: 121 TSPNPNSPAQEPAWRAYAKNLQEYEKKV 148

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 74.3 bits (181), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + ++  +   F GP+ TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   ++  Y+
Sbjct: 85  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNKELYE 136

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 71.6 bits (174), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           DL RWEA   G   T +A   + + I  P+ YP++PPK  F P    HPN+ + +G +CL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 93  DLLKHEA-WSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLR 150
            +L  E  W P   L Q+V  +  LL  P  +SP      R ++ +++ Y+  V+ + +
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSRNKSEYEKKVSSQAK 118

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 14  QLALHPA-VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCS 72
           QL L P+  LS  P  EE  DL +W     GP+ TPY G  F + +   +TYP   PK  
Sbjct: 25  QLMLSPSPGLSAFPEDEE--DLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVR 82

Query: 73  FPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSR 132
           F    + HPN+  S G +CLD+LK + WS VYN+  ++ ++ +LL EP   SPL+   + 
Sbjct: 83  F-VSPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAE 139

Query: 133 LYTTDRAAY 141
           L+  D   Y
Sbjct: 140 LWDKDMREY 148

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 71/148 (47%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  + +G  +L +WEA   G E T +    F + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFFAKPTKKPDGSMNLQKWEAGIPGKEGTIWKDGVFPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   L Q+   +  LL
Sbjct: 63  EYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ +   Y+  V
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNVKEYERKV 148

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 71.6 bits (174), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 71/148 (47%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  + +G  +L +WEA   G E T +A   + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFFAKPTKKTDGTMNLQKWEAGIPGKEGTLWAEGVYPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P  YP++PPK    P    HPN+ + +G +CL +L  E  W P   L Q+   I  LL
Sbjct: 63  EYPNEYPSKPPKVKL-PAGFYHPNV-YPSGTICLSILNEEQDWRPAITLKQICLGIQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++  Y+  V
Sbjct: 121 DSPNPNSPAQEPAWRSFSKNKVEYEKKV 148

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 60/104 (57%), Gaps = 3/104 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + ++  +   F GP+ TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRL 133
           CLD++ +  WSP+Y+LL +VE  I  LL EP    PL+ + + L
Sbjct: 85  CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATL 127

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 71/148 (47%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P    +G  +L +WEA   G E T +    + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFFAKPTRNADGTMNLQKWEAGIPGREGTLWDHGVYPISI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPNI + +G VCL +L  +  W P   L Q+V  +  LL
Sbjct: 63  EYPDEYPSKPPKVRF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVIGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      + +  +R  Y+  V
Sbjct: 121 DTPNPNSPAQEPAWKAFQRNRVEYEKKV 148

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 69.7 bits (169), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (53%), Gaps = 3/110 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  +E   +GP+ +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 29  DDNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAA 140
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++  +  D ++
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDESS 135

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 69.3 bits (168), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 71/148 (47%), Gaps = 8/148 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P    +G  +L +WEA   G E T +A   + + I
Sbjct: 6   LQRLQEERKKWRKD---HPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P  YP++PPK    P +  HPN+ + +G +CL +L  +  W P   L Q+   I  LL
Sbjct: 63  EYPNEYPSKPPKVKL-PANFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             P  +SP      R ++ ++  Y+  V
Sbjct: 121 DSPNPNSPAQEPAWRSFSKNKEEYEKKV 148

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 70.1 bits (170), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 62/113 (54%), Gaps = 3/113 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + ++  +   F GP  TPY    + L + +P+ YP + P   F  + I HPNI  ++G +
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 91  CLDLLKHEAWSPVYNLLQVVE-AISTLLAEPGVDSPLDVDLSRLYTTDRAAYD 142
           CLD++ +  WSP+Y+L+ +VE  I  LL EP    PL+ + + L   +   Y+
Sbjct: 85  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPKMYE 136

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 3/107 (2%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  ++   +GP  +PY    F L + +PE YP E PK  F    I HPNI    G +CL
Sbjct: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRA 139
           D+LK   WSP   +  V+ +I  LLA P  + PL  D++  +  D A
Sbjct: 89  DVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEA 134

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 73/149 (48%), Gaps = 8/149 (5%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENG--DLHRWEAHFQGPENTPYAGFTFTLRI 58
           ++R+  E K+ +K    HP      P  + +G  +L +WEA   G + T +    + L I
Sbjct: 6   LQRLQEERKKWRKD---HPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTI 62

Query: 59  NVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEA-WSPVYNLLQVVEAISTLL 117
             P+ YP++PPK  F P    HPN+ + +G +CL +L  +  W P   L Q++  +  LL
Sbjct: 63  EYPDDYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQLLLGVQDLL 120

Query: 118 AEPGVDSPLDVDLSRLYTTDRAAYDGVVN 146
             P  +SP      R ++ +   Y+  V+
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNIKEYERKVS 149

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  ++   +GP+ +PY    F L + +PE YP E PK  F    I HPNI    G +
Sbjct: 29  DDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           CLD+LK+  WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 87  CLDVLKNN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (51%), Gaps = 3/110 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  +E   +GP  +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 29  DDNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAA 140
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++  +  D  A
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEEA 135

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  ++   +GP+ +PY    F L + +P+ YP EPPK  F    I HPNI    G +CL
Sbjct: 31  NLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNID-RLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSR 132
           D+LK   WSP   +  V+ +I  LLA P  + PL  D+++
Sbjct: 89  DVLKTN-WSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 68/130 (52%), Gaps = 9/130 (6%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +RI++E     ++LA  P     A   E+N  L  +    +GPE +PY    F L + +P
Sbjct: 6   KRIIKE----TERLASDPVPGISAEPHEDN--LRYFAVTIEGPEESPYENGVFELELYLP 59

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
           + YP E PK  F    I HPNI    G +CLD+LK+  WSP   +  V+ +I  LLA P 
Sbjct: 60  DDYPMEAPKVRF-LTRIYHPNID-RLGRICLDVLKNN-WSPALQIRTVLLSIQALLASPN 116

Query: 122 VDSPLDVDLS 131
            + PL  D++
Sbjct: 117 PNDPLANDVA 126

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 66.6 bits (161), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 3/114 (2%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L +WEA   G E T +    F + I  P+ YP++PPK  F P    HPNI + +G VCL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 59

Query: 93  DLLKHEA-WSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
            +L  +  W P   L Q+   +  LL  P  +SP      R ++ +   Y+  V
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKV 113

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  ++   +GP+ + Y    F L + +P+ YP EPPK  F    I HPNI    G +CL
Sbjct: 31  NLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNID-RLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAA 140
           D+LK   WSP   +  V+ +I  LLA P  + PL  D++  +  D  A
Sbjct: 89  DVLKTN-WSPALQIRTVLLSIQALLATPNPNDPLANDVAEDWIADEDA 135

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 67.0 bits (162), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  ++   +GPE +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 66.6 bits (161), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  ++   +GPE +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 76

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 77  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 66.6 bits (161), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  ++   +GPE +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRF-LTRIYHPNID-RLGRI 76

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 77  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 67.0 bits (162), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 3/105 (2%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  ++   +GP+ +PY    F L + +P+ YP E PK  F    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRF-LTKIYHPNID-KLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTD 137
           D+LK   WSP   +  V+ ++  LLA P  + PL  D++  +  D
Sbjct: 89  DVLKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKD 132

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 66.6 bits (161), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  ++   +GPE +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 76

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 77  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 69/140 (49%), Gaps = 8/140 (5%)

Query: 6   REYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYP 65
           R  KQ  ++L   P     A   EEN  L  ++   +GP+ +PY    F L + +P+ YP
Sbjct: 6   RCSKQETERLVSDPVPGITAEPHEEN--LRYFQVTIEGPQQSPYENGVFKLELFLPDDYP 63

Query: 66  NEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSP 125
            E PK  F    I HPNI    G +CLD+LK   WSP   +  V+ ++  LLA P  + P
Sbjct: 64  MEAPKVRF-LTKIYHPNID-RLGRICLDVLKTN-WSPALQIRTVLLSVQALLASPNPNDP 120

Query: 126 LDVDLSRLYTTDRAAYDGVV 145
           L  D++  +  +    DG +
Sbjct: 121 LANDVAEDWIKNE---DGAI 137

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  ++   +GPE +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 25  DDNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 82

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           CLD+LK   WSP   +  V+ ++  LLA P  + PL  D++
Sbjct: 83  CLDILKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 65.5 bits (158), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  ++   +GP+ +PY    F L + +P+ YP E PK  F    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAA 140
           D+LK   WSP   +  V+ ++  LLA P  + PL  D++  +  +  A
Sbjct: 89  DVLKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIRNEDA 135

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 3/99 (3%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  ++   +GP+ +PY    F L + +P+ YP E PK  F    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           D+LK+  WSP   +  V+ ++  LLA P  + PL  D++
Sbjct: 89  DVLKNN-WSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  +    +GPE +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 29  DDNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRF-LTKIYHPNID-RLGRI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 58/109 (53%), Gaps = 7/109 (6%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPP--KCSFPPHHICHPNIKWSTGEVCLDLLKHEAWS 101
           P+   YAG T+   + + +TYP EPP  KC    H I HPNI    G VCL+LL+ E W+
Sbjct: 67  PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCM---HRIYHPNIDID-GNVCLNLLR-EDWT 121

Query: 102 PVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLR 150
           P  ++  ++  I  L  EP    PL+ D ++    D   ++  VN+ LR
Sbjct: 122 PALDIQSIIIGILFLFHEPNGRDPLNKDAAKTLIEDPLRFENKVNHSLR 170

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 64.7 bits (156), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 56/110 (50%), Gaps = 3/110 (2%)

Query: 31  NGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           + +L  +    +GP  +PY    F L + +P+ YP E PK  F    I HPNI    G +
Sbjct: 29  DDNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 91  CLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAA 140
           CLD+LK   WSP   +  V+ +I  LLA P  + PL  D++  +  +  A
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEA 135

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 64.3 bits (155), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  +    +GP  +PY    F L + +P+ YP E PK  F    I HPNI    G +CL
Sbjct: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAA 140
           D+LK   WSP   +  V+ ++  LLA P  + PL  D++  +  + A 
Sbjct: 89  DVLKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAG 135

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 63.5 bits (153), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (54%), Gaps = 3/99 (3%)

Query: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92
           +L  +    +GP+++ Y    F L + +P+ YP E PK  F    I HPNI    G +CL
Sbjct: 31  NLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLS 131
           D+LK+  WSP   +  V+ +I  LLA P  + PL  D++
Sbjct: 89  DVLKNN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P ++SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P ++SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 72/155 (46%), Gaps = 19/155 (12%)

Query: 4   ILREYKQLQKQLALHPAV-LSLAPVGEENGDLHRWEAHFQ-GPENTPYAGFTFTLRINVP 61
           +LR++++L+      P   + L     E  ++  WE  F    E++ Y G   T  +  P
Sbjct: 13  LLRQFRELRDPRRRMPCFHIELV----EKSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFP 68

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL-----------KHEAWSPVYNLLQVV 110
             +P  PP   F P  I HPN+ +S G +C+ +L             E WSPV  +  V+
Sbjct: 69  RNFPFSPPTFLFCPP-IYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETVL 126

Query: 111 EAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
            +I +LL +P V SP +VD +  Y   R  Y+  V
Sbjct: 127 ISIISLLDDPNVSSPANVDAAVEYKNARQEYNKRV 161

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 13/121 (10%)

Query: 45  ENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH------- 97
           E++ Y G  F  ++  PE +P  PP+  F P  I HPN+ +  G +C+ +L         
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQGGDPMTD 108

Query: 98  ----EAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRP 153
               E WSPV  +  V+ +I +LL +P + SP +VD +  Y  ++  Y   V   +    
Sbjct: 109 EPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNQEQYKQRVKMEVERSK 168

Query: 154 Q 154
           Q
Sbjct: 169 Q 169

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P ++SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 52  FTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVE 111
           F F+L  N  + YP EPPK     + I HPNI    G+VCL++L+ E WSP  +L  ++ 
Sbjct: 87  FRFSLEFN--DNYPMEPPKV-VCRNRIYHPNIDVQ-GKVCLNILR-EDWSPALDLQSIIV 141

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
            +  L  EP    PL+ D + +++ D  A+   V
Sbjct: 142 GLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFV 175

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 5/93 (5%)

Query: 49  YAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQ 108
           +   +F+L  N  E YP EPPK +     I HPNI  + G VCL++L+ E WSP  +L  
Sbjct: 76  HGSISFSLDFN--EVYPIEPPKVTCL-KKIFHPNIDLN-GNVCLNILR-EDWSPALDLQS 130

Query: 109 VVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           ++  +  L  EP  + PL+ D ++L+  D+  +
Sbjct: 131 IIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKKF 163

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELEDDSNIFIWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P ++SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 75/163 (46%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E + ++  W   F    E++ Y G  F   +  P 
Sbjct: 13  LLRQYRELTDP---KRAIPSFHIELENDSNIFVWHIGFIILNEDSIYNGGYFKSEMKFPS 69

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL-----------KHEAWSPVYNLLQVVE 111
            +P  PP   F P  I HPN+ +  G++C+ +L            +E WSPV ++  V+ 
Sbjct: 70  NFPYSPPHFKFVPP-IYHPNV-YKDGKLCISILHQSGDSMTSEPDNETWSPVQSVESVLI 127

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD S  Y  +   Y   V  ++    Q
Sbjct: 128 SIISLLEDPNISSPANVDASVEYRKNFQEYKRKVRLQVERSKQ 170

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 3/103 (2%)

Query: 43  GPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSP 102
            P+   Y   +    ++  E YP EPPK +     I HPNI +  G VCL++L+ E WSP
Sbjct: 68  NPDEGYYTHGSINFSLDFNEVYPIEPPKVACL-KRIFHPNIDFK-GNVCLNILR-EDWSP 124

Query: 103 VYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             +L  +V  +  L  EP  + PL+ D ++L   D   +   V
Sbjct: 125 ALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLLCQDEKEFAEAV 167

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 17/150 (11%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     +++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDA---KKAIPSFHIELDDDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL-----------KHEAWSPVYNLLQVVE 111
            +P  PP   F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPTFRFTPA-IYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           +I +LL +P + SP +VD +  Y  +   Y
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNADQY 156

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     +++ +L  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 7/108 (6%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPPK--CSFPPHHICHPNIKWSTGEVCLDLLKHEAWS 101
           P+   Y G  FT ++   + YP EPP   C+     + HPNI    G+VCL++L+ E WS
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIEPPTVICT---SKLYHPNIDID-GKVCLNILR-EDWS 127

Query: 102 PVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149
           P  ++  ++  +  LL EP    PL+ D + + +TD A +  +VN  +
Sbjct: 128 PALDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLSTDTARFASLVNRSM 175

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 57.4 bits (137), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E + Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELEDDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRVKMEVERSKQ 169

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     +++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTD---AKKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL-----------KHEAWSPVYNLLQVVE 111
            +P  PP   F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPTFRFTPA-IYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNIEQYKQRVQLEVERSKQ 169

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     +++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP   F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPNFRFTPA-IYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V+  +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVHLEVERSKQ 169

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 69/143 (48%), Gaps = 17/143 (11%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLY 134
           +I +LL +P + SP +VD +  Y
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDY 149

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 68/143 (47%), Gaps = 17/143 (11%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L       P   S     E++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDPRKCIP---SFNIELEDDSNIFVWNVGVMVLNEDSLYHGGYFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLY 134
           +I +LL +P + SP +VD +  Y
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDY 149

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 49  YAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQ 108
           +    F L  N  E YP EPPK +     I HPNI    G VCL++L+ E WSP  +L  
Sbjct: 76  HGSINFGLDFN--EVYPIEPPKVACL-KKIFHPNIDLK-GNVCLNILR-EDWSPALDLQS 130

Query: 109 VVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
           ++  +  L  EP  + PL+ D ++L+  +   +  +V
Sbjct: 131 IITGLLFLFLEPNPNDPLNKDAAKLFCQNEKKFAEIV 167

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     +++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP   F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPSFRFTPA-IYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKLEVERSKQ 169

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E + Y G  F  ++  P+
Sbjct: 11  LLRQYRELTDP---KKAIPSFHIALEDDSNIFLWNIGVMVLNEESIYHGGYFKAQMKFPD 67

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL-----------KHEAWSPVYNLLQVVE 111
            +P  PP   F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 68  DFPFSPPTFRFTPA-IYHPNV-YRDGRLCISILHQSGNPTSDEPDEETWSPVQTVESVLI 125

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 126 SIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKVKLEVERSKQ 168

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E++ Y G  F  ++  P+
Sbjct: 12  LLRQYRELTNP---KKAIPSFHINLEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPD 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCL-----------DLLKHEAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+           D L  E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKMEVERSKQ 169

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     +++ ++  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL-----------KHEAWSPVYNLLQVVE 111
            +P  PP   F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPSFRFTPA-IYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKLEVERSKQ 169

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (51%), Gaps = 3/102 (2%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPV 103
           P+   Y G  F       ETYP +PPK     + I HPNI    G++CL++L+ E WSP 
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKV-ICNNKIFHPNID-PHGKICLNILR-EDWSPA 127

Query: 104 YNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
            +L  +V  + +L  EP  + PL+ + + +   D+  +  +V
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLV 169

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 70/150 (46%), Gaps = 17/150 (11%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E+  +L  W        E++ Y G  F  ++  PE
Sbjct: 12  LLRQYRELTDP---RKAIPSFHIELEDESNLFIWNIGVMVLNEDSIYHGGYFKSQMRFPE 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPTTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           +I +LL +P + SP +VD +  Y  +   Y
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPEQY 156

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 17/138 (12%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        E++ Y G  F  ++  P+
Sbjct: 12  LLRQYRELTDP---KKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPD 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVD 129
           +I +LL +P + SP +VD
Sbjct: 127 SIVSLLEDPNISSPANVD 144

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPV 103
           P+   Y    F   +   ++YP EPP   F    I HPNI  + G++CL++L+ E WSPV
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFL-KKIYHPNIDLN-GKICLNILR-EDWSPV 131

Query: 104 YNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLR 150
            +L  ++  +  L  EP    PL++    L   ++  +  +V   +R
Sbjct: 132 LDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKENKQEFIDIVRLTMR 178

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     +++ ++  W        E++ Y G  F  ++  P+
Sbjct: 12  LLRQYRELTDP---KKAIPSFNIELDDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPD 68

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-----------EAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G +C+ +L             E WSPV  +  V+ 
Sbjct: 69  DFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRLRTRPQ 154
           +I +LL +P + SP +VD +  Y  +   Y   V   +    Q
Sbjct: 127 SIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRVKMEVERSKQ 169

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 55.1 bits (131), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 4   ILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVPE 62
           +LR+Y++L        A+ S     E++ ++  W        +++ Y G  F  ++  P+
Sbjct: 19  LLRQYRELTDP---KRAIPSFHIELEDDSNIFTWNIGVMVLNKDSIYHGGYFQSQMKFPK 75

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL-----------KHEAWSPVYNLLQVVE 111
            +P  PP+  F P  I HPN+ +  G++C+ +L            +E WSPV ++  V+ 
Sbjct: 76  DFPFSPPQFKFIPP-IYHPNV-YRDGKLCISILHQSGDAMTSEPDNETWSPVQSVESVLI 133

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
           +I +LL +P V SP +VD +  Y  +   Y
Sbjct: 134 SIVSLLEDPNVSSPANVDAAVEYRKNYNEY 163

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 55.1 bits (131), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 73/151 (48%), Gaps = 19/151 (12%)

Query: 4   ILREYKQLQKQLALHPAV-LSLAPVGEENGDLHRWEAHFQG-PENTPYAGFTFTLRINVP 61
           +LR+Y++L       P+  ++L    E++ ++  W        E + Y G  F  ++  P
Sbjct: 12  LLRQYRELTDPKKSIPSFHINL----EDDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFP 67

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTGEVCL-----------DLLKHEAWSPVYNLLQVV 110
           + +P  PP+  F P  I HPN+ +  G +C+           D L  E WSPV ++  V+
Sbjct: 68  DDFPFSPPQFRFTPA-IYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSPVQSVESVL 125

Query: 111 EAISTLLAEPGVDSPLDVDLSRLYTTDRAAY 141
            +I +LL +P + SP +VD +  Y  +   Y
Sbjct: 126 ISIVSLLEDPNISSPANVDAAVDYRKNPEQY 156

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 53.9 bits (128), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 3/103 (2%)

Query: 43  GPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSP 102
            P   PY G  F   +   E YP EPP  +   + I HPNI  + G++CL++L+ E WSP
Sbjct: 76  SPREGPYLGGAFKFNLKFNEMYPIEPPS-AICLNKIFHPNIDLN-GKICLNILR-EDWSP 132

Query: 103 VYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
             +L  +V  +  L  +     PL+   + +   DR  +  +V
Sbjct: 133 ALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLANDRNRFCELV 175

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 49  YAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQ 108
           Y    F L  N  E YP EPPK       I HPNI    G VCL++L+ E WSP  +L  
Sbjct: 77  YGSINFNLDFN--EVYPIEPPKV-VCLKKIFHPNIDLK-GNVCLNILR-EDWSPALDLQS 131

Query: 109 VVEAISTLLAEPGVDSPLDVDLSRL 133
           ++  +  L  EP  + PL+ D ++L
Sbjct: 132 IITGLLFLFLEPNPNDPLNKDAAKL 156

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 52  FTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVE 111
           F F   IN  E YP EPPK       I HPNI   TGE+CL++L+ E WSP  +L  V+ 
Sbjct: 91  FRFQFTIN--ENYPIEPPKVVCLTK-IYHPNIN-RTGEICLNILR-EDWSPALDLQSVII 145

Query: 112 AISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVV 145
            +  L  EP    PL+   +     D A +  +V
Sbjct: 146 GLLFLFIEPNPKDPLNKQAADTLLHDPAVFKHIV 179

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 5/99 (5%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPV 103
           P+   Y G  FT  +   E YP EPPK     + I HPNI  + G VCL++L+ + W+P 
Sbjct: 61  PDEGYYKGGNFTFELLFNEQYPMEPPKVKC-LNRIYHPNID-TDGRVCLNILRQD-WTPA 117

Query: 104 YNLLQVVEAISTLLAE-PGVDSPLDVDLSRLYTTDRAAY 141
            +L  V+  +  L  E  GVD PL+   +  +  +R  +
Sbjct: 118 LDLQSVIIGLLFLFLEISGVD-PLNKQAAETFNRNRQNF 155

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 53/111 (47%), Gaps = 10/111 (9%)

Query: 19  PAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPP--KCSFPPH 76
           P  +S    G E+     +  H   P+   Y    F   +   +TYP EPP  KC    +
Sbjct: 46  PPTVSADTSGLESSSTLFFTIH---PDEGYYKPGYFRFSLFFKDTYPIEPPAVKCV---N 99

Query: 77  HICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLD 127
            I HPNI  + G VCL++L+ E WSPV +L  VV  +  L  EP    PL+
Sbjct: 100 KIYHPNID-TQGNVCLNILR-EDWSPVLDLQSVVIGLLFLFLEPNDKDPLN 148

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 47/86 (54%), Gaps = 7/86 (8%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPP--KCSFPPHHICHPNIKWSTGEVCLDLLKHEAWS 101
           PE   Y G  F   +   +TYP EPP  KC    + I HPNI +S G +CL++L+ E WS
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCL---NTIYHPNIDYS-GNICLNVLR-EDWS 137

Query: 102 PVYNLLQVVEAISTLLAEPGVDSPLD 127
           PV +L  VV  +  L  EP    PL+
Sbjct: 138 PVMDLQTVVLGLLFLFLEPNGSDPLN 163

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPV 103
           P+   Y G  F   +   E+YP +PP        I HPNI  + G++CL++L+ E WSP 
Sbjct: 53  PDEGFYNGGRFKFNLTTSESYPIDPPSV-VCLQKIYHPNIDLN-GKICLNILR-EDWSPA 109

Query: 104 YNLLQVVEAISTLLAEPGVDSPLDVD 129
            ++  V+  +  L  EP    PL+ D
Sbjct: 110 LDIQSVIVGLLFLFLEPNPRDPLNKD 135

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 54/124 (43%), Gaps = 25/124 (20%)

Query: 43  GPENTPYAGFTFTLRINVPETYPNEPP--KCSFPPHHICHPNIKWSTGEVCLDLLKHEAW 100
            P+   Y    FT  +   E YP EPP  +C    + I HPNI    G++CL++L+ E W
Sbjct: 69  SPDEGFYRKGHFTFEMTFTEKYPIEPPQVRCM---NQIFHPNIDLQ-GKICLNILR-EDW 123

Query: 101 SPVYNLLQVVEAISTLLAEPGVDSPLDVD-----------LSRL-------YTTDRAAYD 142
           SP  +L  V+  I  L  E     PL+              SRL       Y+ D   YD
Sbjct: 124 SPALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDENPNKFSRLVQQTMAGYSLDGQHYD 183

Query: 143 GVVN 146
            V+N
Sbjct: 184 NVLN 187

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 44  PENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPV 103
           P+   Y    F       +TYP EPPK +     I HPNI    G VCL++L+ E WSPV
Sbjct: 68  PDEGYYKCGHFKFCATFKDTYPIEPPKVTLL-SKIFHPNIDLQ-GNVCLNILR-EDWSPV 124

Query: 104 YNLLQVVEAISTLLAEPGVDSPLD 127
            ++  ++  +  L  EP    PL+
Sbjct: 125 LDVQSILIGLLMLFLEPNATDPLN 148

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 48.5 bits (114), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 50  AGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQV 109
             F F L+ N  E YP EPP      + I HPNI    G++CL++L+ E WSP  +L  +
Sbjct: 84  GKFKFDLKFN--ENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDWSPALDLNSI 138

Query: 110 VEAISTLLAEPGVDSPL----------DVDLSRLYTTDRAAYDGVVNYR 148
           +  +  L  E     PL          D D+ R Y  D  A   + N +
Sbjct: 139 IIGLLYLFLECNAKDPLNKEAANILHSDEDMFRKYVRDSMAGKKLFNIQ 187

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 48.5 bits (114), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 50  AGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQV 109
             F F L+ N  E YP EPP      + I HPNI    G++CL++L+ E WSP  +L  +
Sbjct: 85  GKFKFDLKFN--ENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDWSPALDLNSI 139

Query: 110 VEAISTLLAEPGVDSPL----------DVDLSRLYTTDRAAYDGVVNYR 148
           +  +  L  E     PL          D D+ R Y  D  A   + N +
Sbjct: 140 IIGLLYLFLECNAKDPLNKEAANILHSDEDMFRKYVRDSMAGKKLFNIQ 188

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 43  GPENTPYAGFTFTLRINVPETYPNEPP--KCSFPPHHICHPNIKWSTGEVCLDLLKHEAW 100
            P+   Y    F   ++  ++YP +PP  KC      I HPNI ++ G +CL++L+ E W
Sbjct: 149 SPDEGFYKHGHFGFSVSFKDSYPIDPPIVKCLTT---IYHPNIDYN-GNICLNVLR-EDW 203

Query: 101 SPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTD 137
           +PV +L  +V  +  L  EP    PL+   +     D
Sbjct: 204 TPVLDLQTIVIGLLFLFLEPNPKDPLNKHAAHTMVKD 240

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 54/120 (45%), Gaps = 4/120 (3%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K   L P   S      ++  + RW     GP ++ +    +++ I    
Sbjct: 9   RLLEELEKGEK--GLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSVSIECGP 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-EAWSPVYNLLQVVEAISTLLAEPG 121
            YP+EPP  +F    I  P +  STGEV  +     + W  +YN+  ++  +   +A P 
Sbjct: 67  KYPDEPPTITF-ISKINLPCVDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRKEMASPA 125

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 51/119 (42%), Gaps = 3/119 (2%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K     P   S      ++  + +W     GP ++ +    ++L I+   
Sbjct: 9   RLLEELEKGEKGFG--PESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGP 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
            YP+ PPK +F    I  P +  +TGEV  D      W   Y +  ++  +   +A P 
Sbjct: 67  NYPDSPPKVTF-ISKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATPA 124

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 50/119 (42%), Gaps = 3/119 (2%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K     P   S      ++  + +W     GP ++ +    ++L I    
Sbjct: 9   RLLEELEKGEK--GFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIECGP 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPG 121
            YP+ PPK +F    I  P +  +TGE+  D      W   Y +  ++  +   +A P 
Sbjct: 67  NYPDSPPKVTF-ISKINLPCVNQTTGEIQTDFHTLRDWKRAYTMETLLLDLRKEMATPA 124

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 4/119 (3%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K   L P   S      ++  + +W     GP ++ +    +++ I    
Sbjct: 9   RLLEELEKGEK--GLGPESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSVLIECGP 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-EAWSPVYNLLQVVEAISTLLAEP 120
           +YP+EPPK  F    I  P +  +TGEV  +     + W   Y +  V+  +   +A P
Sbjct: 67  SYPDEPPKVKF-VSKINLPCVNSTTGEVVKEKFHTLKEWKRSYTMETVLLELRKEMATP 124

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 1/88 (1%)

Query: 34  LHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLD 93
           + +W     GP ++ +    ++L I     YP+ PPK +F    I  P +  +TGEV  D
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTF-ISKINLPCVNPTTGEVQTD 59

Query: 94  LLKHEAWSPVYNLLQVVEAISTLLAEPG 121
                 W   Y +  ++  +   +A P 
Sbjct: 60  FHTLRGWKRAYTMETLLLDLRKEMATPA 87

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 17/155 (10%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +    +P    LA   E+N  +  W     GP +TPY G  +   +  P
Sbjct: 8   KRLTKEYKLMVE----NPPPYILARPNEDN--ILEWHYIITGPADTPYKGGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSF-PPHHICHPNIKWSTGEVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP      P+    PN +     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  SDYPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

Query: 119 --EPGVDSPLDVD-LSRLYTTDRAAYDGVVNYRLR 150
             E    S    D   ++   +  +Y+   N R +
Sbjct: 117 SDEATTGSITTSDHQKKMLARNSISYNSFQNVRFK 151

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 55/120 (45%), Gaps = 14/120 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +    +P    +A   EEN  +  W     GP +TPY G  +   +  P
Sbjct: 8   KRLTKEYKMMVE----NPPPFIIARPNEEN--ILEWHYVISGPPDTPYDGGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP        +  PN ++     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  SDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMT 116

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 14/120 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +    +P    LA   E+N  +  W     GP +TPY G  +   +  P
Sbjct: 8   KRLTKEYKLMVE----NPPPYILARPNEDN--ILEWHYIITGPADTPYKGGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSF-PPHHICHPNIKWSTGEVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP      P+    PN +     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  SDYPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 66/155 (42%), Gaps = 17/155 (10%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +    +P    LA   E+N  +  W     GP  TPY G  +   +  P
Sbjct: 8   KRLTKEYKLMVE----NPPPYILARPNEDN--ILEWHYIITGPAETPYKGGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSF-PPHHICHPNIKWSTGEVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP      P+    PN +     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  SDYPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

Query: 119 --EPGVDSPLDVD-LSRLYTTDRAAYDGVVNYRLR 150
             E    S    D   ++   +  +Y+   N R +
Sbjct: 117 SDEATTGSVTTSDHQKKILAKNSLSYNAFQNLRFK 151

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 54/119 (45%), Gaps = 14/119 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK +      +P    +A   E+N  +  W     GP +TPY    +   +  P
Sbjct: 8   KRLTKEYKNIVN----NPPPFIIAAPHEDN--ILEWHYVITGPPSTPYENGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLL 117
             YP  PP        +  PN ++     +CL +  +  EAW+P ++++ ++  + + +
Sbjct: 62  SDYPFNPPAI-----RMITPNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 50/120 (41%), Gaps = 4/120 (3%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K L   P   S      ++  +  W     GP ++ +    +++ I    
Sbjct: 9   RLLEELEKGEKGLG--PESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIECGP 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-EAWSPVYNLLQVVEAISTLLAEPG 121
            YP+EPPK  F    +  P +  +TGEV   +      W   Y +  ++  +   +A P 
Sbjct: 67  NYPDEPPKIKF-VSKVNVPCVDSTTGEVKSSVFHTLRDWKRAYTMETLLLDLRKEMATPA 125

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 54/119 (45%), Gaps = 14/119 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK +   +   P  ++  P      ++  W     GP++TPY G  +   +  P
Sbjct: 8   KRLTKEYKMM---VETPPPYITARP---NESNILEWHYIIIGPQDTPYDGGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLL 117
             YP +PP        +  PN ++     +CL +  +  + W+P +++  ++  + + +
Sbjct: 62  SDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 35.4 bits (80), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 50/118 (42%), Gaps = 3/118 (2%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K +   P   S      ++  +  W     GP ++ ++   ++L I    
Sbjct: 9   RLLEELEKGEKGMG--PESCSYGLADSDDISMTNWNGTILGPPHSNHSNRIYSLSIECGP 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120
           +YP+EPP   F    I    +  +TG V  D    + W   Y +  ++  +   +A P
Sbjct: 67  SYPDEPPTLKF-ISKINLNCVDSATGVVKPDFNPIKNWKRSYTMETILLELRKEMAHP 123

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 138

 Score = 35.4 bits (80), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 5/94 (5%)

Query: 1  MRRILREYKQLQK----QLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTL 56
          M R+ R ++ L++    +  + P   S      ++  +  W     GP ++ +    +++
Sbjct: 1  MSRVPRSFRLLEELEKGEKGMGPESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIYSV 60

Query: 57 RINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           I   E YP++PPK  F    +  P +  +TGEV
Sbjct: 61 AIECGEAYPDQPPKIRF-LSKVNLPCVDQNTGEV 93

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +     P  +   P  E   ++  W     GP +TPY G  +   ++ P
Sbjct: 8   KRLSKEYKMIMENT---PPYIIAVPNDE---NILEWHYVITGPPDTPYEGGQYHGTLHFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWST-GEVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP        I  PN ++     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  PEYPFKPPAI-----RISTPNGRFKQHTRLCLSMSDYHPDTWNPSWSVATILNGLLSFMT 116

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
          {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 35.0 bits (79), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 1  MRRILREYKQLQK----QLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTL 56
          M R+ R ++ L++    +  L P   S      E+  +  W     GP ++ +    +++
Sbjct: 1  MSRVPRSFRLLEELEKGEKGLGPESCSYGLANGEDITMTTWNGTILGPPHSNHENRIYSV 60

Query: 57 RINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLL 95
           I   + YP++PP   F    I  P +  +TGEV  ++ 
Sbjct: 61 VIKCGDEYPDKPPTVKF-ISKINLPCVDQATGEVETNMF 98

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 35.8 bits (81), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 14/120 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK L   +   P  + LA   E+N  +  W     GP +TPY G  +   +  P
Sbjct: 8   KRLTKEYKLL---VESSPPFI-LARPNEDN--ILEWHYIITGPPDTPYDGGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP        +  PN ++     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  NDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 34.3 bits (77), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 1/88 (1%)

Query: 34  LHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLD 93
           + +W     GP ++ +    ++L I     YP+ PP  +F    I  P +  +TGEV  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTF-ISKINLPCVSQTTGEVQTN 59

Query: 94  LLKHEAWSPVYNLLQVVEAISTLLAEPG 121
                 W   Y +  ++  +   +A P 
Sbjct: 60  FHTLRDWKRAYTMETLLLDLRKEMATPA 87

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 35.4 bits (80), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +    +P    LA   E+N  +  W     GP +TPY    +   +  P
Sbjct: 8   KRLTKEYKLMVE----NPPPYILARPNEDN--ILEWHYIITGPADTPYKAGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSF-PPHHICHPNIKWSTGEVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP      P+    PN +     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  SDYPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 34.3 bits (77), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 2/86 (2%)

Query: 37  WEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLK 96
           W     GP ++ +    +++ +     YP+EPPK  F    I  P +  +TGEV  D   
Sbjct: 4   WNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKF-ISKINLPCVNQTTGEVKRDQFS 62

Query: 97  H-EAWSPVYNLLQVVEAISTLLAEPG 121
               W   YN+  ++  +   +A P 
Sbjct: 63  TLRDWKRSYNMETLLLDLRKEMALPA 88

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 34.7 bits (78), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 47/120 (39%), Gaps = 4/120 (3%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K L   P   S      ++  +  W     GP ++ +    ++L I    
Sbjct: 9   RLLEELEKGEKGLG--PESCSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIECGP 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-EAWSPVYNLLQVVEAISTLLAEPG 121
            YP+ PP   F    I  P +   TG+V          W   YN+  ++  +   +A P 
Sbjct: 67  NYPDHPPTIKF-ISKINLPCVDSKTGQVTPSTFHTLRDWKRAYNMETILLELRKEMATPA 125

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 66/155 (42%), Gaps = 17/155 (10%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
            +R+ +EYK L +     P    LA   E+N  +  W     GP ++PY+   +   +  
Sbjct: 7   FKRLTKEYKTLTET----PPPYILARPNEDN--ILEWHYIITGPPDSPYSEGQYHGTLTF 60

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLL 117
           P  YP +PP        +  PN ++     +CL +  +  + W+P +++  ++  + + +
Sbjct: 61  PTDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDLWNPSWSVSTILTGLLSFM 115

Query: 118 A--EPGVDSPLDVD-LSRLYTTDRAAYDGVVNYRL 149
              E    S +  D   R +  +  A++   N R 
Sbjct: 116 TGDEATTGSIVTTDSQKRQFAMNSVAFNNRQNTRF 150

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 33.9 bits (76), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 5/94 (5%)

Query: 1  MRRILREYKQLQK----QLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTL 56
          M +I R ++ L++    +    P   S      ++  +  W     GP ++ +    ++L
Sbjct: 1  MSKIPRSFRLLEELEKGEKGFGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSL 60

Query: 57 RINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           I     YP+EPPK  F    +  P I   TGE+
Sbjct: 61 EIVCGPNYPDEPPKVKF-VSKVNLPCIDDKTGEI 93

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 34.7 bits (78), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 54/120 (45%), Gaps = 14/120 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +    +P    LA   E N  +  W     GP +TPY G  +   +  P
Sbjct: 8   KRLSKEYKLIIE----NPTPYILARPNENN--ILEWHYIITGPPDTPYVGGQYHGTLTFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLLA 118
             YP +PP        +  PN ++     +CL +  +  + W+P +++  ++  + + + 
Sbjct: 62  SDYPFKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFMT 116

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 140

 Score = 33.9 bits (76), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 3  RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
          R+L E ++ +K L   P   S      ++  +  W     GP ++ +    +++ I    
Sbjct: 11 RLLEELEKGEKGLG--PESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAIECGA 68

Query: 63 TYPNEPPKCSFPPHHICHPNIKWSTGEVCLD 93
           YP+EPP   F    I  P +  +TGEV  D
Sbjct: 69 NYPDEPPLIKF-VSKINLPCVDQTTGEVKHD 98

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 34.3 bits (77), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 2   RRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVP 61
           +R+ +EYK + +    +P    +A   E+N  +  W     GP +TPY G  +   +  P
Sbjct: 8   KRLTKEYKSMVE----NPPPFIIAQPNEDN--ILEWHYVITGPPDTPYEGGQYHGTLVFP 61

Query: 62  ETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLL 117
             YP +PP        +  P+ ++     +CL +  +  + W+P +++  ++  + + +
Sbjct: 62  SDYPFKPPAI-----RMVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSVSTILTGLLSFM 115

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 34.3 bits (77), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 56/121 (46%), Gaps = 14/121 (11%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++R+ +EYK + +    +P    +A   E+N  +  W     GP +TPY+   +   +  
Sbjct: 7   LKRLTKEYKLIVE----NPPPYIVARPNEDN--ILEWHYVITGPSDTPYSSGQYHGTLTF 60

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLL 117
           P  YP +PP        +  PN ++     +CL +  +  + W+P +++  ++  + + +
Sbjct: 61  PSDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFM 115

Query: 118 A 118
            
Sbjct: 116 T 116

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa]
          {ON} Syntenic homolog of Saccharomyces cerevisiae
          YGL087C (MMS2); 1-intron
          Length = 138

 Score = 33.5 bits (75), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query: 3  RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
          R+L E ++ +K +   P   S      ++  +  W     GP ++ +    +++ I    
Sbjct: 9  RLLEELEKGEKGMG--PESCSYGLADGDDISMTHWNGTILGPPHSSHENRIYSVVIECGA 66

Query: 63 TYPNEPPKCSFPPHHICHPNIKWSTGEV 90
           YP+ PPK  F    I  P +  STGEV
Sbjct: 67 EYPDRPPKVRF-ISRINLPCVDPSTGEV 93

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 68/158 (43%), Gaps = 21/158 (13%)

Query: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60
           ++R+ +EYK + +    +P    LA   E+N  +  W     GP +TPY    +   +  
Sbjct: 7   LKRLTKEYKLMVE----NPPPYILARPNEDN--ILEWHYIITGPPDTPYKDGQYHGTLTF 60

Query: 61  PETYPNEPPKCSFPPHHICHPNIKWSTG-EVCLDLLKH--EAWSPVYNLLQVVEAISTLL 117
           P  YP +PP        +  PN ++     +CL +  +  + W+P +++  ++  + + +
Sbjct: 61  PSDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDLWNPGWSVNTILNGLLSFM 115

Query: 118 AEPGVDSPLDVDLS-----RLYTTDRAAYDGVVNYRLR 150
              G DS     ++     RL   +   ++   N R +
Sbjct: 116 T--GDDSTTGSIVTTDSQKRLLAKNSVEFNNRQNLRFK 151

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
          (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 32.3 bits (72), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 37 WEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEV 90
          W     GP ++ +A   ++L I     YP+EPPK  F    +  P +  +TGEV
Sbjct: 4  WNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKF-ISRVNLPCVDVNTGEV 56

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 32.7 bits (73), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 48/120 (40%), Gaps = 4/120 (3%)

Query: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62
           R+L E ++ +K     P   S      ++  + +W     GP ++ +    ++L I   +
Sbjct: 9   RLLEELEKGEK--GFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLEIVCGD 66

Query: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKH-EAWSPVYNLLQVVEAISTLLAEPG 121
            YP+EPP   F    +  P +  +TG V  +       W   Y +  V+  +   +  P 
Sbjct: 67  RYPDEPPLVKF-ISKVNLPCVDQTTGVVSAEKFHTLRDWKRSYTMQTVLLDLRKEMGTPA 125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,438,688
Number of extensions: 790231
Number of successful extensions: 2144
Number of sequences better than 10.0: 272
Number of HSP's gapped: 1799
Number of HSP's successfully gapped: 272
Length of query: 155
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 55
Effective length of database: 42,014,799
Effective search space: 2310813945
Effective search space used: 2310813945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)