Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR313C3.494ON28328314770.0
KLTH0F14872g3.494ON28028311861e-165
SAKL0F02728g3.494ON28228511851e-165
CAGL0I10472g3.494ON28828711381e-158
TDEL0D056203.494ON27928111251e-156
Kwal_55.212403.494ON28327011231e-156
TPHA0D032903.494ON28528611211e-155
Ecym_12353.494ON28328611121e-154
Suva_7.4203.494ON28728611121e-154
Smik_6.2283.494ON28728611111e-154
Kpol_1017.53.494ON28328611101e-154
NCAS0E007903.494ON32728411061e-152
TBLA0D029503.494ON28228110961e-151
NDAI0G009203.494ON29627910911e-151
YGR132C (PHB1)3.494ON28728610871e-150
KAFR0C019803.494ON28326910661e-147
Skud_7.4433.494ON28728610621e-146
ZYRO0D09900g3.494ON28328310421e-143
KNAG0B007903.494ON28428710131e-139
KLLA0D16302g3.494ON2262179071e-123
KAFR0B042505.98ON3102567533e-99
YGR231C (PHB2)5.98ON3102317457e-98
TBLA0H022205.98ON3072317431e-97
Smik_16.755.98ON3102317422e-97
ADL141W5.98ON3072317403e-97
NCAS0F006005.98ON3132537403e-97
CAGL0L06490g5.98ON3132317395e-97
Skud_7.5655.98ON3102347395e-97
KNAG0A015805.98ON2882537341e-96
Suva_7.5235.98ON3102347342e-96
SAKL0G15510g5.98ON3082347342e-96
Kwal_27.127475.98ON3072357334e-96
NDAI0D025305.98ON3162537335e-96
Kpol_1050.615.98ON3102537326e-96
TPHA0A050905.98ON3102317319e-96
KLLA0E15731g5.98ON3082357249e-95
KLTH0C01672g5.98ON3072317231e-94
ZYRO0B15136g5.98ON3102317195e-94
TDEL0G012105.98ON3092317152e-93
KLTH0C08008g3.247ON557177693.3
Smik_12.1388.5ON28374674.4
ZYRO0B01078g2.486ON24780658.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR313C
         (283 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   573   0.0  
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   461   e-165
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   461   e-165
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   442   e-158
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   437   e-156
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   437   e-156
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   436   e-155
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   432   e-154
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   432   e-154
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   432   e-154
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   432   e-154
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     430   e-152
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   426   e-151
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     424   e-151
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   423   e-150
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   415   e-147
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   413   e-146
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   405   e-143
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   394   e-139
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   353   e-123
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   294   3e-99
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   291   7e-98
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   290   1e-97
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   290   2e-97
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   289   3e-97
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   289   3e-97
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   289   5e-97
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   289   5e-97
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   287   1e-96
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   287   2e-96
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   287   2e-96
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   286   4e-96
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   286   5e-96
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   286   6e-96
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   286   9e-96
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   283   9e-95
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   283   1e-94
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   281   5e-94
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   280   2e-93
KLTH0C08008g Chr3 (682247..683920) [1674 bp, 557 aa] {ON} simila...    31   3.3  
Smik_12.138 Chr12 (266633..267484) [852 bp, 283 aa] {ON} YLR079W...    30   4.4  
ZYRO0B01078g Chr2 complement(91817..92560) [744 bp, 247 aa] {ON}...    30   8.6  

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/283 (100%), Positives = 283/283 (100%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 241 RRLEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNLGR 283
           RRLEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNLGR
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNLGR 283

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  461 bits (1186), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/283 (78%), Positives = 258/283 (91%), Gaps = 3/283 (1%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MSRLADSL ++ LPL    LA SA+Q+SMYDV+GG+RA+IFDR+SGV+  VVGEGTHFL+
Sbjct: 1   MSRLADSLAKIALPL---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLV 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQKA+++DVRTKP+NIATNTGTKDLQMVSLTLRVLHRPDVM L  IY+ LG DYDERV
Sbjct: 58  PWLQKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLKAIVAQF+A+ELITQRE VSQ+IR EL+ RASEFNIRLEDVSITHMTFG+E
Sbjct: 118 LPSIGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRE 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTKAVEQKQIAQQ+++RA++VVE AEQER+A+VIRAEGEAE+AE+ISKAL KAGDGLL+I
Sbjct: 178 FTKAVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLI 237

Query: 241 RRLEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNLGR 283
           RR+EASK IA+TLANS NVTYLPS   A++ G+PNSLLLNLGR
Sbjct: 238 RRIEASKEIAKTLANSSNVTYLPSSHSASEQGSPNSLLLNLGR 280

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  461 bits (1185), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/285 (78%), Positives = 260/285 (91%), Gaps = 5/285 (1%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MS+LADSL R+ LP   I +AFSA+Q+SMYDV+GGTRA+IFDR+SGV+  V+GEGTHFL+
Sbjct: 1   MSKLADSLARIALP---IGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLV 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQ+AI++DVRTKP+NIATNTGTKDLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERV
Sbjct: 58  PWLQRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLKAIVAQF+A+ELITQRE+VSQ+IR EL+ RA+EFNIRLEDVSITHMTFG+E
Sbjct: 118 LPSIGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGRE 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTKAVEQKQIAQQ+++RAKF+VERAEQER+AAVIRAEGEAE+A++ISKAL KAGDGLL+I
Sbjct: 178 FTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLI 237

Query: 241 RRLEASKGIAETLANSPNVTYLPSKGQ--AADSGAPNSLLLNLGR 283
           RRLEASK IA+TLANS NVTYLPS G   A   G+PNSLLLNLGR
Sbjct: 238 RRLEASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  442 bits (1138), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/287 (74%), Positives = 253/287 (88%), Gaps = 4/287 (1%)

Query: 1   MSRLADSLVRLTLPLT-PIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFL 59
           MS+ A++ VRL   +  P+ +A S +Q+SMYDV+GG+R +IFDR+ GVK DVVGEGTHFL
Sbjct: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60

Query: 60  IPWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDER 119
           +PWLQKAII+DVRTKP++IATNTGTKDLQMVSLTLRVLHRPDVM L  IY+ LG DYDER
Sbjct: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120

Query: 120 VLPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQ 179
           VLPSIGNEVLK+IVAQF+A+ELITQRE+VSQ+IR EL+ RA+EF IRLEDVSITHMTFG 
Sbjct: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180

Query: 180 EFTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLM 239
           EFTKAVEQKQIAQQ+++RA+F+VE+AEQER+A+VIRAEGEAE+AE+ISKAL K GDGLL+
Sbjct: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240

Query: 240 IRRLEASKGIAETLANSPNVTYLPSK---GQAADSGAPNSLLLNLGR 283
           IRRLEASK IA+TLANS N+TYLPS    G   D G+PN+LLLNLGR
Sbjct: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  437 bits (1125), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 210/281 (74%), Positives = 248/281 (88%), Gaps = 3/281 (1%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MSRL ++L R+ +PL    +  S VQ+SMYDVRGG+RA+IFDR+SGV+  VVGEGTHFL+
Sbjct: 1   MSRLVENLARVAIPL---GIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLV 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQKAI++D+RTKP+ IATNTGTKD+QMVSLTLRVLHRPDV+ L RIY+ LG DYDERV
Sbjct: 58  PWLQKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLKAIVAQF+A+ELITQRELVSQ+IR+EL+ RASEF IRLEDVSITHMTFG E
Sbjct: 118 LPSIGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPE 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTKAVEQKQIAQQ+++RAKF+VE+AEQ R+A+VIRAEGEAE+AE+ISKAL +AGDGLL+I
Sbjct: 178 FTKAVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLI 237

Query: 241 RRLEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNL 281
           RRLEASK IA+TLA S N+TYLP K      G+ NSLLLN+
Sbjct: 238 RRLEASKEIAQTLAASSNITYLPGKAHGNTEGSQNSLLLNI 278

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  437 bits (1123), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/270 (78%), Positives = 245/270 (90%), Gaps = 3/270 (1%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MSR ADSL ++ LPL    LA SA+Q+SMYDV+GG+RA+IFDR+SGV+  VVGEGTHFLI
Sbjct: 1   MSRFADSLAKIALPL---GLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLI 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQKA++FDVRTKP+NIATNTGTKDLQMVSLTLRVLHRPDVM L  IY+ LG DYDERV
Sbjct: 58  PWLQKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLK+IVAQF+A+ELITQRE VSQ+IR EL+ RASEFNIRLEDVSITHMTFG++
Sbjct: 118 LPSIGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRD 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTKAVEQKQIAQQ+++RA+FVVE AEQER+A+VIRAEGEAE+AE+ISKAL KAGDGLL+I
Sbjct: 178 FTKAVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLI 237

Query: 241 RRLEASKGIAETLANSPNVTYLPSKGQAAD 270
           RR+EASK IA+TLANS NVTYLPS  Q A+
Sbjct: 238 RRIEASKEIAKTLANSSNVTYLPSNQQGAE 267

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  436 bits (1121), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/286 (73%), Positives = 250/286 (87%), Gaps = 7/286 (2%)

Query: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61
           +++ D L+++ +PL    +A S +Q++MYDV+GG+RA+IFDR+SGVK  V+GEGTHFL P
Sbjct: 3   TKVLDRLIKIAVPL---GIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFP 59

Query: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121
           WLQKAI+FDVRTKP++IATNTGTKDLQMVSLTLRVLHRPDV  L  IY+ LG DYDERVL
Sbjct: 60  WLQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVL 119

Query: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181
           PSIGNEVLKAIVAQF+A+ELITQRE+VS +IR EL+ R++EF I+LEDVSITHMTFGQEF
Sbjct: 120 PSIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEF 179

Query: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241
           TKAVEQKQIAQQ+++RAKF+VERAEQER+AAVIRAEGEAE+AE+ISKAL KAGDGLL+IR
Sbjct: 180 TKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIR 239

Query: 242 RLEASKGIAETLANSPNVTYLP----SKGQAADSGAPNSLLLNLGR 283
           RLEASK IA+TL+ S NVTYLP    S G    +G PNSLLLNLGR
Sbjct: 240 RLEASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  432 bits (1112), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 251/286 (87%), Gaps = 6/286 (2%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MSR  +++  + +P   I +A  A Q  +YDVRGGTRA+IFDR+SGV+  VVGEGTHFLI
Sbjct: 1   MSRFLENIANIAVP---IGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLI 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQKA+I+DVRTKP+NIATNTGTKDLQ+V+LTLRVLHRPDV+AL +IY+ELG DYDERV
Sbjct: 58  PWLQKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLKAIVAQF+A+ELITQRELVSQ+IR ELA+RA  F+I+LEDV+ITHM FG E
Sbjct: 118 LPSIGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHE 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTK+VE+KQIAQQES+RAK++V+ AEQER AAVIRAEG+AEAAE+ISKAL KAGDGLLMI
Sbjct: 178 FTKSVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMI 237

Query: 241 RRLEASKGIAETLANSPNVTYLP--SKGQAADS-GAPNSLLLNLGR 283
           RRLEASK IA+TLA S N+TYLP  SKG + D+ G P+SLLLNLGR
Sbjct: 238 RRLEASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  432 bits (1112), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 209/286 (73%), Positives = 250/286 (87%), Gaps = 7/286 (2%)

Query: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61
           SR  D + ++ LP   I L  S +Q+SMYDV+GG+R +IFDRI+GVK  VVGEGTHFL+P
Sbjct: 5   SRFIDIITKVALP---IGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVP 61

Query: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121
           WLQKAII+DVRTKP++IATNTGT+DLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVL 121

Query: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181
           PSIGNEVLK+IVAQF+A+ELITQRE++SQ+IR EL+ RA+EF I+LEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEF 181

Query: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE+ISKAL K GDGLL+IR
Sbjct: 182 TKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIR 241

Query: 242 RLEASKGIAETLANSPNVTYLPSK----GQAADSGAPNSLLLNLGR 283
           RLEASK IA+TLANS NV YLPS+    G +  SG+PNSLLLN+GR
Sbjct: 242 RLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  432 bits (1111), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 209/286 (73%), Positives = 251/286 (87%), Gaps = 7/286 (2%)

Query: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61
           SRL D + ++ LP+  +A   S +Q+SMYDV+GG+R +IFDRI+GVK  VVGEGTHFL+P
Sbjct: 5   SRLIDIITKVALPIGIVA---SGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVP 61

Query: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121
           WLQKAII+DVRTKP++IATNTGT+DLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVL 121

Query: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181
           PSIGNEVLK+IVAQF+A+ELITQRE++SQ+IR EL+ RA+EF I+LEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEF 181

Query: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE ISKAL K GDGLL+IR
Sbjct: 182 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIR 241

Query: 242 RLEASKGIAETLANSPNVTYLPSK----GQAADSGAPNSLLLNLGR 283
           RLEASK IA+TLANS NV YLPS+    G +  SG+PNSLLLN+GR
Sbjct: 242 RLEASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  432 bits (1110), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/286 (73%), Positives = 248/286 (86%), Gaps = 6/286 (2%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MS++ D++ ++ LP   I +  S +QFSMYDV+GG+RA+IFDRISGVK +++GEGTHFLI
Sbjct: 1   MSKIIDTVAKVALP---IGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLI 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQKAII+DVRTKP++IATNTGTKDLQMVSLTLRVLHRPDV+ L  IY+ LG DYDERV
Sbjct: 58  PWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSI NEVLKAIVAQF+A+ELITQRE+VS +IR EL RR++EF IRLEDVSITHMTFG E
Sbjct: 118 LPSISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNE 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTKAVE KQIAQQ+++RAKF+VE+AEQER+AAVIRAEGEAE+AE+ISKAL KAGDGLL+I
Sbjct: 178 FTKAVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLI 237

Query: 241 RRLEASKGIAETLANSPNVTYLPS---KGQAADSGAPNSLLLNLGR 283
           RRLEASK IA TL+ S NVTYLP+     +    G PN+LLLNLGR
Sbjct: 238 RRLEASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  430 bits (1106), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 204/284 (71%), Positives = 254/284 (89%), Gaps = 5/284 (1%)

Query: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61
           ++L + + R+ LPL  +A   + +++SMYDV+GG+R +IFDR+SGV+  V+GEGTHFL+P
Sbjct: 47  TKLLNVITRVALPLGILA---TGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVP 103

Query: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121
           WLQKA+I+DVRTKP++IATNTGTKDLQMVSLTLRVLHRP++  L +IY+ LG DYDE+VL
Sbjct: 104 WLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVL 163

Query: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181
           PSIGNEVLK+IVAQF+A+ELITQRE+VSQ+I++EL+ RA EF IRLEDVSITHMTFG EF
Sbjct: 164 PSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEF 223

Query: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE+ISKAL K GDGLL+IR
Sbjct: 224 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIR 283

Query: 242 RLEASKGIAETLANSPNVTYLPSK--GQAADSGAPNSLLLNLGR 283
           RLEASK IA+TLANSPN+TYLP +  G+  DSG+PNSLLLN+GR
Sbjct: 284 RLEASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  426 bits (1096), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/281 (72%), Positives = 245/281 (87%), Gaps = 3/281 (1%)

Query: 3   RLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPW 62
           ++A+ L ++ +PL    +  S + +SMYDV+GG+RA+IFDRI GVK  VVGEGTHFL+PW
Sbjct: 5   KIAEKLAKIAIPL---GVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPW 61

Query: 63  LQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLP 122
           LQK++IFD+RTKP+NI TNTGT+DLQMVSLTLR+LHRPD++ L  IY+ LG DYDERVLP
Sbjct: 62  LQKSVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLP 121

Query: 123 SIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFT 182
           SIGNEVLK+IVAQF+A+ELITQRE+VSQ+IR EL  RA+EF IRLEDVSITHMTFG EFT
Sbjct: 122 SIGNEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFT 181

Query: 183 KAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRR 242
           KAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE IS+ALQKAGDGLL+IRR
Sbjct: 182 KAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRR 241

Query: 243 LEASKGIAETLANSPNVTYLPSKGQAADSGAPNSLLLNLGR 283
           LE SK IAETLA SP+VTYLP  G  A+  + NSLLLNLGR
Sbjct: 242 LETSKEIAETLAGSPHVTYLPGGGNQAEDASKNSLLLNLGR 282

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  424 bits (1091), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 245/279 (87%), Gaps = 6/279 (2%)

Query: 11  LTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFD 70
           LT    PI L  + V +SMYDV+GG+R +IFDR+SGVK  VVGEGTHFL+PWLQKA+I+D
Sbjct: 18  LTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYD 77

Query: 71  VRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLK 130
           VRTKP++IATNTGTKDLQMVSLTLRVLHRP+V  L +IY+ LG DYDE+VLPSIGNEVLK
Sbjct: 78  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLK 137

Query: 131 AIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQI 190
           +IVAQF+A+ELITQRE+VSQ+I++EL+ RA+EF +RLEDVSITHMTFG EFTKAVEQKQI
Sbjct: 138 SIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQI 197

Query: 191 AQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIA 250
           AQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE ISKAL K GDGLL+IRRLEASK IA
Sbjct: 198 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIA 257

Query: 251 ETLANSPNVTYLPSKGQAADSG------APNSLLLNLGR 283
           +TLANSPNVTYLP + + + SG      +PNSLLLN+GR
Sbjct: 258 QTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  423 bits (1087), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/286 (73%), Positives = 251/286 (87%), Gaps = 7/286 (2%)

Query: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61
           ++L D + ++ LP+  IA   S +Q+SMYDV+GG+R +IFDRI+GVK  VVGEGTHFL+P
Sbjct: 5   AKLIDVITKVALPIGIIA---SGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVP 61

Query: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121
           WLQKAII+DVRTKP++IATNTGTKDLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVL 121

Query: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181
           PSIGNEVLK+IVAQF+A+ELITQRE++SQ+IR EL+ RA+EF I+LEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEF 181

Query: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE ISKAL K GDGLL+IR
Sbjct: 182 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIR 241

Query: 242 RLEASKGIAETLANSPNVTYLPSK----GQAADSGAPNSLLLNLGR 283
           RLEASK IA+TLANS NV YLPS+    G +  SG+PNSLLLN+GR
Sbjct: 242 RLEASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  415 bits (1066), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/269 (73%), Positives = 238/269 (88%), Gaps = 2/269 (0%)

Query: 17  PIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPR 76
           P  L  +AV +SMYDV+GG+R +IFDRISGVK  V+GEGTHFL+PWLQKAII+DVRTKP+
Sbjct: 15  PSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPK 74

Query: 77  NIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQF 136
           +I+TNTGTKDLQMVSLTLR+LHRP+V+ L RIY+ LG DYDERVLPSIGNEVLK+IVAQF
Sbjct: 75  SISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQF 134

Query: 137 NASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESD 196
           +A+ELITQRE+VSQ+IR E++ RA+EF I+LEDVSITHMTFG EFTKAVEQKQIAQQ+++
Sbjct: 135 DAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAE 194

Query: 197 RAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANS 256
           RA+F+VE+AEQER+A+VIRAEGEAE+AE ISKAL + GDGLL+IRRLEASK IA TL+ S
Sbjct: 195 RARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKS 254

Query: 257 PNVTYLP-SKGQAADSGA-PNSLLLNLGR 283
            N+TYLP  KG+  D    PNSLLLN+GR
Sbjct: 255 SNITYLPGGKGREGDEKTPPNSLLLNIGR 283

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  413 bits (1062), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 208/286 (72%), Positives = 250/286 (87%), Gaps = 7/286 (2%)

Query: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61
           SRL D + ++ LP+  IA   + +Q++MYDV+GG+R +IFDRI+GVK  VVGEGTHFL+P
Sbjct: 5   SRLIDVITKVALPIGIIA---TGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVP 61

Query: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121
           WLQKAII+DVRTKP++IATNTGT+DLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVL 121

Query: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181
           PSIGNEVLK+IVAQF+A+ELITQRE++SQ+IR EL+ RA+EF I+LEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEF 181

Query: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE ISKAL K GDGLL+IR
Sbjct: 182 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIR 241

Query: 242 RLEASKGIAETLANSPNVTYLPSK----GQAADSGAPNSLLLNLGR 283
           RLEASK IA+TLANS NV YLPS+    G    SG+PNSLLLN+GR
Sbjct: 242 RLEASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  405 bits (1042), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 208/283 (73%), Positives = 247/283 (87%), Gaps = 4/283 (1%)

Query: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61
           SRLA+++ ++ +PL  +A   S +Q+SMYDVRGG+RA+IFDR+SGV+ +VVGEGTHFL+P
Sbjct: 3   SRLAETVAKVAIPLGIVA---SGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVP 59

Query: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121
           WLQKA+I+DVRTKP++IATNTGTKD+QMVSLTLRVLHRP V+ L  IY+ LG DYDERVL
Sbjct: 60  WLQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVL 119

Query: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181
           PSIGNEVLKAIVA+++A+ELITQRELVS  IR+EL+ RASEF+IRLEDVSITHMTFG EF
Sbjct: 120 PSIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEF 179

Query: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241
           TKAVE KQIAQQ+++RAKF+VE+AEQ R+ +VIRAEGEAEAAE ISKAL KAGDGLL+IR
Sbjct: 180 TKAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIR 239

Query: 242 RLEASKGIAETLANSPNVTYLPS-KGQAADSGAPNSLLLNLGR 283
           RLEASK IA+TLANS NVTYLPS +      G   SLLLNLGR
Sbjct: 240 RLEASKDIAQTLANSSNVTYLPSQQSGGGQEGTSQSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  394 bits (1013), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 203/287 (70%), Positives = 242/287 (84%), Gaps = 7/287 (2%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MS+  + L ++ +P     L   A  ++MYDV+GG+R +IFDR+SGV+  VVGEGTHFL+
Sbjct: 1   MSKAINVLSKMAIP---AGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLV 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQKAII+DVR+KP++IATNTGTKDLQMVSLTLRVLHRP+VM L RIY+ LG DYDERV
Sbjct: 58  PWLQKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLK+IVAQF+A+ELITQRE+VSQ+IR EL+ RA EF IRLEDVSITHMTFG E
Sbjct: 118 LPSIGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAE 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240
           FTKAVEQKQIAQQ+++RAKF+VE+AEQ R+A+VIRAEGEAE+AE ISKAL K GDGLL+I
Sbjct: 178 FTKAVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLI 237

Query: 241 RRLEASKGIAETLANSPNVTYLPSKGQAA----DSGAPNSLLLNLGR 283
           RRLEASK IA TL+ S NVTYLPS G       + G+ N+LLLN+GR
Sbjct: 238 RRLEASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  353 bits (907), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 198/217 (91%), Gaps = 3/217 (1%)

Query: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60
           MSR+AD + R+ +P   + L  SA+Q+SMYDVRGG RA+IFDR+ GV+  V+GEGTHFL+
Sbjct: 1   MSRVADVMARIAIP---VGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLV 57

Query: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120
           PWLQK+I+FDVRTKP+NIATNTGTKDLQMVSLTLRVLHRPDVM L +IY+ LG DYDERV
Sbjct: 58  PWLQKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERV 117

Query: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180
           LPSIGNEVLKAIVAQF+A+ELITQRE+VSQ+IR EL++RA EF+I+LEDVSITHMTFGQE
Sbjct: 118 LPSIGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQE 177

Query: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAE 217
           FTKAVEQKQIAQQ+++RA+F+VE+AEQER+AAVIRAE
Sbjct: 178 FTKAVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  294 bits (753), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 148/256 (57%), Positives = 196/256 (76%), Gaps = 11/256 (4%)

Query: 25  VQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGT 84
           +Q S+++V GG RAI++ RI+GV   +  EGTHF++PWL+  I++DVR KPRN+A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 85  KDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQ 144
           KDLQMV++T RVL RPDV +L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 145 RELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVER 204
           RE VS+ IR  L RRAS+FNI L+DVSIT MTF  EFT+AVE KQIAQQ++ RA F+V++
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 205 AEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYLPS 264
           A QE++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA  LANSPN   L +
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTAREIARILANSPNRVVLDN 291

Query: 265 KGQAADSGAPNSLLLN 280
           +          SLLLN
Sbjct: 292 E----------SLLLN 297

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  291 bits (745), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV   +  EGTHF+ PWL   II+DVR KPRN+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPDV+ L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V+RA+GEA++AE I +A++K+ D  + ++RL+ ++ IA+ LA+SPN
Sbjct: 237 EKQGMVVRAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILASSPN 286

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           S+++V GG RAI++ R+SGV   +  EGTHF+IPWLQ  II+DVR KPRN+A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPD+ +L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRA +FNI L+DVSIT MTF  EFT AVE KQIAQQ++ RA F+V+RA Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V++A+GEA++AE I +A++K+ D  + ++RL+ SK IA+ LA S N
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDISKDIAKILATSSN 284

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  290 bits (742), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 140/231 (60%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV   +  EGTHF+ PWL   I++DVR KPRN+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPDV+ L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA+ LA+SPN
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILASSPN 286

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  289 bits (740), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 138/231 (59%), Positives = 186/231 (80%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           S+++V GG RAI++ R+SGV+  V GEGTHF+IPWL+  +++DVR+KPR +++ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPDV  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR+ L RRAS FNI L+DVSIT+MTF  EFT AVE KQ+AQQ++ RA F VE+A+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E+++ +++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA  LA SPN
Sbjct: 237 EKQSMIVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIAGILAASPN 286

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  289 bits (740), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 190/253 (75%), Gaps = 11/253 (4%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           S+++V GG RAI++ RISGV P +  EGTHF+IPW++  II+DVR KPRN+A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RP+V  L  IYR LG DYDERVLPSI NEVLK++VAQFNAS+LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L  R+S FNI L+DVSIT MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYLPSKGQ 267
           E++  V+RA+GEA++AE I +A++K+ D  + ++RL+ ++ IA  LA SPN   L ++  
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILAKSPNRVVLDNE-- 295

Query: 268 AADSGAPNSLLLN 280
                   SLLLN
Sbjct: 296 --------SLLLN 300

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  289 bits (739), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV   +  EGTH +IPW++  I++DVR KPRN+A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRNVASLTGTKDL 118

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RP+V  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR+ L RRAS FNI L+DVSIT+MTF  EFT+AVE KQIAQQ++ RA F+V++A Q
Sbjct: 179 VSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 238

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V++A+GEA++AE I  A++K+ D  + ++RL+ +K IA+ LANSPN
Sbjct: 239 EKQGMVVKAQGEAKSAELIGDAIKKSRD-YVELKRLDTAKDIAKILANSPN 288

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  289 bits (739), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 183/234 (78%), Gaps = 1/234 (0%)

Query: 25  VQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGT 84
           V  ++++V GG RAI++ RI GV   +  EGTHF+ PWL   II+DVR KPRN+A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 85  KDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQ 144
           KDLQMV++T RVL RPDV  L  IYR LG DYDERVLPSI NEVLK++VAQFNAS+LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 145 RELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVER 204
           RE VS+ IR  L RRA+ FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 205 AEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           A QE++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA+ LANSPN
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILANSPN 286

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  287 bits (734), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 144/253 (56%), Positives = 190/253 (75%), Gaps = 11/253 (4%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV P +  EGTHF++PWL+  I++DVR KPRN+A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPDV  L  +YR LG DYD+RVLPSI NEVLK++VAQFNAS+LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRAS FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA F+V++A Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYLPSKGQ 267
           E++  V++A GEA++AE I +A++K+ D  + ++RL+ +K IA  LA SPN   L ++  
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKD-YVELKRLDTAKEIATILAASPNRVVLDNE-- 271

Query: 268 AADSGAPNSLLLN 280
                   SLLLN
Sbjct: 272 --------SLLLN 276

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  287 bits (734), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 140/234 (59%), Positives = 184/234 (78%), Gaps = 1/234 (0%)

Query: 25  VQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGT 84
           V  ++++V GG RAI++ R++GV   +  EGTHF+ PW+   II+DVR KPRN+A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 85  KDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQ 144
           KDLQMV++T RVL RPDV  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 145 RELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVER 204
           RE VS+ IR  L RRAS F+I L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 205 AEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           A QE++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA+ LANSPN
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTARDIAKILANSPN 286

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  287 bits (734), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 138/234 (58%), Positives = 185/234 (79%), Gaps = 1/234 (0%)

Query: 25  VQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGT 84
           V  ++++V GG RAI++ R+ G++  +  EGTHF +PWL+  I++DVR KPRN+A+ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 85  KDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQ 144
           KDLQMV++T RVL RP+V  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 145 RELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVER 204
           RE VS+ IR  L RRAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 205 AEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           A QE++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IAE L+ SPN
Sbjct: 235 ARQEKQGMVVKAQGEAQSAELIGEAIKKSKD-YVELKRLDTAREIAEILSKSPN 287

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  286 bits (733), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 186/235 (79%), Gaps = 1/235 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           S+++V GG RAI++ R++GV+  +  EGTHF IPWL+  I++DVR KPRN+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPDV  L  ++R LG DYDERVLPSI NEVLK++VAQFNAS+LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRAS+FN+ L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYL 262
           E++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA  L++SPN   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILSSSPNKVIL 290

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  286 bits (733), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 188/253 (74%), Gaps = 11/253 (4%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RISGV P +  EGTHF IPW++  II+DVR KPRN+A+ TGTKDL
Sbjct: 62  ALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKDL 121

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RP+V  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 122 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 181

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L  RA+ FNI L+DVSIT MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 182 VSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 241

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYLPSKGQ 267
           E++  V+RA+GEA++AE I  A++K+ D  + ++RL+ ++ IA  LA SPN   L ++  
Sbjct: 242 EKQGMVVRAQGEAKSAELIGDAIKKSKD-YVELKRLDTAREIARILAKSPNRVVLDNE-- 298

Query: 268 AADSGAPNSLLLN 280
                   SLLLN
Sbjct: 299 --------SLLLN 303

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  286 bits (732), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 190/253 (75%), Gaps = 11/253 (4%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV   +  EGTHF++PWL+  +++DVR KPRN+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPDV  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L  RA  FN+ L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++A+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYLPSKGQ 267
           E++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA+ LA SPN   L ++  
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIADILAKSPNRVVLDNE-- 296

Query: 268 AADSGAPNSLLLN 280
                   SLLLN
Sbjct: 297 --------SLLLN 301

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  286 bits (731), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV   +  EGTHF+IPW++  +I+DVR KPRN+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RP+V  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR+ L  RA +FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V++A+GEA++AE I +A++K+ D  + ++RL+ +K IA+ LA SPN
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAKDIADILAKSPN 287

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  283 bits (724), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 185/235 (78%), Gaps = 1/235 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI+GV+P +  EGTHF+IPW++  +++DVR KPRN+++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RP+V  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRA  FNI L+DVSIT+MTF  EFT +VE KQIAQQ++ +A FVV++A Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYL 262
           E++  +++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA  L+ SPN   L
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIASILSRSPNKVIL 291

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  283 bits (723), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           S+++V GG RAII+ R++GV+  +  EGTHF IPW +  I++DVR KPRN+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RP+V  L  ++R LG DYDERVLPSI NEVLK++VAQFNAS+LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRAS+FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA  L+ SPN
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILSQSPN 286

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  281 bits (719), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 181/231 (78%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV   +  EGTH L+PW +  +++DVR KPRN+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RPDV  L  IYR LG DYDERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRAS FNI L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV+RA Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V++A+G+A++AE I +A++K+ D  + ++RL+ ++ IA+ L+ SPN
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKD-YVELKRLDTAREIAQILSRSPN 289

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  280 bits (715), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 181/231 (78%), Gaps = 1/231 (0%)

Query: 28  SMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPRNIATNTGTKDL 87
           ++++V GG RAI++ RI GV   +  EGTH +IPWL+  +++DVR KPRN+A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKDL 118

Query: 88  QMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQFNASELITQREL 147
           QMV++T RVL RP+V  L  IYR LG DY ERVLPSI NEVLKA+VAQFNAS+LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 148 VSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQ 207
           VS+ IR  L RRAS F+I L+DVSIT+MTF  EFT AVE KQIAQQ++ RA FVV++A Q
Sbjct: 179 VSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 208 ERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPN 258
           E++  V++A+GEA++AE I +A++K+ D  + ++RL+ ++ IA+ LA SPN
Sbjct: 239 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIAQILARSPN 288

>KLTH0C08008g Chr3 (682247..683920) [1674 bp, 557 aa] {ON} similar
           to uniprot|P38228 Saccharomyces cerevisiae YBR044C TCM62
           mitochondrial protein (putative) chaperone
          Length = 557

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 69/177 (38%), Gaps = 27/177 (15%)

Query: 114 PDYDERVLPSIGN--------EVLKAIVAQFNASELITQRELVSQQIRNELARRA----- 160
           P++ E V PS  +        E LKA   +      +   ++  Q+IRN+  R       
Sbjct: 350 PEFSEHV-PSTASAALFFGSLESLKATTGE----AFLYNTQVGGQEIRNDALRTTVTLHV 404

Query: 161 ---SEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAE 217
              SE  I      + H+         +    +  Q    AK V      + R+A  R+ 
Sbjct: 405 GGHSELEIDHRRAQLDHI-MNNILCHGLAHGWVPSQGVALAKSVAVLQSGDSRSA--RSP 461

Query: 218 GEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVT--YLPSKGQAADSG 272
           G     E ++  L+ A   L    R EAS+  AET+A+ P+ T  YLP K    + G
Sbjct: 462 GADVLTESLTLPLESAVTNLYAAHRFEASRLTAETIAD-PSFTTAYLPEKCSTVERG 517

>Smik_12.138 Chr12 (266633..267484) [852 bp, 283 aa] {ON} YLR079W
           (REAL)
          Length = 283

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 42/74 (56%), Gaps = 7/74 (9%)

Query: 126 NEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAV 185
           ++++K +  Q N +  ++  EL++Q+IRNE  R     N  +EDV    +T+  +  + V
Sbjct: 205 DDIIKPV--QVNKNPFVSD-ELITQEIRNERKRALLTENPDIEDV----VTYVNKKGEVV 257

Query: 186 EQKQIAQQESDRAK 199
           E++++  +E  R K
Sbjct: 258 EKRKLTDEEKRRFK 271

>ZYRO0B01078g Chr2 complement(91817..92560) [744 bp, 247 aa] {ON}
           similar to uniprot|P28320 Saccharomyces cerevisiae
           YKL095W YJU2 Essential nuclear protein putative
           spliceosomal component involved in mRNA splicing based
           on computational analysis of large-scale protein-protein
           interaction data
          Length = 247

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 204 RAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANSPNVTYLP 263
           RA+Q+R+   +  E E +  + + K  ++A          E+ KG A+TL  S     + 
Sbjct: 178 RAQQQRKVDSLSHESEEDQDDELDKLAERA---------FESRKGRADTLKVSKPAKKI- 227

Query: 264 SKGQAADSGAPNSLLLNLGR 283
            +   A +GAPN L + + R
Sbjct: 228 RRATGAHTGAPNPLGIRIKR 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,429,996
Number of extensions: 911407
Number of successful extensions: 3294
Number of sequences better than 10.0: 66
Number of HSP's gapped: 3364
Number of HSP's successfully gapped: 66
Length of query: 283
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 175
Effective length of database: 41,097,471
Effective search space: 7192057425
Effective search space used: 7192057425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)