Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR312W3.493ON1681686381e-85
Ecym_12363.493ON1691694497e-57
SAKL0F02750g3.493ON1701214028e-50
KLLA0D16280g3.493ON1691213983e-49
TDEL0D056103.493ON1751213593e-43
ZYRO0D09966g3.493ON1781223491e-41
Kpol_1017.63.493ON1871223404e-40
Kwal_55.212383.493ON1701703281e-38
KLTH0F14850g3.493ON1711223281e-38
TPHA0D032803.493ON1841223203e-37
Skud_16.4443.493ON1731213194e-37
Smik_6.2273.493ON1741213161e-36
TBLA0C044903.493ON1861233133e-36
YPR149W (NCE102)3.493ON1731213091e-35
CAGL0I10494g3.493ON1721223063e-35
Smik_16.4023.493ON1731213031e-34
KAFR0C019703.493ON1791223021e-34
NDAI0G009303.493ON1761213003e-34
Suva_7.4193.493ON1741212993e-34
YGR131W (FHN1)3.493ON1741212961e-33
Suva_16.4783.493ON1661212898e-33
NDAI0B058803.493ON1821222882e-32
KNAG0A079503.493ON1821182883e-32
CAGL0L08448g3.493ON1731462742e-30
NCAS0E008003.493ON1741212709e-30
TBLA0D029603.493ON1891232665e-29
NCAS0F035603.493ON1831222648e-29
KNAG0B008003.493ON1821212604e-28
Skud_7.4423.493ON1741212578e-28
KAFR0G037003.493ON1861222292e-23
Kwal_23.46502.61ON38596800.043
Kwal_23.4058singletonON216129750.13
Suva_4.272.61ON32299645.1
NCAS0D003402.61ON333101636.7
NDAI0G045202.637ON91740638.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR312W
         (168 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   250   1e-85
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   177   7e-57
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   159   8e-50
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   157   3e-49
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   142   3e-43
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   139   1e-41
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   135   4e-40
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   130   1e-38
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   130   1e-38
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   127   3e-37
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   127   4e-37
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   126   1e-36
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   125   3e-36
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   123   1e-35
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   122   3e-35
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   121   1e-34
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   120   1e-34
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   120   3e-34
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   119   3e-34
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   118   1e-33
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   115   8e-33
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   115   2e-32
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   115   3e-32
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   110   2e-30
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   108   9e-30
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   107   5e-29
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   106   8e-29
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   104   4e-28
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   103   8e-28
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...    93   2e-23
Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W...    35   0.043
Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON...    33   0.13 
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     29   5.1  
NCAS0D00340 Chr4 (50708..51709) [1002 bp, 333 aa] {ON} Anc_2.61        29   6.7  
NDAI0G04520 Chr7 (1081291..1084044) [2754 bp, 917 aa] {ON} Anc_2...    29   8.7  

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  250 bits (638), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 134/168 (79%), Positives = 134/168 (79%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QXXXXXXXXXXXXXXXXXXXSGLNIFXXXXXXXXXXXXXXXVPTISQV 168
           Q                   SGLNIF               VPTISQV
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNIFSSGAFSSGGSKRGGGVPTISQV 168

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  177 bits (449), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 106/169 (62%), Positives = 114/169 (67%), Gaps = 1/169 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLSILDNSLRA NF+FLIIVL LTGSLI+GQ  SHSRVNFGLFTA+FAL+ DS YS++AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           FISA AWPI+ I  DVLNLIFTFAAATALG +IG HSCSN GFL GN ISE    RCRKV
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QXXXXXXXXXXXXXXXXXXXSGLNIFXXXX-XXXXXXXXXXXVPTISQV 168
           Q                   SGLNI                 VPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGGGVPTISQV 169

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  159 bits (402), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 90/121 (74%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLSILDNSLR VNF FL+I+LGLTGSLI  Q     RVNF +FTA FALVTDSFY++ AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
             SAFAWPI+ +  D LN +FTF+AATAL   I  HSC+N  +L  N I++ STDRCRK 
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  157 bits (398), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 92/121 (76%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLSILDNSLR VNFVFLIIVLGL G+LI  Q +S SRVNF +F AVF +V DS Y+++AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           FISA AWPII ++LD LN +FTF+AATAL   I   SC+N  F  GN I+E S DRCRK 
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  142 bits (359), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML+I+DN+LR VNF FL+I+LGL G LI  +    SRVNF +F A F +VTDSFY I+AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
               FAWP+I  ALD LN  FTF+AATAL   I  HSC N+ +LD N I++ ST RCR  
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  139 bits (349), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 85/122 (69%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSH-SRVNFGLFTAVFALVTDSFYSIVA 59
           ML++ DN LRAVNF F +I+LGL G LI  +++ H SRVNF +F A F +V DSFY I+A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
           N    FA+P+I   LD LN +FTF AATAL   I  HSC+NR +LD N I++ ST RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 VQ 121
            Q
Sbjct: 121 AQ 122

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  135 bits (340), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 82/122 (67%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS+ DN +RA+NF F +I +GL GSL+  ++   SRVN+ +F   FA+VTDSFY I+AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  -FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
            + + FAWPII  A D LN  FTF A T L   I  HSC NR ++D N I + STDRCRK
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 VQ 121
            Q
Sbjct: 121 AQ 122

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  130 bits (328), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 103/170 (60%), Gaps = 2/170 (1%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLSILDNSLRA NFVFL+IVLGLTGSL   + N++ +VNF +F A F L+ D+ Y+I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           FISA AWP++    D LN +FTFAAATAL  +I  HSC+N  ++D N +++ S+DRCRK 
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QXXXXXXXXXXXXXXXXXXXSGLNIFXXXXXXXXX--XXXXXXVPTISQV 168
           Q                   S +N+F                 VPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRKSANVGVPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  130 bits (328), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQR-NSHSRVNFGLFTAVFALVTDSFYSIVA 59
           MLSILDNSLRA+NF FL+I+LGLTGSL    + +++ +VNF +FTA F L+ DS Y+I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
           NF+SA AWP++    D LN +FTFAAATAL  +I  HSC+N+ +LD NT+++ STDRCRK
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 VQ 121
            Q
Sbjct: 121 AQ 122

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  127 bits (320), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 76/122 (62%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML + DN LR VNF F +I LGL GSL+  Q    SRVN+ +F   FALVTD+FY  +AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FIS-AFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
             S   AWPII    D LN  FTF A T L      HSC+N+ +LD N I++ STDRCRK
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 VQ 121
            Q
Sbjct: 121 AQ 122

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  127 bits (319), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 80/121 (66%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML+  DN LR +NF+FL+IV+GL  SL++ Q  + SRVNF +F A + + TDS Y + AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F    AWP++   LD LN +FTF A T L   I AHSC+NR ++D N I++ S  RCR+ 
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  126 bits (316), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS  DN +R +N VFLII +GL   LI  Q    SRVNF +FTA + LVTDS Y  +AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F S+  +P I +ALD+LN IFTF AATAL   I  HSC N+ +L+ N I++ S+ RC + 
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  125 bits (313), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 2/123 (1%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHS-RVNFGLFTAVFALVTDSFYSIVA 59
           MLS   N LR +NF FL+I+ G+ G LI  ++  HS RVN+ +F A FALVTDSFY+I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFI-SAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCR 118
           NF  S FAWPI+  + D LN  FTF A T L   I  HSC N+ +L  N I++ ST+RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 KVQ 121
             Q
Sbjct: 121 LAQ 123

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  123 bits (309), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML++ DN LR +NF+FL+I +GL  SL++ Q    SRVN+ +F   + + TDS Y + AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           FI   AWP++   LD LN +FTF A T L   I AHSC+N  ++D N I++ S  RCR+ 
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  122 bits (306), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 78/122 (63%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS+ DN LR VN VFLII +GL  SLI+ ++   SRVNF LF A + + TDS Y I AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNT-ISEQSTDRCRK 119
           F    AWP++   LD LN +FTF A T L   I AHSC+N+ +L+  T I + S  RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 VQ 121
            Q
Sbjct: 121 AQ 122

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  121 bits (303), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 77/121 (63%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML++ DN LR +NF+FL+I + L  SL++ Q    SRVN+ +F   + + TDS Y + AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           FI   AWP++   LD LN +FTF A T L   I AHSC+N  ++D N I++ S  RCR+ 
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  120 bits (302), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 75/122 (61%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSH-SRVNFGLFTAVFALVTDSFYSIVA 59
           ML + DN LR +N VFLII + LT +LI+ Q   H SRVN+ +F   F L  DS Y I A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
           NF    AWP++   LD LN  FTF+AATAL   I AHSC N+ +LD N I   S  RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 VQ 121
            Q
Sbjct: 121 AQ 122

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  120 bits (300), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 83/121 (68%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS+ DN LR +N +FL+I +GL  +L++ Q+  +SR+N+ +FT V+ L+TDSF+ I+AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F    ++P I   LD LN  FTF A T L   I +HSC+N+ +LD N I++ S +RCR+ 
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  119 bits (299), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 77/121 (63%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS+ DN +R +N +FLII +GL   LI  Q    SRVNF +F A + L+TDSFY  +AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
             S+  +P+I   LD LN +FTF A TAL   I  HSCSN+ +LD N I++ S  RC + 
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 Q 121
           +
Sbjct: 121 K 121

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  118 bits (296), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 77/121 (63%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS  DN +R +N VFLII +GL   LI  Q    SRVNF +F AV+ LVTDS Y  +AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F ++  +P I + LD LN IFTF AATAL   I  HSC N+ +L+ N I + S+ RC + 
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  115 bits (289), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%), Gaps = 7/121 (5%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML+ +DN LR +NF+FL+I +GL  SL++ Q  + SR+N+ +F   +A+VTDS Y + AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F    AWP+I  +LD LN +FTF A       I AHSC N+ +L  N+I++ S +RCR+ 
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 Q 121
           Q
Sbjct: 114 Q 114

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  115 bits (288), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (64%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS +DN LR +N +FL++ +    +L++ QRN+ SR+NF +F A F L+TDSF+ +  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FISAFA-WPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
              A A WPI+    D LN +FTF A T L  +I AHSC N  +++ N+I++ S +RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 VQ 121
            Q
Sbjct: 121 SQ 122

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  115 bits (288), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 54/118 (45%), Positives = 75/118 (63%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML++ D  LR VNFVFL+I +GL  +L++ Q    SR+N+ +FTA + + TDSFY +VAN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCR 118
           F    +WP++  ALD LN +FT  A   L   I AHSC N  + + N I + S +RCR
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCR 118

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  110 bits (274), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 75/146 (51%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML++ DN LR VNFVF++I +GL   LI  +    SRVN+ +F A + + TDS Y + AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F    AWP+I   LD LN  F   A   L   I AHSC+N  + + N I + S  RCR+ 
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QXXXXXXXXXXXXXXXXXXXSGLNIF 146
           Q                   S LNIF
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIF 146

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  108 bits (270), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 75/121 (61%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML + DN LR +N VFL+I +GL  +L++ + +++SR+N+ +FT  + L TDS Y I AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F    A P +   LD LN  FTF A T L   I AHSC +  +++ N I++   +RCR+ 
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  107 bits (266), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 2/123 (1%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHS-RVNFGLFTAVFALVTDSFYSIVA 59
           ML + DN  R  NF F +I  G+ G+L++ +   HS RVN+ +F   + LV+DSFY I+A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFI-SAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCR 118
           N +   FA+P I  A D LN +FTF A T L   I  HSC+N+ +   N I + S  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 KVQ 121
           + Q
Sbjct: 121 EAQ 123

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  106 bits (264), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 74/122 (60%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS +DN+LR  N +FL++ +    +L+  Q +  SRVN+ +F A F L+TDSF+ + AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FISAF-AWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
            I    +WPII    D LN +FTF A T L   I  HSC+NR +L+ N I + S  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 VQ 121
            Q
Sbjct: 121 SQ 122

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  104 bits (260), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 69/121 (57%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           ML + DN LR +NF FL+I L    +LI+ Q+   SRVN+ +F A + + TD  Y ++AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F    AWP+I   LD LN  FT  A   L   I AHSC N  + + N I + S +RCR  
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  103 bits (257), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 81/121 (66%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60
           MLS  DN +R V+ VFLII +GL G L+  Q N  SRVNF +F A + L+TDSFY  +AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120
           F S+  +P I + LD LN +FTFAAATAL   I  HSC N+ +L+ N I++ S+ RC + 
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 Q 121
           Q
Sbjct: 121 Q 121

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score = 92.8 bits (229), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 71/122 (58%), Gaps = 1/122 (0%)

Query: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHS-RVNFGLFTAVFALVTDSFYSIVA 59
           ML+I DNSLR VNF F++I +     L++ ++  +S RVN+ +F   F ++TDS Y + A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119
           NF    AWPII    D LN +F F A T L   I AH+C+N  + + N I   S  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 VQ 121
            Q
Sbjct: 121 AQ 122

>Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W -
           1:1 [contig 5] FULL
          Length = 385

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 8   SLRAVNFVFLIIVLGLTGSLIHG--QRNSHSRVNFGLFTAVFALVTDSFYSIVANFISAF 65
           SLR + F+  +IVLGL   ++ G   R SH + N+GL  AV ++V     S++   +S F
Sbjct: 77  SLRMLQFICSVIVLGLLAYVLKGYDYRGSH-KTNYGLAVAVISVVYLLLLSVLGAVLSKF 135

Query: 66  AWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNR 101
             P + +  +++      +A   L +  G+ SC  R
Sbjct: 136 LLPGLYLLFEMIMWALWLSAFVVLAKEHGSRSCGLR 171

>Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON}
           YDL218W - Hypothetical ORF [contig 255] FULL
          Length = 216

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 54/129 (41%), Gaps = 28/129 (21%)

Query: 4   ILDNSLRAVNFVFLIIVLGLTGSLIH-GQRNSHSRVNFG----------LFTAVFALVTD 52
           IL  S+RA  F+F II LGLT  ++  G R+S +               L  A+   + D
Sbjct: 27  ILLWSVRAGQFIFSIITLGLTSRVVDFGYRDSAAAYGVAVSVISTLYLILIVAIPLKLND 86

Query: 53  SFYSIVANFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQ 112
               +VA FIS           +++ +I  FAA  AL    G   CS         I+E 
Sbjct: 87  ---CVVAVFIS-----------ELVMMILWFAAFVALAAQHGGIDCST---YKSYYITED 129

Query: 113 STDRCRKVQ 121
            ++ CR  +
Sbjct: 130 WSEPCRAAE 138

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 9   LRAVNFVFLIIVLGLTGSLIHGQRN-SHSRVNFGLFTAVFALVTDSFYSIVANFISAFAW 67
           LR   FV  ++V+ L    IH   +  + + NF L T V ++    FY ++A  I   A 
Sbjct: 12  LRFSQFVSSVLVMSLLAYAIHAYSDRGNKKTNFTLATGVISV----FY-LIALGILCLAL 66

Query: 68  P-IITIAL----DVLNLIFTFAAATALGQSIGAHSCSNR 101
           P +I I +    +++  +   AA   L ++ G HSC +R
Sbjct: 67  PTLIYIGMYFCAELIMCMLWLAAFVVLAKAQGQHSCKSR 105

>NCAS0D00340 Chr4 (50708..51709) [1002 bp, 333 aa] {ON} Anc_2.61
          Length = 333

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 13/101 (12%)

Query: 8   SLRAVNFVFLIIVLGLTGSLIHGQRN-SHSRVNFGLFTAVFALVTDSFYSIVANFISAFA 66
           +LR + F   ++V  L    IH   +  + + NFGL   V +    +FY +     + FA
Sbjct: 70  TLRILEFASSVLVFALLSFAIHDYHDHGNHKTNFGLAVGVIS----TFYLLAVMLGTLFA 125

Query: 67  WP------IITIALDVLNLIFTFAAATALGQSIGAHSCSNR 101
            P      ++ IA  ++ L++   A   + +SIG H CSN+
Sbjct: 126 -PQFVFAGVLLIAEGIVCLLW-LCAFIVIAKSIGEHGCSNK 164

>NDAI0G04520 Chr7 (1081291..1084044) [2754 bp, 917 aa] {ON}
           Anc_2.637 YMR066W
          Length = 917

 Score = 28.9 bits (63), Expect = 8.7,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 54  FYSIVANFISAFAWPIITIALDVLNLIFTFAAATALGQSI 93
           F+ I+A FI    W ++   L ++N  +     T+LGQ I
Sbjct: 769 FHLIIATFIRERCWTVLPSVLILMNKRYNIKITTSLGQYI 808

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.139    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,037,927
Number of extensions: 343957
Number of successful extensions: 1068
Number of sequences better than 10.0: 40
Number of HSP's gapped: 1068
Number of HSP's successfully gapped: 40
Length of query: 168
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 67
Effective length of database: 41,900,133
Effective search space: 2807308911
Effective search space used: 2807308911
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)