Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR311CsingletonON1491496773e-92
KLTH0A02354g8.82ON57141810.026
AGL009C8.82ON57331681.2
NCAS0J006908.82ON58938662.2
NDAI0G042903.92ON111342662.7
SAKL0E15158g5.713ON76666653.5
SAKL0B02684g8.82ON58138643.8
Kwal_23.51068.82ON57738643.9
CAGL0H00891g6.269ON147558644.5
KLTH0C08624gna 1ON57162627.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR311C
         (149 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR311C Chr6 complement(1003431..1003880) [450 bp, 149 aa] {ON} ...   265   3e-92
KLTH0A02354g Chr1 (200459..202174) [1716 bp, 571 aa] {ON} simila...    36   0.026
AGL009C Chr7 complement(705220..706941) [1722 bp, 573 aa] {ON} S...    31   1.2  
NCAS0J00690 Chr10 (104982..106751) [1770 bp, 589 aa] {ON} Anc_8....    30   2.2  
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    30   2.7  
SAKL0E15158g Chr5 (1263977..1266277) [2301 bp, 766 aa] {ON} weak...    30   3.5  
SAKL0B02684g Chr2 complement(256014..257759) [1746 bp, 581 aa] {...    29   3.8  
Kwal_23.5106 s23 complement(1014284..1016017) [1734 bp, 577 aa] ...    29   3.9  
CAGL0H00891g Chr8 complement(85886..90313) [4428 bp, 1475 aa] {O...    29   4.5  
KLTH0C08624g Chr3 complement(723206..724921) [1716 bp, 571 aa] {...    28   7.3  

>AFR311C Chr6 complement(1003431..1003880) [450 bp, 149 aa] {ON}
           NOHBY636; No homolog in Saccharomyces cerevisiae
          Length = 149

 Score =  265 bits (677), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 132/149 (88%), Positives = 132/149 (88%)

Query: 1   MPYPSAPRSPFXXXXXXXXXXXXXXXXXASKASDATIARSAHLLPNRDSLRGGLLWQRCR 60
           MPYPSAPRSPF                 ASKASDATIARSAHLLPNRDSLRGGLLWQRCR
Sbjct: 1   MPYPSAPRSPFLSTSTRPLRRTLLRSVSASKASDATIARSAHLLPNRDSLRGGLLWQRCR 60

Query: 61  RIFEPLLSPRALECIVGDSRALDCPKRHVNILTQSRDRTSVRKCSRSPPLPDDEPLFQEQ 120
           RIFEPLLSPRALECIVGDSRALDCPKRHVNILTQSRDRTSVRKCSRSPPLPDDEPLFQEQ
Sbjct: 61  RIFEPLLSPRALECIVGDSRALDCPKRHVNILTQSRDRTSVRKCSRSPPLPDDEPLFQEQ 120

Query: 121 QTTAREHPGTQQDVENRRSDELYFRKGHT 149
           QTTAREHPGTQQDVENRRSDELYFRKGHT
Sbjct: 121 QTTAREHPGTQQDVENRRSDELYFRKGHT 149

>KLTH0A02354g Chr1 (200459..202174) [1716 bp, 571 aa] {ON} similar
           to uniprot|Q12308 Saccharomyces cerevisiae YPL007C TFC8
           One of six subunits of RNA polymerase III transcription
           initiation factor complex (TFIIIC) part of TFIIIC TauB
           domain that binds BoxB promoter sites of tRNA and other
           genes linker between TauB and TauA domains human homolog
           is TFIIIC-90
          Length = 571

 Score = 35.8 bits (81), Expect = 0.026,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 45  PNRDSLRG--GLLWQRCRRIFEPLLSPRALECIVGDSRALD 83
           PN D ++   G +W+RCR  F PLL+ +   C V + R +D
Sbjct: 499 PNTDVVQSEEGHIWKRCRATFLPLLTSKVKVCPVSNYRIID 539

>AGL009C Chr7 complement(705220..706941) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL007C
           (TFC8)
          Length = 573

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 53  GLLWQRCRRIFEPLLSPRALECIVGDSRALD 83
           G LWQRC   + PLL+     C V + R +D
Sbjct: 509 GTLWQRCAITYLPLLTASVKVCPVSNHRIID 539

>NCAS0J00690 Chr10 (104982..106751) [1770 bp, 589 aa] {ON} Anc_8.82
           YPL007C
          Length = 589

 Score = 30.0 bits (66), Expect = 2.2,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 53  GLLWQRCRRIFEPLLSPRALECIVGDSRALDCPKRHVN 90
           G +W+RC     PLL+ +   C V  +R +D  K  +N
Sbjct: 525 GTVWKRCAVSLLPLLTTKVKICPVSKTRIIDINKDSLN 562

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 89  VNILTQSRDRTSVRKCSRSPPLPDDEPLFQEQQTTAREHPGT 130
           V + +++R  TS R  + S PLPD  P  QE++  +   P T
Sbjct: 936 VKLASRTRRNTSSRPHAGSSPLPDVSPSIQEEKEISVALPNT 977

>SAKL0E15158g Chr5 (1263977..1266277) [2301 bp, 766 aa] {ON} weakly
           similar to uniprot|P22035 Saccharomyces cerevisiae
           YKR099W BAS1 Myb-related transcription factor involved
           in regulating basal and induced expression of genes of
           the purine and histidine biosynthesis pathways
          Length = 766

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 83  DCPKRHVNILTQSRDRTSVRKCSRSPPLPDDEPLFQEQQTTAREHPGTQQDVENRRSDEL 142
           D    H + L+ SR +T V   SRSP LP   PL Q+Q   + E PGT   + N    EL
Sbjct: 294 DSNNVHFDHLS-SRHQTPVVLNSRSPSLP---PL-QKQHLQSTEKPGTNTLLTNNDVQEL 348

Query: 143 YFRKGH 148
           +  K H
Sbjct: 349 HKHKLH 354

>SAKL0B02684g Chr2 complement(256014..257759) [1746 bp, 581 aa] {ON}
           similar to uniprot|Q12308 Saccharomyces cerevisiae
           YPL007C TFC8 One of six subunits of RNA polymerase III
           transcription initiation factor complex (TFIIIC) part of
           TFIIIC TauB domain that binds BoxB promoter sites of
           tRNA and other genes linker between TauB and TauA
           domains human homolog is TFIIIC-90
          Length = 581

 Score = 29.3 bits (64), Expect = 3.8,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 53  GLLWQRCRRIFEPLLSPRALECIVGDSRALDCPKRHVN 90
           G  W+RC   F PL++ +   C V + R +D  +  +N
Sbjct: 517 GHTWKRCAITFLPLITTKVKVCPVSNQRIIDIRRDSLN 554

>Kwal_23.5106 s23 complement(1014284..1016017) [1734 bp, 577 aa]
           {ON} YPL007C (TFC8) - 60 kDa subunit of TFIIIC (tau60)
           [contig 7] FULL
          Length = 577

 Score = 29.3 bits (64), Expect = 3.9,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 19/38 (50%)

Query: 53  GLLWQRCRRIFEPLLSPRALECIVGDSRALDCPKRHVN 90
           G +W+RC   F PLL+     C V + R +D  +   N
Sbjct: 515 GHIWKRCAGTFLPLLTSSVKVCPVSNFRIIDIKRDAYN 552

>CAGL0H00891g Chr8 complement(85886..90313) [4428 bp, 1475 aa] {ON}
            similar to uniprot|Q12280 Saccharomyces cerevisiae
            YPL242c IQG1 involved in cytokinesis
          Length = 1475

 Score = 29.3 bits (64), Expect = 4.5,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 77   GDSRALDCPKRHVNILTQSRD-RTSVRKCSRSPPLPDDEPLFQEQQTTAREHPGTQQD 133
            G  +  D  KR   I+ Q  D  T++   S S  LP DEP+FQE     R + G ++D
Sbjct: 1169 GIRKVYDQVKRAFVIMIQVEDVETNLYDLSVSSVLPQDEPVFQE---LLRNNIGLEKD 1223

>KLTH0C08624g Chr3 complement(723206..724921) [1716 bp, 571 aa] {ON}
           conserved hypothetical protein
          Length = 571

 Score = 28.5 bits (62), Expect = 7.3,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 55  LW--QRCRRIFEPLLSPRALECIVGDS-RALDCPKRHVNILTQSRDRTSVRKCSRSPPLP 111
           LW  +R  ++ E +L  +    IVG S  A+D  KR V IL +++    +   S +PP+P
Sbjct: 270 LWYNKRFPQLKEEVLLDKRRVVIVGKSFSAMDVLKRLVPILDKAQGNLEIILSSNTPPMP 329

Query: 112 DD 113
           ++
Sbjct: 330 EN 331

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,513,019
Number of extensions: 456141
Number of successful extensions: 1221
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1219
Number of HSP's successfully gapped: 12
Length of query: 149
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 50
Effective length of database: 42,129,465
Effective search space: 2106473250
Effective search space used: 2106473250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)