Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR310C3.492ON62362328780.0
Ecym_12373.492ON7274104172e-42
SAKL0F02772g3.492ON7732623402e-32
KLTH0F14828g3.492ON8362592922e-26
KLLA0D16236g3.492ON8712702878e-26
Skud_7.4413.492ON8072632796e-25
Suva_7.4183.492ON8312652796e-25
YGR130C3.492ON8162632707e-24
Kwal_55.212293.492ON7872592672e-23
Smik_6.2263.492ON8392632601e-22
ZYRO0D09988g3.492ON9942602307e-19
Kpol_480.143.492ON6992502153e-17
TDEL0D056003.492ON7002542048e-16
NCAS0E008103.492ON6922401983e-15
TPHA0D042503.492ON6292491957e-15
CAGL0I10516g3.492ON8132671734e-12
NDAI0G009403.492ON6562501592e-10
KNAG0B008103.492ON7572741163e-05
TBLA0C044803.492ON802951000.002
KNAG0A079403.492ON275102850.074
Kwal_23.63566.349ON305111770.80
NCAS0F035503.492ON44182761.4
NDAI0F011806.289ON63946761.5
Suva_11.1452.633ON657161761.5
NDAI0B058603.492ON68185761.6
KAFR0A060404.237ON110277733.3
TBLA0E040608.604ON804120715.5
Kpol_295.31.372ON416131706.0
Kwal_27.120398.542ON718202707.4
Skud_4.1964.238ON1792128707.8
KLTH0G12298g8.323ON50097698.0
NOTE: 2 genes in the same pillar as AFR310C were not hit in these BLAST results
LIST: KAFR0G03690 KAFR0C01960

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR310C
         (623 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...  1113   0.0  
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   165   2e-42
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   135   2e-32
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   117   2e-26
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   115   8e-26
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   112   6e-25
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   112   6e-25
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   108   7e-24
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   107   2e-23
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   104   1e-22
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    93   7e-19
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    87   3e-17
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    83   8e-16
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    81   3e-15
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    80   7e-15
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    71   4e-12
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    66   2e-10
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    49   3e-05
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    43   0.002
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    37   0.074
Kwal_23.6356 s23 complement(1548185..1549102) [918 bp, 305 aa] {...    34   0.80 
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    34   1.4  
NDAI0F01180 Chr6 complement(284217..286136) [1920 bp, 639 aa] {O...    34   1.5  
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    34   1.5  
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    34   1.6  
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    33   3.3  
TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8...    32   5.5  
Kpol_295.3 s295 complement(3906..5156) [1251 bp, 416 aa] {ON} co...    32   6.0  
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...    32   7.4  
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    32   7.8  
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...    31   8.0  

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/623 (91%), Positives = 568/623 (91%)

Query: 1   MSIALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGGAAVTGDASHDEYYSPF 60
           MSIALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGGAAVTGDASHDEYYSPF
Sbjct: 1   MSIALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGGAAVTGDASHDEYYSPF 60

Query: 61  RDAIAVEEAHGSGTLKFPTTGTHVTEEARRRVPDIDEPKRLSTVDXXXXXXXXXXXXXXX 120
           RDAIAVEEAHGSGTLKFPTTGTHVTEEARRRVPDIDEPKRLSTVD               
Sbjct: 61  RDAIAVEEAHGSGTLKFPTTGTHVTEEARRRVPDIDEPKRLSTVDERQRQQLQELELKEG 120

Query: 121 XXXXYKESQKIVDVRGKSDVTQRRAAQNXXXXXXXXXXXXALGDDDAVLVDYKSVLIVYP 180
               YKESQKIVDVRGKSDVTQRRAAQN            ALGDDDAVLVDYKSVLIVYP
Sbjct: 121 QLRLYKESQKIVDVRGKSDVTQRRAAQNTSKTSTTTGDKGALGDDDAVLVDYKSVLIVYP 180

Query: 181 SGTYDGAYGPVTDRLGGDAKATTQKDVSDVSVQAADKDSEEGKPLLERSSTKRAAETTER 240
           SGTYDGAYGPVTDRLGGDAKATTQKDVSDVSVQAADKDSEEGKPLLERSSTKRAAETTER
Sbjct: 181 SGTYDGAYGPVTDRLGGDAKATTQKDVSDVSVQAADKDSEEGKPLLERSSTKRAAETTER 240

Query: 241 RHSAGPLSNIMSHMPXXXXXXXXXXXXXXHHDKEQLLVPNGTPEEPEVVLLTNRGYMSKA 300
           RHSAGPLSNIMSHMP              HHDKEQLLVPNGTPEEPEVVLLTNRGYMSKA
Sbjct: 241 RHSAGPLSNIMSHMPFKLQKGGKLGGLFKHHDKEQLLVPNGTPEEPEVVLLTNRGYMSKA 300

Query: 301 VYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKLRADITALQAETE 360
           VYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKLRADITALQAETE
Sbjct: 301 VYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKLRADITALQAETE 360

Query: 361 GQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXXXLADKEEIVHQNQELQPEIDRL 420
           GQIDGLEASLSKNIQDMKAENADKQHVLH          LADKEEIVHQNQELQPEIDRL
Sbjct: 361 GQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRAEQLADKEEIVHQNQELQPEIDRL 420

Query: 421 RKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREV 480
           RKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREV
Sbjct: 421 RKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREV 480

Query: 481 ADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKIRQEIEFQRKELVALKER 540
           ADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKIRQEIEFQRKELVALKER
Sbjct: 481 ADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKIRQEIEFQRKELVALKER 540

Query: 541 PQRTAASSFQGVATAVPVARHGTNDVKPFATASADPNSSALKNLSSGPSTNKESSLYDNE 600
           PQRTAASSFQGVATAVPVARHGTNDVKPFATASADPNSSALKNLSSGPSTNKESSLYDNE
Sbjct: 541 PQRTAASSFQGVATAVPVARHGTNDVKPFATASADPNSSALKNLSSGPSTNKESSLYDNE 600

Query: 601 TADEVIVTEGDSKPSRLIVLPDN 623
           TADEVIVTEGDSKPSRLIVLPDN
Sbjct: 601 TADEVIVTEGDSKPSRLIVLPDN 623

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  165 bits (417), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 215/410 (52%), Gaps = 75/410 (18%)

Query: 280 NGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIA 339
           N TPE+PE ++LT +GYMSK +YDRL  EE+ H  +L + D+++A  Y+  ++ YE+++A
Sbjct: 322 NATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381

Query: 340 DLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXXX 399
            L+ EI+++ A +  L+++TE ++  +EASLS+N+ D++A++ +++  L           
Sbjct: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441

Query: 400 LADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQ 459
           + +K  I  +  +++PE++ L++L+    VE+ + Q+ +  L  +LDA+  EL+ V+D+Q
Sbjct: 442 ITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQ 501

Query: 460 AEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILTE 519
            EV++ +A L+E++ Q+E+++++SN     N+E L+ L   +   ++  +D + SE+   
Sbjct: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNL---ENHPSIAALDNQVSEVTRT 558

Query: 520 IAKIRQEIEFQRKELVAL------------------------------------------ 537
           ++ + QE   Q+ EL  L                                          
Sbjct: 559 VSAVEQEHAAQKDELTELSTKKEPTLSAVNPPKMVEEIDVQEISELPDDVIVPEELDRLL 618

Query: 538 ---KERPQRTAASSFQGVA---TAVPVARHGTN-DVKPFATASADPNSSALK--NLSS-- 586
              K++P     +S  G +   T VP +    N +VK     S DPN+ + K  NLSS  
Sbjct: 619 HSSKQKPLGNPFTSHDGDSLDFTHVPASAKADNGEVK----ISLDPNAESKKPVNLSSLS 674

Query: 587 ------------GPSTNKESSLYDNETADEVIVTEGD---SKPSRLIVLP 621
                        P T K +S Y+ ET +EV++ EGD   S  SRLI +P
Sbjct: 675 SRPRNPPSIATTSPGTAKGNSEYEYETIEEVVIVEGDGTRSDSSRLIAVP 724

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 66/142 (46%), Gaps = 8/142 (5%)

Query: 4   ALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQ--SHHPPTGGAAVTGDA-SHDEYYSPF 60
           ++FKK  +P DPF+EL    E+K      F+++  +H   +      G+     EY SPF
Sbjct: 3   SIFKKNKQP-DPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSPF 61

Query: 61  RDAIAVEEAHGSGTLKFPTTGTH----VTEEARRRVPDIDEPKRLSTVDXXXXXXXXXXX 116
           RD  AV EA     LKFPTTG H    V +  +R+  DI EP+   T D           
Sbjct: 62  RDDKAVAEAERIRDLKFPTTGHHSTVRVKDNVKRKAQDIAEPRSFGTTDLKQQKQLDELG 121

Query: 117 XXXXXXXXYKESQKIVDVRGKS 138
                    + SQKIVDVR  S
Sbjct: 122 MKENQLEYLRNSQKIVDVRKSS 143

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  135 bits (340), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 151/262 (57%)

Query: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338
           P  TP++PE ++ T++GYMSKA+YD+L  +E+ H   L   +++ A  Y    + Y  ++
Sbjct: 350 PLATPQDPEYIVRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKL 409

Query: 339 ADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXX 398
             L ++I +L+A +  L+ +T+ +I   E+ LSK + D+ A +   ++V+          
Sbjct: 410 TLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQ 469

Query: 399 XLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458
            +A+++EI  +++E++ EI+ L  LK+    E  E QA++D L  QLD++  +++ + D+
Sbjct: 470 KIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDK 529

Query: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILT 518
           Q E++ ++A L ++K ++E E  D+ E  K +   LE +   +Y   +  ID++ + +L 
Sbjct: 530 QMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLG 589

Query: 519 EIAKIRQEIEFQRKELVALKER 540
            +  I+QE   Q+ E  A+ +R
Sbjct: 590 SLTLIKQENANQKTEFAAITKR 611

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 62/151 (41%), Gaps = 27/151 (17%)

Query: 3   IALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGGAAVTGDASHD---EYYSP 59
           +++FKKK +  DPF  L   PE+ ++ P  FLR+          VT     +   +Y SP
Sbjct: 1   MSIFKKK-QQVDPFAHLLQ-PEQPQEQPN-FLRK---------VVTNKKKEEEEKDYSSP 48

Query: 60  FRDAIAVEEAHGSGTLKFPTT------------GTHVTEEARRRVPDIDEPKRLSTVDXX 107
           FR    +  A      KFPT             G  V + A+RR  DI  P+ L   D  
Sbjct: 49  FRSQQELIAAKNVKAKKFPTVSATSGTASAADLGYKVIDSAKRRAKDISVPRYLKNTDEK 108

Query: 108 XXXXXXXXXXXXXXXXXYKESQKIVDVRGKS 138
                             K+SQKIVDVR K+
Sbjct: 109 QRKKLDKLEFKENHLQYLKDSQKIVDVRKKN 139

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 137/259 (52%)

Query: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338
           P  +P +PE ++  ++GYMSKA+YD L  EE  H   + +  ++    Y+  +  YE  +
Sbjct: 376 PVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRL 435

Query: 339 ADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXX 398
             L ++I++L A +  LQ +T  +I+  EA LS  + D+ AE++  ++V+          
Sbjct: 436 TSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAA 495

Query: 399 XLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458
            + +KE +  + ++++ E++ L KL+     E  E Q R+D+L  +LDA+   ++ +  Q
Sbjct: 496 KVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQ 555

Query: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILT 518
           QAE+   +  LQ+QK  L  E   ++E    N   LE +   +Y   +  ID K SE+LT
Sbjct: 556 QAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLT 615

Query: 519 EIAKIRQEIEFQRKELVAL 537
            +  ++QE    + E  A+
Sbjct: 616 SLTVVKQETANHKTEFAAV 634

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 53/133 (39%), Gaps = 19/133 (14%)

Query: 26  KKKDPTEFLRQSHHPPTGGA-------AVTGDASHDEYYSPFRDAIAVEEAHGSGTLKFP 78
           K++DP E L Q   P TG A        V+ +     Y SPFR + ++  A      KFP
Sbjct: 4   KRQDPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSAYNSPFRTSQSLAAAQKRKMQKFP 63

Query: 79  T------------TGTHVTEEARRRVPDIDEPKRLSTVDXXXXXXXXXXXXXXXXXXXYK 126
           T             G  V + ARRR  DI  P+ L   D                    K
Sbjct: 64  TVSASVSAHSSSDMGYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKK 123

Query: 127 ESQKIVDVRGKSD 139
           +SQ+IVDVRG  D
Sbjct: 124 DSQRIVDVRGGQD 136

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  115 bits (287), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 149/270 (55%), Gaps = 14/270 (5%)

Query: 278 VPNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337
            P  TPE+PE+++ T  GY+SK+VYD+L  +E  H  +L    ++  + Y+  +Q YE++
Sbjct: 443 APVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEK 502

Query: 338 IADLDAEISKLRADITALQAETE-----GQIDGLEASLSKNIQDMKAENADKQHVLHXXX 392
           I  + AEI++L A +  ++ E E      Q++  +A L  N++ + A+       L+   
Sbjct: 503 IQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGD-----LYKQT 557

Query: 393 XXXXXXXLADKE--EIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSR 450
                  ++DKE  E+ HQ   +Q EID L  LK+  A E  E ++++++L  +LD ++ 
Sbjct: 558 EEIKNQTISDKEDKEVAHQT--VQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTS 615

Query: 451 ELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREID 510
            L     ++ E +  +  L+E+KA+LE+E+ ++ E  ++N   +E ++  +Y   V EI+
Sbjct: 616 ALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEIN 675

Query: 511 AKNSEILTEIAKIRQEIEFQRKELVALKER 540
            + S +L  +  I+QEI  Q+ E  ++  R
Sbjct: 676 TEISSLLASLGLIQQEIANQKVEFSSVTRR 705

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  112 bits (279), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 136/263 (51%), Gaps = 1/263 (0%)

Query: 279 PNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337
           P  TPE PE+++ T   GY+SKAVYD++N +EK H   L +        Y   S  Y + 
Sbjct: 389 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSER 448

Query: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXX 397
           + DL  +I ++   + A++ ET  +I+  +  L K I D+   + +K+ ++         
Sbjct: 449 LQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKN 508

Query: 398 XXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457
             L +K+E++ +   ++ EID L   K N   E  +    +  L QQLDAQ  ++  +  
Sbjct: 509 QKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINL 568

Query: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEIL 517
           +Q++V   +  LQ++K  L  +  ++ +  +RN + LE +   +Y   + +ID + S +L
Sbjct: 569 KQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLL 628

Query: 518 TEIAKIRQEIEFQRKELVALKER 540
            ++  IRQE   ++ EL A+ +R
Sbjct: 629 NKMTIIRQENANEKTELSAITKR 651

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  112 bits (279), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 138/265 (52%), Gaps = 1/265 (0%)

Query: 277 LVPNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYE 335
           L P  TPE PE+++ T   GY+SKAVYD++N +EK H   LV+        Y   +  Y+
Sbjct: 410 LNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYK 469

Query: 336 KEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXX 395
           +++ DL  +I ++   +  L+ ET  +I+  +  L K I D+  E+ +K+ ++       
Sbjct: 470 EKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENM 529

Query: 396 XXXXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLV 455
               L +K E++++   ++ EID L   K N   E  +    +  L QQLDAQ  ++  +
Sbjct: 530 KKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQI 589

Query: 456 TDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSE 515
             +Q++    +  L++QK  L  +  ++ +  ++N E LE +   +Y   + +ID + S 
Sbjct: 590 NLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQIST 649

Query: 516 ILTEIAKIRQEIEFQRKELVALKER 540
           +L ++  IRQE   +R  L A+ ++
Sbjct: 650 LLNQMTIIRQENANERTHLSAITKK 674

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  108 bits (270), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 139/263 (52%), Gaps = 1/263 (0%)

Query: 279 PNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337
           P  TPE PE+++ T   GY+SKAVYD++N +EK H   L +        Y   ++ Y+++
Sbjct: 398 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEK 457

Query: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXX 397
           + DL  +I ++   + A++ ET  +I+  +  L K I D+ AE+ +K+ ++         
Sbjct: 458 LQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKN 517

Query: 398 XXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457
             L +K E++ +   ++ EID L   K N   E  +    +  L QQLDAQ  ++  +  
Sbjct: 518 QKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINL 577

Query: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEIL 517
           +Q +V   +  L+++K  L  +  ++ +  ++N + LE +   +Y   + +ID + S +L
Sbjct: 578 KQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLL 637

Query: 518 TEIAKIRQEIEFQRKELVALKER 540
            E+  I+QE   ++ +L A+ +R
Sbjct: 638 NEVTIIKQENANEKTQLSAITKR 660

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 135/259 (52%)

Query: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338
           P  +P++PE ++  ++GYMSKA+YD L  EE  H   +    ++    Y   +Q YE  +
Sbjct: 348 PVASPDDPEFIVKFDKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHL 407

Query: 339 ADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXX 398
             L ++I++L A +  LQ +T  +I+   A LS  + +  A++++ ++V+          
Sbjct: 408 TSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAA 467

Query: 399 XLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458
            + +K  +V +  E++ E + L   +        E  +RID+L  QLD++   ++ + DQ
Sbjct: 468 KIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQ 527

Query: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILT 518
           QAE+   +  L++QK  L  +   ++E    N   LE ++  DY   +  +D++ S++L+
Sbjct: 528 QAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKINALDSQISQLLS 587

Query: 519 EIAKIRQEIEFQRKELVAL 537
            +A ++QE   Q  E  A+
Sbjct: 588 SLALVKQETANQHTEFAAV 606

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 57/144 (39%), Gaps = 24/144 (16%)

Query: 5   LFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGGAAVTGDASHDEYYSPFRDAI 64
           +FKKK    DPFE L    + KK+    FLR+          VT +     Y SPFR + 
Sbjct: 1   MFKKK---HDPFEHLFQQDQPKKETSKGFLRK---------VVTKEQEDATYSSPFRTSQ 48

Query: 65  AVEEAHGSGTLKFPTT------------GTHVTEEARRRVPDIDEPKRLSTVDXXXXXXX 112
           +  EA      +FPT             G  V + AR+R  DI  P+ L   D       
Sbjct: 49  SQVEAQKRKVQRFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRL 108

Query: 113 XXXXXXXXXXXXYKESQKIVDVRG 136
                        K+SQKIV V+G
Sbjct: 109 DKLERKEDSLQYKKDSQKIVKVKG 132

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 141/263 (53%), Gaps = 1/263 (0%)

Query: 279 PNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337
           P  TPE+PE+++ T   GY+SKAVYD++N +EK H   L +        Y   ++ YE++
Sbjct: 421 PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEK 480

Query: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXX 397
           + DL  +I ++   + A++ ET  +I+  +  L K I D+ A + +K+ ++         
Sbjct: 481 LQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKN 540

Query: 398 XXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457
             L +K  ++++   ++ +ID L   K N   +  +    +  L QQLDAQ  ++  +  
Sbjct: 541 QKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINL 600

Query: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEIL 517
           +Q++V   + +L+++K  L  +  ++ +  ++N + LE +   +Y   + +ID + S +L
Sbjct: 601 KQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLL 660

Query: 518 TEIAKIRQEIEFQRKELVALKER 540
            E+  I+QE   ++ +L A+ +R
Sbjct: 661 NEMTIIKQENANEKTQLSAITKR 683

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 126/260 (48%), Gaps = 9/260 (3%)

Query: 273 KEQLLVPN--GTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAH---LGRLVNSDEDAAQD 326
           K Q   PN   TPE PE+++ T+R G++SKAVYD++  E   H   L   ++S++   ++
Sbjct: 480 KSQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEE 539

Query: 327 YQLVSQHYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQH 386
            Q+    Y+  + +L  E+ KL   +  ++ +    I+     LSK   +   +  +K++
Sbjct: 540 KQV---DYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKN 596

Query: 387 VLHXXXXXXXXXXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLD 446
            +             + +EI H+ +E+Q EI  L   K+N   E      R+      LD
Sbjct: 597 AIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLD 656

Query: 447 AQSRELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATV 506
           A+   L  +  +  +    +  L  +KA LE+E+A   E   +N +A+E+    +Y   V
Sbjct: 657 AKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKV 716

Query: 507 REIDAKNSEILTEIAKIRQE 526
            EID K S +L E++ I+QE
Sbjct: 717 HEIDDKISNLLGELSVIKQE 736

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 130/250 (52%), Gaps = 2/250 (0%)

Query: 279 PNGTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337
           P  +PE PE V+ T + GY+SKAVYD++  ++  H   L N +    + YQ     YE  
Sbjct: 356 PMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDN 415

Query: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXX 397
           +AD+ ++I  +   +  L+ +T  +I+ +E  L KNI DM   + D ++ +         
Sbjct: 416 LADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKL 475

Query: 398 XXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457
             L  K++ + +  E++ EI+ L + +     +  E  ++++++  QLDA+  ++R    
Sbjct: 476 EKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQ 535

Query: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDYTATVREIDAKNSEI 516
           Q+ ++   +A L   K +LE E+  + E  K N E L  LN + +Y   + EID + +  
Sbjct: 536 QKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGR 595

Query: 517 LTEIAKIRQE 526
           L +++ I++E
Sbjct: 596 LEKLSTIKKE 605

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 125/254 (49%)

Query: 284 EEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDA 343
           E PE V+ T  GY++K +YD++  +++ H   +    +D  Q +        ++I  L A
Sbjct: 346 ENPEHVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRA 405

Query: 344 EISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXXXLADK 403
           +I +++ ++  L+++T+ +I+  E  L++   +M   +  K++ +           L++K
Sbjct: 406 QIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEK 465

Query: 404 EEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVS 463
           + ++ +  E+Q EID L   KE    E  +    I++L  ++DA+  +L  V  +Q    
Sbjct: 466 DSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQ 525

Query: 464 VVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKI 523
             +  LQ+QK  +  ++  +N     N + +E      Y   + E+D + S +L ++  I
Sbjct: 526 EEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTI 585

Query: 524 RQEIEFQRKELVAL 537
           RQ    +R EL A+
Sbjct: 586 RQHCANERTELSAI 599

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 115/240 (47%)

Query: 287 EVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEIS 346
           E+V     GY+SKAVYD++  +E+ H   L + +    + Y+   Q Y+K + D+D ++S
Sbjct: 277 EIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMS 336

Query: 347 KLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXXXLADKEEI 406
           +L   I   + +T+ +ID +   L K + D K    + +  +           L++KE +
Sbjct: 337 ELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENV 396

Query: 407 VHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVL 466
           ++ N E++  ID L   K     E       +  +  +LDA+  ++  +   Q  +   +
Sbjct: 397 LNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKI 456

Query: 467 ATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKIRQE 526
             L  QK  L+ E+A +      N + +E ++  +Y   + +ID + + +L ++  ++QE
Sbjct: 457 DALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQE 516

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 123/249 (49%), Gaps = 4/249 (1%)

Query: 281 GTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIA 339
            +PE PE ++ TN    +SKAVYD++N E+K H   L N +    + Y    Q YE ++ 
Sbjct: 316 ASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 375

Query: 340 DLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAE-NADKQHVLHXXXXXXXXX 398
           +L  ++  +         + + +I+ +E  L KN+ D++++ N DK  V+          
Sbjct: 376 ELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQK 435

Query: 399 XLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQ 458
             A KE+++ +  +++ EI++L   KE    E       ++ L   LD +  ++  + + 
Sbjct: 436 INA-KEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494

Query: 459 QAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDYTATVREIDAKNSEIL 517
              +   +  LQ +K  LE E+ D  E  K N++ L++LN + DY   + EID + +   
Sbjct: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554

Query: 518 TEIAKIRQE 526
            ++A I+ E
Sbjct: 555 DKLAIIKNE 563

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 129/267 (48%), Gaps = 1/267 (0%)

Query: 272 DKEQLLVPNGTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLV 330
           D+ QL  P  TPE PE++  T   GYMSK +YD++  +E  H   L    +     Y   
Sbjct: 411 DQSQLDFPIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDK 470

Query: 331 SQHYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHX 390
            + Y  E+ +L  EI  +   +  L+ ET  +I+  E +L K I +    + ++++ +  
Sbjct: 471 MEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFK 530

Query: 391 XXXXXXXXXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSR 450
                    +  K+EI+ ++  +Q EI +L   K+    E  +    +  L QQLDA+  
Sbjct: 531 ETENIKNQKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIM 590

Query: 451 ELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREID 510
           ++  +T +Q E    +  L+ QK + + ++  + +  +  ++ +E     +Y   +  ID
Sbjct: 591 KVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTID 650

Query: 511 AKNSEILTEIAKIRQEIEFQRKELVAL 537
            + SE+L E+A I+QE   ++ EL  +
Sbjct: 651 NQISELLNELAIIKQENANEQTELSKI 677

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 123/250 (49%), Gaps = 3/250 (1%)

Query: 279 PNGTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337
           P  TP   E ++ T + G +SK++YD+L  +++ H   L +   +  + Y +  Q YE E
Sbjct: 228 PKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENE 287

Query: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXX 397
           +  LD +I      I   + +T+ ++D + A L K + D ++   D +  +         
Sbjct: 288 LKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKR 347

Query: 398 XXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457
             + +K  +   + ++  EID+L K KE    E  E    +  + +QLDA+  +++ +  
Sbjct: 348 EKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINI 407

Query: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNR-EALERLNQTDYTATVREIDAKNSEI 516
            Q  +   +  L  +K  L +E+ ++N+FT  N  E +E ++   Y   +  ID++ +++
Sbjct: 408 TQMNLQNKIDGLNNEKLGLTKEI-EANKFTHANNVETIENVDNKQYLPKLNNIDSQINDL 466

Query: 517 LTEIAKIRQE 526
           L ++  I+QE
Sbjct: 467 LNQLTLIKQE 476

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 127/274 (46%), Gaps = 9/274 (3%)

Query: 279 PNGTPEEPEVVL-LTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337
           P  T + PE++L L   G++S AV++++  ++K H   + +   +    +    Q YE++
Sbjct: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357

Query: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAE-NADKQHVLHXXXXXXX 396
           +A +D     + A +   + +   + + +E    K + D  A  N  K  VLH       
Sbjct: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLH-EAQLVK 416

Query: 397 XXXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVT 456
              L D + I  +   +Q E+++L   K +   +       +  + ++LDAQ  +L    
Sbjct: 417 LQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFN 476

Query: 457 DQQAEVSVVLATLQEQKAQLEREVADSNEFTK----RNREALERLNQTDYTATVREIDAK 512
            +Q +++  +  L ++K +LE E+ D+N+F+K    RN   LE          V+  D+ 
Sbjct: 477 HKQDKITRQIRDLTQRKTELEAEI-DANQFSKGNADRNLADLETGQHLKSHELVKVTDSI 535

Query: 513 NSEILTEIAKIRQEIEFQRKELVALKERPQRTAA 546
             + L  +A ++QEI  +R +L+ +    +R  A
Sbjct: 536 QGK-LDSLAVVKQEISGERLKLIGITNEMERARA 568

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 276 LLVPNGTPEEPEVVLLT----NRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVS 331
           ++ P  TP+ PE+++ T    N   +SK+VYD +N   K H  R+ +   D+   Y+  +
Sbjct: 374 VINPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKN 433

Query: 332 QHYEKEIADLDAEISKLRADITALQAETEGQIDGL 366
           + +   I +LD +I  +  DI   +A    +ID L
Sbjct: 434 EEFNNSINELDLKIKSIEKDIIDYKA----KIDSL 464

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 279 PNGTPEEPEVVLL------TNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQ 332
           P  TPE PE V++      TN+ Y SK ++D +  +   H   L++ +  A        +
Sbjct: 121 PVATPETPEEVVIYKHLNGTNKAY-SKEIFDNIQRDICNHNAWLLSREGKANDQCATKME 179

Query: 333 HYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNI 374
            Y K++A LD +I   +A +  L+ + +  ID  E  L+K  
Sbjct: 180 EYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTF 221

>Kwal_23.6356 s23 complement(1548185..1549102) [918 bp, 305 aa] {ON}
           YCR076C - Hypothetical ORF [contig 17] FULL
          Length = 305

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 45/111 (40%), Gaps = 16/111 (14%)

Query: 473 KAQLEREVADSNEFTKRNRE------ALERLNQTDYTATVREIDAKNSEILTEIAKIRQE 526
           K QLE E       T++NRE       LE+L  ++ T+    + AK  +  +EI     E
Sbjct: 136 KFQLEHEPTKRASSTRQNREDSSVHEKLEKLKFSNVTSPAASLPAK--QPFSEIPGFEDE 193

Query: 527 IEFQRKELVALKERPQRTAASSFQGVATAVPVARHGTNDVKPFATASADPN 577
            E Q        ++P R A  +F     AVP    G  D   + +    PN
Sbjct: 194 YEIQ--------QQPGRLATGAFGVPGLAVPPPEVGYGDQDLYPSGQKYPN 236

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 279 PNGTPEEPEVV--LLTNRG-YMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYE 335
           P  TP+ PE++  L  N+   +SK  YDRL   +  H   L + + +   +Y    Q Y+
Sbjct: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239

Query: 336 KEIADLDAEISKLRADITALQA 357
           K+I  LD +I   +     L+A
Sbjct: 240 KQIDVLDEKIRYYQEMSNVLEA 261

>NDAI0F01180 Chr6 complement(284217..286136) [1920 bp, 639 aa] {ON}
           Anc_6.289 YMR198W
          Length = 639

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 336 KEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAEN 381
           KEIA LD ++ +L+  I  L  E E + +   ++L KN    K EN
Sbjct: 178 KEIAHLDEKLIQLQDQIIGLTMENENKCNQYNSTLQKNFNKFKLEN 223

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 25/161 (15%)

Query: 424 KENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQA------EVSVVLATLQEQKAQLE 477
           KE+ A +  + +    +L+ QLD+ ++ L  +T+++       EVSV+L    EQ AQLE
Sbjct: 420 KEDMATKFDDSKKENTKLKLQLDSIAQLLGKLTNEEPNNSINDEVSVILMNRCEQIAQLE 479

Query: 478 ----REV-ADSN-----EFTKRNREALERLNQTDYTATVREIDAKNSEI---LTEIAKIR 524
               R+V A+S      E+ K   EALE +N       + +I  +  EI   LT  A ++
Sbjct: 480 LSFDRQVNANSKLEKELEYKKSKEEALESMN----VKLLEQIQLQEKEIQELLTTNAILK 535

Query: 525 QEIEFQRKELVALKERPQRTAASSFQ-GV-ATAVPVARHGT 563
            E+E   K      ER +    S  + G+  +A P  R G+
Sbjct: 536 GELETHSKLTETRNERIKSLEGSVKELGINKSATPSPRKGS 576

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 277 LVPNGTPEEPEVVLLTN--RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHY 334
           L P  T   PE+++  N  +  ++K  YD+L +  + H   ++N++ +++  Y    + Y
Sbjct: 382 LNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTY 441

Query: 335 EKEIADLDAEISKLRADITALQAET 359
           ++++  L+ +I+     I+ ++ +T
Sbjct: 442 QEKLNKLNEQINHHNLIISMIKKDT 466

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 411 QELQPEIDRLRKLKENTAVEITECQARIDQLQQQL-DAQSRELRLVTDQQAEVSVVLATL 469
           +E+  + D+LR+   +  ++ TE   +++ L   L D Q+ E  +V  +QA+V  +  ++
Sbjct: 420 REMGGDKDQLREELADLEMQNTELNTQVNALTINLQDVQNEEREVVQQRQADVQQLERSI 479

Query: 470 QEQKAQLEREVADSNEF 486
           Q QK Q++R V  +N F
Sbjct: 480 QNQKIQIQRTVESNNNF 496

>TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON}
           Anc_8.604 YOR195W
          Length = 804

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 402 DKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAE 461
           D +EI+ Q   ++ E++++ + K +   +I E + +ID+LQ +++ Q+ EL  + +   +
Sbjct: 505 DTKEIIEQ---IKKELNKMEEDKNSKEYQIIEFEKKIDELQGKINNQNDELLKLKESYDK 561

Query: 462 VSVVLATLQEQKAQLEREVAD--SNEFTKRNREALERLNQTDYTATVREIDAKNSEILTE 519
           ++        +  QL  E+ +  SNE   + + + +  N  D+ A       +N +IL E
Sbjct: 562 INDNFEIKNAEVIQLNEEIKELRSNEINLKEKISNDEKNSNDWKAKYESSKIENEKILIE 621

>Kpol_295.3 s295 complement(3906..5156) [1251 bp, 416 aa] {ON}
           complement(3906..5156) [1251 nt, 417 aa]
          Length = 416

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 60/131 (45%), Gaps = 18/131 (13%)

Query: 402 DKEEIVHQNQELQPEIDRLRKL--------KENTAVEITECQARIDQLQQQLDAQSRELR 453
           D +E +H+  +L  ++ +L K         K +   EI E    + QL Q+  A  ++L 
Sbjct: 70  DIDEYLHETDKLMKQLSKLYKKNSLPGFEDKSHDEKEIEEISFNVTQLFQKCYAVMKKLN 129

Query: 454 LVTDQQAEVS--------VVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTAT 505
            ++ +Q   +        ++L  L+++ AQL +    SN+F       L+ LN+ D    
Sbjct: 130 YISTEQVYANKRLKYDELIILGNLEKRYAQLIQ--FKSNQFRVLQNNYLKFLNKDDMKPI 187

Query: 506 VREIDAKNSEI 516
           + ++D  N+ +
Sbjct: 188 LPKLDNSNNTM 198

>Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]
           {ON} YPL074W (YTA6) - AAA family ATPase [contig 24] FULL
          Length = 718

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 90/202 (44%), Gaps = 20/202 (9%)

Query: 305 LNDEEKAHLGRLVNSDEDAAQ--DYQLVSQHYEKEIADLDAEISKLRA---DITALQAET 359
           LN+  KA  G L    E  AQ  ++  V   +  +  D+ A ++ LR    DI   + E 
Sbjct: 46  LNELVKALAGVLAYLHEGLAQIENFYKVKNIFFLKSPDILAMVNDLRILDHDIKMSKQEA 105

Query: 360 EGQIDGLEASLSKNIQDMKAENADKQHVLHXXXXXXXXXXLADKEEIVHQNQELQP---- 415
           E ++   E+S  KN Q + + N+                 +A ++E+    +E Q     
Sbjct: 106 EKKLT--ESSEGKN-QTLSSGNSHFSLSKLLKKTKISSSSVARRDEMRKSEEEKQAKEVE 162

Query: 416 EIDRLRKLKENTAVEITECQARIDQLQQQLDA-QSRELRLVTDQQAEVSVVLATLQEQKA 474
           E+ RL+KL+E  AV   E       L ++L+A Q+R L +   +Q E  + +    E+K+
Sbjct: 163 ELKRLKKLEEERAVLDKEA------LDRKLEAEQARALEMAVKRQVEKEMAVRATVERKS 216

Query: 475 QLEREVADSNEFTKRNREALER 496
              RE +   EF K  R A ER
Sbjct: 217 APGREKSQKPEFEKPQR-AFER 237

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
           (REAL)
          Length = 1792

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 67/128 (52%), Gaps = 8/128 (6%)

Query: 337 EIADLDAEISKLRADITALQAETE---GQIDGLEASLSKNIQDM--KAENADKQHVLHXX 391
           E+ +L  + SKL+ ++ +LQ ETE   G +     +LSK  +D+  K ++    H+L   
Sbjct: 731 EVEELQKQCSKLKNELGSLQTETEATNGDLTKKLEALSKEHEDLMEKYQSLTSSHLLLKE 790

Query: 392 XXXXXXXXLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRE 451
                   L   +E +++  +L+  ++   K KEN A+ I EC++ I + ++ ++   +E
Sbjct: 791 SFSSLEIELGTIKESLNKMTQLRDALE--TKDKENQAL-IQECKSTIQKQEEAIEILEKE 847

Query: 452 LRLVTDQQ 459
           L  V+ Q+
Sbjct: 848 LDNVSSQK 855

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 16/97 (16%)

Query: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338
           PNGTP             MS  + + L  ++    GRL+ +  +  +  +    + +K+I
Sbjct: 104 PNGTPNN----------NMSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQI 153

Query: 339 ADLDAEISKLRAD-ITALQAETE-----GQIDGLEAS 369
             LD EI K + D  T  Q ET       ++ G  AS
Sbjct: 154 EILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSAS 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,568,836
Number of extensions: 2339573
Number of successful extensions: 12714
Number of sequences better than 10.0: 674
Number of HSP's gapped: 12707
Number of HSP's successfully gapped: 1018
Length of query: 623
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 507
Effective length of database: 40,180,143
Effective search space: 20371332501
Effective search space used: 20371332501
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)