Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR309C3.491ON36434816290.0
Ecym_12383.491ON3933738681e-114
KLTH0F14806g3.491ON3583517911e-103
Kwal_55.212273.491ON3763687801e-101
SAKL0F02794g3.491ON3973917363e-94
ZYRO0D10010g3.491ON3823806521e-81
KLLA0E04621g3.491ON3893816503e-81
Skud_16.4433.491ON4204186506e-81
TDEL0D055903.491ON3443516151e-76
Suva_16.4773.491ON4234236123e-75
CAGL0L08492g3.491ON3853605972e-73
TPHA0D032703.491ON3883955912e-72
Smik_16.4013.491ON4274265862e-71
Kpol_1017.73.491ON3783745581e-67
TBLA0D029803.491ON4434235594e-67
NCAS0F035403.491ON4442664541e-51
NDAI0B058503.491ON4732924385e-49
KAFR0G036803.491ON4152663664e-39
YPR148C3.491ON4351213579e-38
KNAG0A079303.491ON4521192428e-22
TDEL0H022407.221ON3383302274e-20
KLTH0A03894g7.221ON3233482141e-18
ZYRO0D16522g7.221ON3582912081e-17
Kwal_47.181487.221ON3233502062e-17
ADL115W7.221ON3333392026e-17
SAKL0F08162g7.221ON3303472001e-16
KNAG0D017607.221ON3422941992e-16
NCAS0A133807.221ON3293291885e-15
KLLA0E04511g7.221ON3022751867e-15
NDAI0A026607.221ON3643301861e-14
Ecym_43777.221ON3332911832e-14
Kpol_1070.197.221ON3113411724e-13
TPHA0B027507.221ON3633331673e-12
KAFR0I019507.221ON3302381637e-12
Suva_9.1597.221ON3252621602e-11
CAGL0L00891g7.221ON3413341566e-11
YIL041W (GVP36)7.221ON3262621522e-10
Smik_9.1507.221ON3262051503e-10
Skud_9.1287.221ON3292511461e-09
Kpol_478.227.221ON3503451451e-09
TPHA0C012307.221ON3053271414e-09
TBLA0D042007.221ON3312961398e-09
TBLA0B015807.221ON3862381311e-07
KLLA0E22089g2.389aON470105760.68
Kwal_23.46632.63ON54161722.1
ZYRO0C09944g2.63ON53761722.3
TDEL0A010402.63ON54261712.6
TPHA0C00220singletonON55287685.9
Suva_14.1522.63ON54261679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR309C
         (364 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   632   0.0  
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   338   e-114
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   309   e-103
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   305   e-101
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   288   3e-94
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   255   1e-81
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   254   3e-81
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   254   6e-81
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   241   1e-76
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   240   3e-75
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   234   2e-73
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   232   2e-72
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   230   2e-71
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   219   1e-67
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   219   4e-67
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   179   1e-51
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   173   5e-49
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   145   4e-39
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   142   9e-38
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...    98   8e-22
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    92   4e-20
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    87   1e-18
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    85   1e-17
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    84   2e-17
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    82   6e-17
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    82   1e-16
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    81   2e-16
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    77   5e-15
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    76   7e-15
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     76   1e-14
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    75   2e-14
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    71   4e-13
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    69   3e-12
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    67   7e-12
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    66   2e-11
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    65   6e-11
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    63   2e-10
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    62   3e-10
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    61   1e-09
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    60   1e-09
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    59   4e-09
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    58   8e-09
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    55   1e-07
KLLA0E22089g Chr5 complement(1970992..1972404) [1413 bp, 470 aa]...    34   0.68 
Kwal_23.4663 s23 (806647..808272) [1626 bp, 541 aa] {ON} YNL189W...    32   2.1  
ZYRO0C09944g Chr3 complement(755216..756829) [1614 bp, 537 aa] {...    32   2.3  
TDEL0A01040 Chr1 (175963..177591) [1629 bp, 542 aa] {ON} Anc_2.6...    32   2.6  
TPHA0C00220 Chr3 complement(34296..35954) [1659 bp, 552 aa] {ON}       31   5.9  
Suva_14.152 Chr14 (280191..281819) [1629 bp, 542 aa] {ON} YNL189...    30   9.3  

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/348 (89%), Positives = 310/348 (89%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXX 180
           NTSTKETRFLKF               AAGSSDPPSFAHALHRAAKGSQGI         
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQELKEQAE 180

Query: 181 XXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240
                         SLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG
Sbjct: 181 EEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240

Query: 241 HTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQ 300
           HTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQ
Sbjct: 241 HTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQ 300

Query: 301 LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
           LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ
Sbjct: 301 LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  338 bits (868), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/373 (49%), Positives = 235/373 (63%), Gaps = 25/373 (6%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS+YF   SLDK+A+T+N AA KTQQKL+ETQE LTHAI +I +DDP+T+LSL+TRK QL
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QETLG+ KDIS+LPP+Y FLERKCDA E+VC +ILVVSKTFEV+GYDYPPN  ESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 121 NTST-KETRFLKFXXXXXXXXXXXXXXXAAGSSD-----PPSFAHALHRAAKGSQGIXXX 174
            +S+ K+  F  F               +A         PPSFA A+ +AA  S  I   
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKE 180

Query: 175 XXXXXXXX-XXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLL 233
                                SL+ +   WA+AQ N+D AK++MDQFM+ EFN+KL  L+
Sbjct: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240

Query: 234 EVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQD-----EAKQA--------EG 280
             +F K   LR+KVEESRL FDTL+YE   R +  ++ ++     E++Q         + 
Sbjct: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN 300

Query: 281 ATPS----TGVTQSST-ADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLF 335
             P+    TG+  SS   D  F   LE AEDEFVSNT +AV +MT I D+  L +LVKLF
Sbjct: 301 LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLF 360

Query: 336 QNFQLVYHRKCVQ 348
            NFQL+YH+KCVQ
Sbjct: 361 HNFQLIYHKKCVQ 373

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  309 bits (791), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 168/351 (47%), Positives = 219/351 (62%), Gaps = 13/351 (3%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS YFG  SL+KL N++ N A KTQ  LS        AI NI++DDP+  LSLK RK  L
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLS-------TAIANIQLDDPQAKLSLKARKHYL 53

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QETLG+ +DIS+LPPQY FLE+KCD++E+VC+++LVV+KT+EVEGYDYPPN +ES+SDWW
Sbjct: 54  QETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWW 113

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXX 180
            +S KE  F  F               +  +  P SFA A+ +AAK S  +         
Sbjct: 114 -SSNKEGLF-GFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQ 171

Query: 181 XXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240
                         SLIKMF  W+  Q+NMD +K EMD  MVKEFN KL   +E +FK  
Sbjct: 172 KASAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNA 231

Query: 241 HTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSST-ADLAFYA 299
            TLR+KVE+SRL FDT++YE    +    K ++ A+Q E   P     ++S  +D +  A
Sbjct: 232 RTLRKKVEDSRLKFDTMRYELKMAEEQ-GKTEEAAQQTESQKPQEDEAEASKDSDSSDEA 290

Query: 300 Q--LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
           Q  LE  EDEFVSNT EAVE M  I D+ ++I+LVKLF NFQL+Y+++CVQ
Sbjct: 291 QKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQ 341

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  305 bits (780), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/368 (46%), Positives = 215/368 (58%), Gaps = 29/368 (7%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS+YFG  S +KL +TL NAA KTQ  LS        AI NI++DDP+ ILSLK RK  L
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLS-------TAIANIQLDDPQAILSLKARKHYL 53

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QETLG+ +DIS+LPPQY  LE+KCD++E+ C+++LVV+KTFEVEGYDYPPN +ES+SDWW
Sbjct: 54  QETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWW 113

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXX 180
            +S KE  F                  A  +  P SFA A+ +AAK S  +         
Sbjct: 114 -SSNKEGLF-GLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQ 171

Query: 181 XXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240
                          LIKMF  W++ QY +D  K EMD  M KEFN+KL  L+E +FK  
Sbjct: 172 QASADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNA 231

Query: 241 HTLRRKVEESRLTFDTLKYE----------QHERDAALAKKQDEAKQAEGATPS------ 284
             LRRKVE+SRL FDT++YE            E + A  K+ D + + EGA  +      
Sbjct: 232 SVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEV 291

Query: 285 ----TGVTQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQL 340
               T   +    + A    LE  EDEFVSNT EAVE M  I D+ +L++LVKLF NFQL
Sbjct: 292 GKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQL 351

Query: 341 VYHRKCVQ 348
           VYHR+CVQ
Sbjct: 352 VYHRQCVQ 359

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  288 bits (736), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 168/391 (42%), Positives = 217/391 (55%), Gaps = 52/391 (13%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS YF + SLDKL N++++AA KTQ KLS        AI NI++DDP+  LSLK RK  L
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLS-------TAIANIQLDDPQAKLSLKVRKHYL 53

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QETLG+  DIS+LPPQY FLE+KCD++E++C+++LVV+KTFEVEGYDYPPN +ESISDWW
Sbjct: 54  QETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWW 113

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSD--PPSFAHALHRAAKGSQGIXXXXXXX 178
             +   +  L F                  +    P SFA AL +AAK S  +       
Sbjct: 114 GANR--SGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDE 171

Query: 179 XXX-XXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEF 237
                            SLI MF  W+  +  +D  K EMD  M KEFN+KL  L+  +F
Sbjct: 172 QKEPPQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDF 231

Query: 238 KKGHTLRRKVEESRLTFDTLKYE----QHERDAALAKKQDEAK-------------QAEG 280
           KK H+LR+KVEESRL FDTL+YE    + E+  A AK+++  K             + EG
Sbjct: 232 KKVHSLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEEKAKTEG 291

Query: 281 ATPSTGVTQSSTADLAF-----------------------YAQLEDAEDEFVSNTAEAVE 317
              S G      AD                          +  LE  EDEFVS+T EAVE
Sbjct: 292 QETSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVE 351

Query: 318 FMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
            M  I D+++++SLVKLF  FQL+YHR+CVQ
Sbjct: 352 IMGEITDSSEILSLVKLFHKFQLIYHRQCVQ 382

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  255 bits (652), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 152/380 (40%), Positives = 210/380 (55%), Gaps = 44/380 (11%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS YF + S   L +++ NAA +TQ KLS       +A+ N+ ++DP+T LS+KTR R L
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLS-------NAVANVNLNDPQTRLSIKTRTRYL 53

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           +ETLG+  +IS+LPPQY  LERK DA+E+ CK++L+V++TFEVEGYDYPPN  ES SDWW
Sbjct: 54  KETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWW 113

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXX 180
            + +KE  F                  +     P SFA A+ +A+               
Sbjct: 114 -SGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHEC----GEAYQNSQ 168

Query: 181 XXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240
                         +L++MF T +    N+D  K EMD+ + +EFN+KL+ LL  +FKK 
Sbjct: 169 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228

Query: 241 HTLRRKVEESRLTFDTLKYEQ---------------HERDAALAKKQDE-----AKQAEG 280
           H LR KVE SRL FDT++YE                +  +    K Q E     AK+ E 
Sbjct: 229 HVLRNKVENSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQEPTNEPAKEEEK 288

Query: 281 ATPS-------TGVTQSSTADLAFYAQ-----LEDAEDEFVSNTAEAVEFMTSIADATKL 328
            TP+       T  T++S  +           LE  EDEFVSNT+EAVE MTSI + +++
Sbjct: 289 PTPAEPAEAQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEI 348

Query: 329 ISLVKLFQNFQLVYHRKCVQ 348
           + L+KLFQN QLVY+R+CVQ
Sbjct: 349 LRLMKLFQNLQLVYYRQCVQ 368

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  254 bits (650), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 149/381 (39%), Positives = 212/381 (55%), Gaps = 47/381 (12%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           F  +SL+ + ++++NAAQ+TQ       E  + AI+ I +DDP+T LS+  R+ QLQETL
Sbjct: 2   FSKLSLNNITDSISNAAQRTQ-------EQFSSAIEKIHLDDPETRLSILKRRHQLQETL 54

Query: 65  GSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTST 124
           G+  DISQLP QY FLE+K DA+E++CK++L+V+KTFEVEGYDYPPN TES +DWW +  
Sbjct: 55  GTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWW-SGN 113

Query: 125 KETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXX 184
           K++ F  F                 G   P SFA AL +AA  S  I             
Sbjct: 114 KDSIF-SFSKKKAEVSPEVKETAENGLL-PRSFAQALSKAATDSALILKQLKAEETRTNQ 171

Query: 185 XXXXX--------------------------XXXXXSLIKMFGTWADAQYNMDIAKREMD 218
                                               +LIK F +W   Q ++D +K EMD
Sbjct: 172 EESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMD 231

Query: 219 QFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYE---QHERDAALAKKQDEA 275
             MVKEFN KL  L+E +FKKGH LR KV+++RL FDTL++E   + +    +A  ++  
Sbjct: 232 SLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAE 291

Query: 276 KQAEGATPST--GVTQSSTADLAFYAQLEDA------EDEFVSNTAEAVEFMTSIADATK 327
           K+    TP T    T     D+A   +  D+      ED+FVS T+E VEF+  + D+++
Sbjct: 292 KKVATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSE 351

Query: 328 LISLVKLFQNFQLVYHRKCVQ 348
           +ISLVKLF NFQL+++++CV+
Sbjct: 352 IISLVKLFHNFQLIHYKQCVK 372

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  254 bits (650), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 215/418 (51%), Gaps = 82/418 (19%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS YF   SL+K+ +++  AA KTQ  L+        A  N+ ++DP+T LS+K+R R +
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNA-----LASANVNLNDPETRLSIKSRTRFV 55

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QE+LG+  DIS+LPPQY FLE+K D++E+VC++IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWW 115

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSD---PPSFAHALHRAAKGSQ-------- 169
           + + K+  F                   +   D   P SFA A+ +AA   +        
Sbjct: 116 SVN-KDGWF------GSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQ 168

Query: 170 ----GIXXXXXXXXXXXXXXXXXXXXXX------XSLIKMFGTWADAQYNMDIAKREMDQ 219
               G+                             +LIK+F +W+    N+D  K EMD 
Sbjct: 169 DEKAGLKKKSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDS 228

Query: 220 FMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQ------- 272
            M+KEFN+KL+ L+  +FKK H LR+KVE+SRL FDT++YE   ++A L  ++       
Sbjct: 229 TMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEV 288

Query: 273 -------------DEAKQAEGATP--------STGVTQSSTADLAFYAQ----------- 300
                        DE    E  +P        S   T  S AD A   +           
Sbjct: 289 DDKAVSANAPISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEP 348

Query: 301 ----------LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
                     LE  EDEFVSNT  AVE M  I D++ ++ LVKLFQNFQLVY R+CVQ
Sbjct: 349 TIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQ 406

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  241 bits (615), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 199/351 (56%), Gaps = 27/351 (7%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS Y    SL+K+ +TL NAA KTQ       + L  AI N+   DP+  LSLK R R L
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQ-------DTLNSAIANVS--DPQAKLSLKARTRYL 51

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QETLG+  D S+LPPQY  LE+K DA+E+ CK+IL+V++TFEVEGYDYPPN TESISDWW
Sbjct: 52  QETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWW 111

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSD---PPSFAHALHRAAKGSQGIXXXXXX 177
           + + K+  F                  ++  SD   P SF+ A+ +AA     +      
Sbjct: 112 SLN-KDGWF-------GTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSV-----F 158

Query: 178 XXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEF 237
                            ++ KMF +W+    N+D  K EMD  + KEFN KL+ ++  +F
Sbjct: 159 TNLQEHGDEDEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDF 218

Query: 238 KKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAF 297
           KK H  R+KVEESRL FDT++YE   ++   AKK  E  +A      T      T++   
Sbjct: 219 KKVHASRKKVEESRLKFDTVRYEIKLKETENAKKSTETDEASKDETKTEEEPPKTSEED- 277

Query: 298 YAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
              LE+ EDEFVSNT  AVE M  + ++ +++ L KLFQNFQLVY R+CVQ
Sbjct: 278 -KLLEELEDEFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQ 327

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  240 bits (612), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 154/423 (36%), Positives = 215/423 (50%), Gaps = 89/423 (21%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS Y+      K+ +++  AA KTQ  L+     L +A  N+ ++DP+T LS+K+R R +
Sbjct: 1   MSGYWN-----KITDSIATAAHKTQDTLNSA---LANA--NVNLNDPQTRLSIKSRTRFV 50

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QE+LG+  DIS+LPPQY FLE+K D++E+VCK+IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 51  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 110

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAA--------------- 165
           + +    +   F                  +  P SFA A+ +AA               
Sbjct: 111 SLN----KDGWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEK 166

Query: 166 -------KGSQGIXXXXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMD 218
                  +  +                         +LIK+F +W+    N+D  K EMD
Sbjct: 167 EDLKQKKEAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMD 226

Query: 219 QFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQD----E 274
             MVKEFN+KL+ L+  +FKK H LRRKVEESRL FDT++YE   ++  L  ++D    E
Sbjct: 227 SMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKE 286

Query: 275 AKQAEGATPSTGVTQSSTADLAFYAQ---------------------------------- 300
           A   + +  ST + ++ TA+     +                                  
Sbjct: 287 ADNNDNSANSTSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQP 346

Query: 301 ------LEDA---------EDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRK 345
                 +ED+         EDEFVSNT  AVE M  I D+++++SLVKLFQNFQLVY R+
Sbjct: 347 TNNQPPVEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQ 406

Query: 346 CVQ 348
           C Q
Sbjct: 407 CAQ 409

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  234 bits (597), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/360 (38%), Positives = 190/360 (52%), Gaps = 65/360 (18%)

Query: 43  KIDDPKTILSLKTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFE 102
           + +DPKT LS+K + R LQE +G+ +DIS+LPPQY  LE+KCD+IE+V K+IL+V+KT+E
Sbjct: 23  QFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYE 82

Query: 103 VEGYDYPPNPTESISDWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGS----------- 151
           +EGYDYPPN +ES+S WW T      +                   AG+           
Sbjct: 83  IEGYDYPPNISESLSSWWQTK----EWFNISELTKNVIPKHGNVEKAGTEASKTLTDKEV 138

Query: 152 --SDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYN 209
               PPSFA A+ RA K SQ I                        L+K+F  W+D  Y 
Sbjct: 139 SHEGPPSFASAIARAGKDSQLI-------FESIETKDEDEKEDIDELVKIFKIWSDCFYE 191

Query: 210 MDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYE--------- 260
           +  +K EMDQ M+KEFN KL+  L+  F+K HTLR KVEESRL FDT++YE         
Sbjct: 192 ISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTD 251

Query: 261 ---------------------QHERDAALAKKQDEAKQAEGATPSTGVTQS----STADL 295
                                  E++AA  K + + K    AT +    ++     + DL
Sbjct: 252 SKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDL 311

Query: 296 AFYAQ-------LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
              ++       LE  EDEFVSNT EAVE MT +++ ++L+SL+KLFQ FQL YH+ CV+
Sbjct: 312 KEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVK 371

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  232 bits (591), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 150/395 (37%), Positives = 200/395 (50%), Gaps = 75/395 (18%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           F   SLDKL ++++N A KTQ+  +     L + I+ I ++DP T LS++ R R +QE L
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETI-LNDPNTKLSIRARSRYIQEQL 60

Query: 65  GSAKD-ISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW--N 121
           G+  D IS+LP QY  LE K D++E++ K++L+V+ TF  EGYDYPPN TESISDWW  +
Sbjct: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120

Query: 122 TSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXX 181
            +T+   FL                       P SFA AL +A   S+ I          
Sbjct: 121 ETTENKNFL-----------------------PRSFAQALAKAYSDSKLITDKAERNIKL 157

Query: 182 XXXXXXXXXXXXX---------------------SLIKMFGTWADAQYNMDIAKREMDQF 220
                                             +L K F   +++  N+D  K EMD  
Sbjct: 158 QTSPKNTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTM 217

Query: 221 MVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKY---------EQHERDAALAKK 271
           +V EFN+KL+HLLEVEFK+   LRR VE SRL FDT++Y         EQ E       K
Sbjct: 218 IVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDK 277

Query: 272 QDEAKQAEGATPSTGVTQS---STAD---------------LAFYAQLEDAEDEFVSNTA 313
           + E K++E   P T  T+     T D                  Y  LE  EDEFVSNT+
Sbjct: 278 EIEKKESETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNTS 337

Query: 314 EAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
            AVE M  + D+ K++ LVKLFQNFQLVY+R+CVQ
Sbjct: 338 SAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQ 372

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  230 bits (586), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 156/426 (36%), Positives = 212/426 (49%), Gaps = 91/426 (21%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS YF + SL+K+ +++  AA KT   L+    +    +      DP+T LS+K+R R +
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLN-----DPQTRLSIKSRTRFV 55

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QE+LG+  DIS+LPPQY FLE+K D++E+VCK+IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 56  QESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115

Query: 121 NTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSD---PPSFAHALHRAA------------ 165
           + + K+  F                   +   D   P SFA A+ +AA            
Sbjct: 116 SLN-KDGWF------GSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLEN 168

Query: 166 -------------KGSQGIXXXXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDI 212
                        K +Q                         +LIK+F +W+    N+D 
Sbjct: 169 DEKAELKKKRESTKNAQ-TTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDE 227

Query: 213 AKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAAL-AKK 271
            K EMD  MVKEFN+KL+ L+  +FK+ H LR+KVE SRL FDT++YE   ++A L A+K
Sbjct: 228 GKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQK 287

Query: 272 QDEAKQAEGATPSTGVTQS-----STAD-------------------------------- 294
               ++A     S     S     ST D                                
Sbjct: 288 PGVTEEAHTKDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKEDP 347

Query: 295 ---LAFYAQLEDAE---------DEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVY 342
                    LE++E         DEFVSNT  AVE M  IAD+++++ L+KLFQNFQLVY
Sbjct: 348 KDDKKDDTPLEESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVY 407

Query: 343 HRKCVQ 348
            R+CVQ
Sbjct: 408 FRQCVQ 413

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  219 bits (558), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/374 (36%), Positives = 194/374 (51%), Gaps = 41/374 (10%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           F   S+DKL ++++N A KTQ+ L+    ++   ++N  ++DP T LS+K++ R +QE L
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENY-LNDPNTKLSIKSKARFIQEKL 60

Query: 65  GSAKD-ISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTS 123
           G+  D  S+LPP Y  LE K DAIE+  K++L V+KT+E EGYDYPPN TES+SDWW   
Sbjct: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTND 120

Query: 124 TKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRA---AKGSQGIXXXXXXXXX 180
              T                    +  S  P SFA A+  A   A  +            
Sbjct: 121 DNVTN----------TDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNH 170

Query: 181 XXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240
                          L K+F +  +   N+D  K EMD+ +V EFN KLK L+  EFK  
Sbjct: 171 KDDEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNV 230

Query: 241 HTLRRKVEESRLTFDTLKYE-------------QHERDAALAKKQDEAKQ------AEGA 281
           H LR+ VE SRL FDT++YE             + E  + ++KK    K+      ++  
Sbjct: 231 HQLRKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEASKKE 290

Query: 282 TPSTGV-------TQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKL 334
           TP   +        + +T +      LE  EDEFVSNT  AVE M  + D +K+I+LVKL
Sbjct: 291 TPKKEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKL 350

Query: 335 FQNFQLVYHRKCVQ 348
           +QNFQLVY+++C+Q
Sbjct: 351 YQNFQLVYYKQCIQ 364

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  219 bits (559), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 142/423 (33%), Positives = 206/423 (48%), Gaps = 95/423 (22%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKID--DPKTILSLKTRKR 58
           MS YF   SLDKLA++L +AAQKTQ  LS       +AIQN+ ID  DP+T L+L +++ 
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLS-------NAIQNVNIDWNDPQTRLTLLSKQH 78

Query: 59  QLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISD 118
            LQE++G   +IS+LP QY  LERK DA+E++ K+IL+V+ TFE+EGYDYPPN +ESIS+
Sbjct: 79  YLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISE 138

Query: 119 WWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPP-----------------SFAHAL 161
           WW        FL+                   +S+PP                 SF HA+
Sbjct: 139 WW--LNDPLAFLR--------DNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAI 188

Query: 162 HRAAKGSQGIXXXXXXXXXXXXXXXXXXXXXXXS------LIKMFGTWADAQYNMDIAKR 215
            +A+  S  I                              LIK+F +W+    N+D +K 
Sbjct: 189 SKASSDSSAILTNLNNNEKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKF 248

Query: 216 EMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEA 275
           + DQ ++K+FN+KL  LL+VEFK    LR KV+++RL FDT++YE  +   A  + ++  
Sbjct: 249 QRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAEEND 308

Query: 276 KQAE--------------------------------------------------GATPST 285
           K  E                                                     P  
Sbjct: 309 KPVEMEKGEGEDEGEGEGKGKGKGKGETASTSTETASTSTTKDAAATIESQKKDSPNPEF 368

Query: 286 GVTQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRK 345
               S   D      LE   DEFVS+T+ AVE M  I +++K++ L+KLFQNFQL+++++
Sbjct: 369 EKNDSQNEDEKLLEHLE---DEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQ 425

Query: 346 CVQ 348
           C++
Sbjct: 426 CIK 428

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  179 bits (454), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 144/266 (54%), Gaps = 33/266 (12%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           F   SLDK+ N+L  AAQKT   LS     +T A       DP T LSL+++KR  QE++
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNA---ITTAT------DPATKLSLRSQKRLFQESI 52

Query: 65  GSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTST 124
           G+  DIS LP QY  LE + DA+E+  ++IL+VSKTFE+EGYDYPPN +ES SDWW+ S+
Sbjct: 53  GTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSS 112

Query: 125 KETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGI----------XXX 174
           K+ +  +                      P SFA A+  +A+    I             
Sbjct: 113 KKKKEQEKEDKKGFL--------------PRSFAQAISNSAEDCVEIYQHVNDGDDEDKE 158

Query: 175 XXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLE 234
                               +LIK F +WA    N+D  K EMD  M+KEFN KL+ LL 
Sbjct: 159 ENANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLN 218

Query: 235 VEFKKGHTLRRKVEESRLTFDTLKYE 260
            EFKK HTLR++V++SRL FDT++YE
Sbjct: 219 EEFKKVHTLRKRVKDSRLKFDTVRYE 244

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 4/83 (4%)

Query: 266 AALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADA 325
           A  A K DE K +E       +   S      +  LE  ED FVS+TA AVE M  I D+
Sbjct: 352 AESATKVDEEKASEDKKTDKAIEDDSEE----HKLLEQLEDTFVSSTASAVEMMEEITDS 407

Query: 326 TKLISLVKLFQNFQLVYHRKCVQ 348
           +++I LVKLFQNFQLVY+R+CVQ
Sbjct: 408 SEIIGLVKLFQNFQLVYYRQCVQ 430

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  173 bits (438), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 145/292 (49%), Gaps = 45/292 (15%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           F + SLDK+ N++ NAAQK    L+       +AI      DP+T LS+K++ R  QE L
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLN-------NAINTAT--DPQTKLSIKSQTRLFQEQL 52

Query: 65  GSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTST 124
           G+  DIS+LP QY  LE K D++E+  K+IL+VSKTFE+EGYDYPPN TES SDWWN + 
Sbjct: 53  GTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITK 112

Query: 125 KETRFLKFXXXXXXXXXXXXXXXAAGSSD--------------PPSFAHALHRAAKGSQG 170
           K +   K                   +++              P SFA A+ ++A     
Sbjct: 113 KSSSHRKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTD 172

Query: 171 IXXXXXXXXXXXXXXXXXXXXXX----------------------XSLIKMFGTWADAQY 208
           I                                             +LIK F +W++   
Sbjct: 173 IYQQLSIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYK 232

Query: 209 NMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYE 260
           N+D  K EMD  M KEFN KL+ L+  EFKK +TLR+KV +SRL FDT+++E
Sbjct: 233 NIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHE 284

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/48 (66%), Positives = 40/48 (83%)

Query: 301 LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
           LE  EDEFVS+TA AVE MT I +++ +I L+KLFQNFQLVY+R+CVQ
Sbjct: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQ 458

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  145 bits (366), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/266 (34%), Positives = 140/266 (52%), Gaps = 36/266 (13%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           F   + DK+ N+++ AAQ  QQK+++T          I   D +T L  K   R  QE +
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDT----------ILTPDVQTKLHFKKTARFWQEKV 51

Query: 65  GSA--KDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNT 122
           G    K+IS+LP  Y  LE K DA+E++ K++L+V+KT+E+EGYDYPPN +ES++DWW +
Sbjct: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWS 111

Query: 123 STKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXX 182
             K+++                      S    SF  A+ +AA  S+ I           
Sbjct: 112 DLKKSK----------------KHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDL 155

Query: 183 XXXXXXXXXXXX--------SLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLE 234
                               +L+++F + ++   N+D +K EMD  +VKEFN KL+HL+ 
Sbjct: 156 PKEGEEPEEEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLIN 215

Query: 235 VEFKKGHTLRRKVEESRLTFDTLKYE 260
            +FKK   LR KV++SRL FDTL++E
Sbjct: 216 NDFKKVSKLRTKVQDSRLEFDTLRHE 241

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 66/117 (56%), Gaps = 4/117 (3%)

Query: 236 EFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGA--TPSTGVTQ--SS 291
           E  K  T ++K+ E +   D ++ +  E  A   + +  AK+       P   V    SS
Sbjct: 286 ESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEAPKEDVKHNGSS 345

Query: 292 TADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
             +   Y  LE  EDEFVSNT  AVE MT + + +++I+LVKLFQNFQL+++++CVQ
Sbjct: 346 EEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQ 402

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  142 bits (357), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (73%), Gaps = 5/121 (4%)

Query: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60
           MS YF   SL+K+ +++  AA KTQ  L+    +    +      DP+T LS+K+R R +
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLN-----DPQTRLSIKSRTRFV 55

Query: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120
           QE+LG+  DIS+LPPQY FLE+K D++E+VCK+IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115

Query: 121 N 121
           +
Sbjct: 116 S 116

 Score =  127 bits (320), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 110/209 (52%), Gaps = 55/209 (26%)

Query: 195 SLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTF 254
           +LIK+F +W+    N+D  K EMD  MVKEFN+KL+ L+  +FKK H LR+KVEESRL F
Sbjct: 213 NLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKF 272

Query: 255 DTLKYEQHERDAAL-AKK-------------------------------QDEAKQAEGAT 282
           DT++YE   ++A L AKK                               +DE  ++EGA 
Sbjct: 273 DTMRYEVKAKEAELEAKKAEATGEAHSKDVSAKDISANTTTSFDETPSTEDEKPKSEGAE 332

Query: 283 PSTG--VTQSSTADLAFYAQ---------------------LEDAEDEFVSNTAEAVEFM 319
             +     + +  D+A   +                     LE  EDEFVSNT  AVE M
Sbjct: 333 EESKKEANEPTVDDVADRKEDLKSNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETM 392

Query: 320 TSIADATKLISLVKLFQNFQLVYHRKCVQ 348
             I D+++++ L+KLFQNFQLVY R+CVQ
Sbjct: 393 EEITDSSEILGLIKLFQNFQLVYFRQCVQ 421

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score = 97.8 bits (242), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 71/119 (59%), Gaps = 12/119 (10%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           F   SLDKL +T+ NAAQ  Q  +  T          I   D +T L      R  QE +
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNT----------ILSPDAQTKLQFLKTTRYFQEKV 51

Query: 65  G--SAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWN 121
           G  S  +I++LP  Y  L+ K +A+E+V K++LVV+KTFE+EGYDYPPN TES++ WWN
Sbjct: 52  GTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN 110

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 47/65 (72%)

Query: 195 SLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTF 254
           ++I  FG W++   N+D +K EMD  +VKEFN+KL  +LE++FK  H L  +V++SRL F
Sbjct: 200 NMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEF 259

Query: 255 DTLKY 259
           DTL++
Sbjct: 260 DTLRH 264

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (83%)

Query: 306 DEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
           DEFVSN   AVE MT + D+++LISLVKLFQN QLV++R+CVQ
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQ 433

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 130/330 (39%), Gaps = 43/330 (13%)

Query: 15  NTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKDISQLP 74
           +T NN      QK  E    ++   Q I  + P      ++ +R +QE LG   DISQLP
Sbjct: 2   STFNNFTNSLNQKFQELSTAVSQRTQEISTNLPSLT---QSTQRLVQERLGQVTDISQLP 58

Query: 75  PQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFXX 134
            +Y  LERK D I+ + +  L V+  +E E YDYP   TES++D+      + + L    
Sbjct: 59  REYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQELSHAS 118

Query: 135 XXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXXXXXXXXX 194
                         A   +P +  +AL + +  S                          
Sbjct: 119 SASEAQNILITPTPAK--EPRTLNYALSKVSLIS-------------SEYLNHIGDHDEA 163

Query: 195 SLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTF 254
            +  +   ++D Q  +  A+ + D  +   FN++LK  LE  FKK    R+ VE  RL +
Sbjct: 164 QVASVLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQY 223

Query: 255 DTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTAE 314
           D  +      + A AK + EA                    +   Q+E  ED+F   T +
Sbjct: 224 DVAR-----SNLAQAKPEKEA--------------------SLRVQMETLEDQFAQATED 258

Query: 315 AVEFMTSIADATKLISLVKLFQNFQLVYHR 344
           A   M  +    K    +K   N QL YH+
Sbjct: 259 ATIIMQEVLSNAKFTEEIKEMANAQLTYHQ 288

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 87.0 bits (214), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/348 (23%), Positives = 141/348 (40%), Gaps = 57/348 (16%)

Query: 16  TLNNAAQKTQQKLSETQEHLTHAIQNIKID----DPKTILSLKTR-------------KR 58
           + NN A    +KL E    ++   Q+ ++D    D  + +S +T+             +R
Sbjct: 2   SFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQR 61

Query: 59  QLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISD 118
            +QE LG   DISQLP +Y  LE K D +  V +  L V++ +E E YDYP N  +S+++
Sbjct: 62  LVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVNE 121

Query: 119 WWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXX 178
           +  +S    +                        DP +  +AL + A  S          
Sbjct: 122 F--SSVVAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNYALSKVALTS---------S 170

Query: 179 XXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFK 238
                           +L+K    ++D Q  +  A+ + D  +   FN+KL+ +L  +  
Sbjct: 171 EYLNKSVGGDDSEVSNALLK----YSDVQAKVAQARLQQDTLIQTRFNKKLRDILANDLN 226

Query: 239 KGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFY 298
           +    R+ VE  RL +D  +      + A AK + EA                    +  
Sbjct: 227 EAQKARKNVEHKRLQYDIAR-----SNLANAKPEKEA--------------------SLR 261

Query: 299 AQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKC 346
            Q+E  EDEF   T +AV  M  +A +++L+  ++     Q  YH++ 
Sbjct: 262 VQMESLEDEFAQATDDAVVVMQKVAGSSELLKELRELVAAQADYHKQS 309

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 113/291 (38%), Gaps = 40/291 (13%)

Query: 58  RQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESIS 117
           R +QE LG A DIS++P +Y  L  K DAI+ +    L V++ ++ E YDYP    ESI+
Sbjct: 37  RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESIN 96

Query: 118 DWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXX 177
           ++  + T  ++  +                   S DP +  +AL R +  S         
Sbjct: 97  EF--SRTVGSKIQELSHASSAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSECMEHLST 154

Query: 178 XXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEF 237
                             L      ++D Q  +  A+   D  +   FN KL+  ++   
Sbjct: 155 HDDAL-------------LASYLMKYSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNL 201

Query: 238 KKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAF 297
           K+ H +RR VE  RLT+D  +    +     AK + EA+                     
Sbjct: 202 KRAHRVRRDVENKRLTYDASRTHLEK-----AKPEKEAQ--------------------L 236

Query: 298 YAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
             Q+E AE+EF   T  A+  M  +      + L++     Q  YH    Q
Sbjct: 237 RVQMETAEEEFAQATENAIVVMQEVIAGANFMPLLRELAAAQWSYHETAAQ 287

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 143/350 (40%), Gaps = 57/350 (16%)

Query: 16  TLNNAAQKTQQKLSETQEHLTHAIQNIKID----DPKTILSLKTR-------------KR 58
           + N+ A    +K  E    ++   Q  ++D    D  T +S KT+             +R
Sbjct: 2   SFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQR 61

Query: 59  QLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISD 118
            +QE LG   DISQLP  Y  LE K D ++ V +  L V++ +E E YDYP N  +S+++
Sbjct: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121

Query: 119 WWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXX 178
           +  +S   T+  +                     DP +  +AL + A  S          
Sbjct: 122 F--SSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTS---------S 170

Query: 179 XXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFK 238
                           SL+K    ++D Q  +  A+   D  +  +FN+KL+  L  +  
Sbjct: 171 EYLNKSPGAEDSEVSSSLLK----YSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLN 226

Query: 239 KGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFY 298
           +    R+ VE  RL +D  +       A LA  + E K+A                 +  
Sbjct: 227 RAQKARKNVENKRLQYDIAR-------ANLANARPE-KEA-----------------SLR 261

Query: 299 AQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
            Q+E  EDEF   T +AV  M  +A++++L+  ++     Q  Y+++  +
Sbjct: 262 VQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 82.4 bits (202), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 76/339 (22%), Positives = 146/339 (43%), Gaps = 46/339 (13%)

Query: 12  KLANTLNNAAQKTQ--QKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKD 69
           ++++T+   AQ+ Q  +KL +    ++   Q++  + P      +T +R++QE LG   D
Sbjct: 16  EISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLA---QTTQRRVQERLGQVTD 72

Query: 70  ISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRF 129
           ISQ+P +Y  LE++ D  + +    L VS+ +E E YDYP + ++S++D+  T T + + 
Sbjct: 73  ISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVTGKVQ- 131

Query: 130 LKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXXXX 189
            +                   + +P +  +AL + A  S                     
Sbjct: 132 -ELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDDVVTADI---- 186

Query: 190 XXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEE 249
                 L+K    ++D Q  +  A+ + D  +   FN +L+  L  +F +    R++V++
Sbjct: 187 ------LLK----YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQ 236

Query: 250 SRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFV 309
            RL +D  +       A     + E KQA                 +   Q+E  ED+F 
Sbjct: 237 KRLQYDIAR-------ANFTAARPE-KQA-----------------SLRVQMETLEDQFA 271

Query: 310 SNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
            +T +AV  M ++ D T+ +   +     QL +H+   +
Sbjct: 272 QSTEDAVALMQAVIDDTEFLKEFQELVTAQLGFHKAAAE 310

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 146/347 (42%), Gaps = 51/347 (14%)

Query: 8   ISLDKLANTLNNAAQK----TQQKLSETQ-----EHLTHAIQNIKIDDPKTILSL-KTRK 57
           +S +  A++LN   Q+      QK  E Q     + L+ A+     D   ++ SL ++ +
Sbjct: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60

Query: 58  RQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESIS 117
           R +QE LG   DISQLP +Y  LE + D I  V +  L V++ +E E YDYP N  +S++
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 118 DWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXX 177
           ++  T +  ++  +                   + DP +  +AL + A  S         
Sbjct: 121 EFSKTVS--SKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTS--------- 169

Query: 178 XXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEF 237
                            +L+K    ++D Q  +  A+ + D  +  +FN+KL+  L  + 
Sbjct: 170 -SEYLSKSGHEDETIATALLK----YSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDL 224

Query: 238 KKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAF 297
            K    R++VE  RL +D  +      + A AK + EA                    + 
Sbjct: 225 NKAVKARKEVENKRLQYDIAR-----ANLANAKPEKEA--------------------SL 259

Query: 298 YAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHR 344
             Q+E  EDEF   T +A   M  +  +++ +  +    + QL Y++
Sbjct: 260 RVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 119/294 (40%), Gaps = 39/294 (13%)

Query: 54  KTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPT 113
           +T +R +QE LG   DISQLP +Y  LE++ DA++ V +  L V+  +E E YDYP    
Sbjct: 38  QTTQRLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVR 97

Query: 114 ESISDWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAA-KGSQGIX 172
           +S+++W  + T  TR  +                    ++P +  +AL + A  GSQ + 
Sbjct: 98  DSVNEW--SRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLV- 154

Query: 173 XXXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHL 232
                                  L++  G  A+    +  A+ E D  +  +FNEKL+  
Sbjct: 155 ------DNLDAPRTPRETQLSSGLLEFSGVEAE----LAQARLEQDAAVKAQFNEKLRGQ 204

Query: 233 LEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSST 292
           L  E  +    R++V + RL +D  +      +   AK + EA                 
Sbjct: 205 LSGEIARAAAARKEVFQKRLQYDVAR-----TNLLNAKPEKEA----------------- 242

Query: 293 ADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKC 346
              +   Q+E  EDEF   T  A   M  +     L+  V+     Q  YH + 
Sbjct: 243 ---SLRVQMETLEDEFAQCTEHATIVMQEVLSQADLLGAVRRLAAAQHAYHERS 293

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 132/329 (40%), Gaps = 46/329 (13%)

Query: 15  NTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKDISQLP 74
           N+  N+  KT  +LS T   ++   Q +  + P      ++ +R +QE LG   DISQLP
Sbjct: 5   NSFTNSFSKTLSELSST---VSQKTQELSTNLPNLA---QSTQRMVQERLGQVTDISQLP 58

Query: 75  PQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFXX 134
            +Y  LE K D+I+Q+    L VS  +E + YDYP    ES+ ++  T+  +   L    
Sbjct: 59  EEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSH-A 117

Query: 135 XXXXXXXXXXXXXAAGSSDPPSFAHALHRAA-KGSQGIXXXXXXXXXXXXXXXXXXXXXX 193
                        +    +P +   AL + A K S+ +                      
Sbjct: 118 SSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHL-------------NQFNDNEAF 164

Query: 194 XSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLT 253
            S       +++ Q  +  A+ + D  + ++FN+ L+H L     K   +R++V+  RL 
Sbjct: 165 KSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQ 224

Query: 254 FDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTA 313
           +D  +      +   AK + EA                    +   Q+E  ED+F   T 
Sbjct: 225 YDIAR-----TNLMNAKPEKEA--------------------SLRVQMETLEDDFAQATE 259

Query: 314 EAVEFMTSIADATKLISLVKLFQNFQLVY 342
            A   M  + D + ++S V      QL Y
Sbjct: 260 HATIVMQDVIDNSDIVSRVNELARAQLAY 288

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 76.3 bits (186), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 116/275 (42%), Gaps = 40/275 (14%)

Query: 1   MSAYFGAIS--LDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKR 58
           MS YF + S  + +L+ +++  AQ+ Q         L    +++K + P   L   + +R
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ---------LDQKFKDLKTNLP---LLANSTQR 48

Query: 59  QLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISD 118
            LQE LG   DISQLP +Y  LE + + I+ + +  L V+K +E E YDYP N  ES+ +
Sbjct: 49  MLQEKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDE 108

Query: 119 WWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXX 178
           +        +                   +    +P +  +AL + A  S          
Sbjct: 109 FSKLVG--GKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTS---------- 156

Query: 179 XXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFK 238
                           SL      ++D+Q  +   + + D  +  +FN+ +K  LE + +
Sbjct: 157 ---------SEHVEDESLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIE 207

Query: 239 KGHTLRRKVEESRLTFDT-----LKYEQHERDAAL 268
                R+ VE+ RL +D      LK  + E+ AAL
Sbjct: 208 TSTKARKLVEQKRLQYDVVRSNRLKNTKPEKQAAL 242

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 131/330 (39%), Gaps = 34/330 (10%)

Query: 15  NTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKDISQLP 74
           N+  N+  K  Q+LS T   ++   Q    + P      ++ +R +QE LG   DISQLP
Sbjct: 5   NSFTNSFNKRLQELSTT---VSQKTQEFSTNMPDINSLAQSTQRMVQERLGQVTDISQLP 61

Query: 75  PQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFXX 134
            +Y  LERK D I+ V    L V+ TFE + YDYP    ES+ ++  ++  +   L    
Sbjct: 62  EEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVIEFSKSAVSKVEELSH-A 120

Query: 135 XXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXXXXXXXXX 194
                        +    +P +  +AL +A+     +                       
Sbjct: 121 TSASEAQQILTNNSNQIKEPKTLNYALSKAS-----LISSEQLNKQFSTDDDNNSNSDFK 175

Query: 195 SLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTF 254
            +  +   ++D Q  +  A+ + D  + ++FN  L++ L   F++   +R+ V+  RL +
Sbjct: 176 LVSSILLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQY 235

Query: 255 DTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTAE 314
           D  +      +   AK + EA                    +   Q+E  ED+F   T  
Sbjct: 236 DVAR-----TNLLNAKPEKEA--------------------SLRVQMELLEDQFAQATEH 270

Query: 315 AVEFMTSIADATKLISLVKLFQNFQLVYHR 344
           A   M  I + +  +  +      QL Y++
Sbjct: 271 ATLVMNEIIENSNFMEYLNELARAQLAYYQ 300

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 118/291 (40%), Gaps = 41/291 (14%)

Query: 54  KTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPT 113
           +T  R +QE LG   DISQ+P +Y  +E++ D I  + +  L V++ +E E YDYP + +
Sbjct: 57  QTTHRMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVS 116

Query: 114 ESISDWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXX 173
           ES+++   T T + +  +                   + DP +  +AL + +  S     
Sbjct: 117 ESVNEISKTVTGKIQ--ELTKATSTEEAQNILISPGPAKDPKTLNYALSKVSLTSSEYLS 174

Query: 174 XXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLL 233
                                 L+K    ++D Q  +  A+ + D  +   FN++LK  L
Sbjct: 175 KSGSDSNVTADI----------LLK----YSDIQAQIAQARLQQDMLIRTRFNKQLKEKL 220

Query: 234 EVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTA 293
             EF      R++V+  RL +D  +      + + AK + +A                  
Sbjct: 221 NNEFAAAARARKEVDNKRLQYDIAR-----ANFSAAKPEKQA------------------ 257

Query: 294 DLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHR 344
             +    +E  EDEF      ++ FM S+ + ++ +         QL YH+
Sbjct: 258 --SLRVHMETLEDEFAEAMDVSISFMQSVMEKSEFLKEFSELVGAQLKYHK 306

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/341 (21%), Positives = 137/341 (40%), Gaps = 50/341 (14%)

Query: 8   ISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSA 67
           +S +   N+L+   Q+    +SE  +  + +I  +           ++ +R +QE LG+ 
Sbjct: 1   MSFNSFTNSLSQKFQELSTAVSEKTQEFSTSIPTLA----------ESTQRLVQEKLGNV 50

Query: 68  KDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKET 127
            DISQLP +Y  LER+ D I+ V +  L ++  +E E YDYP   ++S++D+        
Sbjct: 51  TDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKVFA--N 108

Query: 128 RFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXX 187
           +  +                   + +P +  +AL + A  S                   
Sbjct: 109 KVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNS---------SESLAQLADP 159

Query: 188 XXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKV 247
                  +L+K    ++D Q  +   +   D  +  +FN++L+  LE++  K    R+ V
Sbjct: 160 NEGPVADALLK----FSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDV 215

Query: 248 EESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDE 307
           +  RL +D  + +  +     AK + EA                    +   ++E  E++
Sbjct: 216 QYKRLQYDVARSKLTQ-----AKPEKEA--------------------SLRVEMESLEEQ 250

Query: 308 FVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
           F  +T +A   M  +   +K +S +K     QL Y     Q
Sbjct: 251 FAQSTEDATIIMQEVIADSKFLSSLKELAEAQLSYFETSAQ 291

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 125/333 (37%), Gaps = 60/333 (18%)

Query: 15  NTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKDISQLP 74
           N+ +++  K  Q+LSE  + +T  I ++           +  +R ++E LG AKDIS LP
Sbjct: 4   NSFSSSFNKKFQELSEKTQEMTSTIPHVA----------QNTQRLMKEKLGQAKDISTLP 53

Query: 75  PQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFXX 134
            +Y  LE K D ++++ +  L V+  +E E YDYP    ES   W  T +   +F     
Sbjct: 54  QEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESF--WEFTDSVGEKFSALNI 111

Query: 135 XXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXXXXXXXXX 194
                              P +  +ALH                                
Sbjct: 112 SEHNNKVKI----------PKTLNYALHNV-------------FLTANEKVKLLHEPLDN 148

Query: 195 SLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTF 254
           SL +   + ++ + ++  A+   D  +    N +LK  L   F++    R+ V   R  +
Sbjct: 149 SLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAAKYRKAVHHKRFNY 208

Query: 255 DTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTAE 314
           D  K                    E A P    T S+ AD+         +DEF   T +
Sbjct: 209 DVAK-----------------TNFEHAKPEKQATLSAQADI--------LKDEFEQATKD 243

Query: 315 AVEFMTSIADATKLISLVKLFQNFQLVYHRKCV 347
           A   M  I   ++L  ++K     QLVYH++  
Sbjct: 244 ATIVMQEIISNSRLEHILKELAVSQLVYHQRST 276

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 103/238 (43%), Gaps = 23/238 (9%)

Query: 54  KTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPT 113
           ++ +R +QE LG   DISQLP +Y  LE+K D+I+ + +  L V+  +E E YDYP    
Sbjct: 38  QSTQRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIK 97

Query: 114 ESISDWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXX 173
           +S++D+  + T   +                        DP +  +AL + +  +  +  
Sbjct: 98  DSVNDF--SKTMAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTASEV-- 153

Query: 174 XXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLL 233
                                +L      +++ Q  +  A+ + D  +  +FN+ L+  L
Sbjct: 154 ----------INQVGSTPNESALSSKLLEFSNVQSKIAQARLQQDTLIQTKFNKALRDDL 203

Query: 234 EVEFKKGHTLRRKVEESRLTFDT----LKYEQHERDAALAKK----QDEAKQA-EGAT 282
                K +  R++V+  RL +D     L   + E++A+L  K    +DE  QA E AT
Sbjct: 204 STSLAKANKFRKEVQNKRLQYDVARTNLMNAKPEKEASLRVKMESLEDEFAQATENAT 261

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 104/262 (39%), Gaps = 51/262 (19%)

Query: 8   ISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSA 67
           +S +  A++L+   Q+    +SE  + L +  Q              + +R +QE LG  
Sbjct: 1   MSFNAFASSLSKKLQELSTSVSERTQDLPNLAQ--------------STQRMVQERLGQV 46

Query: 68  KDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKET 127
            DISQLP +Y  LE K D I+ +    L V+  +E   YDYP    ES++++  +S+  +
Sbjct: 47  TDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEF--SSSLAS 104

Query: 128 RFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXX 187
           +  +                     +P +  +AL + A  S                   
Sbjct: 105 KLTELTHATSASQAQNILVAPGPIKEPKTLNYALSKVALNS------------------- 145

Query: 188 XXXXXXXSLIKMFGT-----------WADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVE 236
                   L KMF T           ++D Q  +  A+ + D  +  +FN+KL+  +  E
Sbjct: 146 -----SECLNKMFPTEEQPLASSLLQFSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFE 200

Query: 237 FKKGHTLRRKVEESRLTFDTLK 258
             K    R++V   RL +D  +
Sbjct: 201 IGKADKCRKEVHSMRLRYDVAR 222

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 128/334 (38%), Gaps = 49/334 (14%)

Query: 15  NTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSL-KTRKRQLQETLGSAKDISQL 73
           N+  N+ ++  Q  S T    TH +          I +L ++ +R +QE LG   DISQL
Sbjct: 5   NSFANSLRENLQSFSNTVSQKTHELST-------NIPTLAQSTQRMVQEKLGQVTDISQL 57

Query: 74  PPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFX 133
           P +Y  LE K D I+ V +  L V+  +E E YDYP   +ES++++      + + L   
Sbjct: 58  PQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQEL--- 114

Query: 134 XXXXXXXXXXXXXXAAGS-SDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXXXXXXX 192
                         A G   +P +  +A+ + A  +                        
Sbjct: 115 SKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNA------------SEYLNHSFDDPM 162

Query: 193 XXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRL 252
              L K+   ++D Q  +  A+ + D  +  +FN+ ++  L     + +  R+ V+  RL
Sbjct: 163 DAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRL 222

Query: 253 TFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNT 312
            +D  +          AK + EA                        Q+E  ED+F   T
Sbjct: 223 QYDVARTNLQN-----AKPEKEA--------------------GLRVQMETLEDQFAQAT 257

Query: 313 AEAVEFMTSIADATKLISLVKLFQNFQLVYHRKC 346
            +A   M  +  +   +  +K     QL Y+ + 
Sbjct: 258 EDATVVMQEVIASANFLPSLKELATAQLEYYEQS 291

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 99/262 (37%), Gaps = 51/262 (19%)

Query: 8   ISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSA 67
           +S +  A++L+   Q+    +SE  + L    Q              + +R +QE LG  
Sbjct: 1   MSFNAFASSLSKKLQEISTSVSEKTQELPSLAQ--------------STQRMVQERLGQV 46

Query: 68  KDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKET 127
            DISQLP +Y  LE K D I+ +    L V+  +E   YDYP    ES++++  +    +
Sbjct: 47  TDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVA--S 104

Query: 128 RFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXX 187
           +  +                     +P +  +AL + A  S                   
Sbjct: 105 KLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNS------------------- 145

Query: 188 XXXXXXXSLIKMFGT-----------WADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVE 236
                   L KMF T           ++D Q  +  A+ + D  +  +FN+ L+  L  E
Sbjct: 146 -----SECLNKMFPTEEQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFE 200

Query: 237 FKKGHTLRRKVEESRLTFDTLK 258
             K    R+ V   RL +D  +
Sbjct: 201 IGKADKCRKDVHSMRLRYDVAR 222

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 81/205 (39%), Gaps = 15/205 (7%)

Query: 54  KTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPT 113
           ++ +R +QE LG   DISQLP +Y  LE K D I+ +    L V+  +E   YDYP    
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 114 ESISDWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXX 173
           ES++++  + +  ++  +                     +P +  +AL + A  S     
Sbjct: 93  ESVNEF--SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSEC-- 148

Query: 174 XXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLL 233
                                 L      ++D Q  +  A+ + D  +  +FN+ L+  L
Sbjct: 149 -----------LNKMLPTEEQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERL 197

Query: 234 EVEFKKGHTLRRKVEESRLTFDTLK 258
             E  K    R+ V   RL +D  +
Sbjct: 198 SFEIGKADKTRKDVHSMRLRYDVAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 96/251 (38%), Gaps = 29/251 (11%)

Query: 8   ISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSA 67
           +S +  A++L+   Q+    +SE  + L +  Q              + +R +QE LG  
Sbjct: 1   MSFNAFASSLSKKLQEISTSVSERTQELPNFAQ--------------STQRMVQERLGQV 46

Query: 68  KDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKET 127
            DISQLP +Y  LE K D I+ +    L V+  +E   YDYP    ES++++  +    +
Sbjct: 47  TDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVA--S 104

Query: 128 RFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXX 187
           +  +                     +P +  +AL + +  S                   
Sbjct: 105 KLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNSSEC-------------LNK 151

Query: 188 XXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKV 247
                   L      ++D Q  +   + + D  +  +FN+KL+  L  E  K    R+ V
Sbjct: 152 MFPAEEQPLASALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDV 211

Query: 248 EESRLTFDTLK 258
              RL +D  +
Sbjct: 212 HSMRLRYDVAR 222

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/345 (21%), Positives = 131/345 (37%), Gaps = 73/345 (21%)

Query: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64
           FGA S         +  +K Q+  ++TQE LT  I  +           ++  R ++E L
Sbjct: 3   FGAFS--------ESVGKKFQELTTKTQE-LTSTIPTV----------AQSTHRMVKEKL 43

Query: 65  GSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTST 124
           G   DIS LP +Y  LE K D  + V +  L ++  +E E YDYP   +ES++++  T +
Sbjct: 44  GQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEF--TDS 101

Query: 125 KETRFLKFXXXXXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXX 184
              +  +F                +    P +  +A+ + + G+                
Sbjct: 102 IGNKMYEF--------SNGVSTEGSSGKTPRTLNYAVSKVSMGA-------------SEQ 140

Query: 185 XXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLR 244
                      +  +     +A+ ++  A+   D  +  +FN +L+  +    ++    R
Sbjct: 141 FQKLHDTDDKRIANLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIERASKYR 200

Query: 245 RKVEESRLTFDTL--KYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLE 302
           ++V   RL +D    KY +HE++  +                               +LE
Sbjct: 201 KEVYHKRLKYDIAREKYSKHEKNGTVK-----------------------------VELE 231

Query: 303 DAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCV 347
             EDEF   T +A+  M  I    +    +K F   +L YH K V
Sbjct: 232 ILEDEFNHATKDAIMVMQEIISNNRFEQNLKDFAAAKLAYHEKSV 276

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 71/327 (21%), Positives = 130/327 (39%), Gaps = 43/327 (13%)

Query: 16  TLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKDISQLPP 75
           + N+ A    QK  E    ++   Q++    P +I S  + +R +QE LG+  DISQLP 
Sbjct: 2   SFNDFASSLTQKFQELSTVVSERTQDLGTSIP-SIAS--STQRLVQEKLGNVTDISQLPQ 58

Query: 76  QYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFXXX 135
           +Y  LE++ D I+ V +  L ++  ++ E YDYP   ++S++D+  +   +++       
Sbjct: 59  EYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDY--SKLFQSKIEDLSRA 116

Query: 136 XXXXXXXXXXXXAAGSSDPPSFAHALHRAAKGSQGIXXXXXXXXXXXXXXXXXXXXXXXS 195
                           ++P +  +AL + A  S                          +
Sbjct: 117 TSAEEAQNILVTPGPITEPRTLNYALSKVALTS---------SESLNQLQDPNVSAVAST 167

Query: 196 LIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFD 255
           L+K    ++D Q  +   + + D  +  + N+ +K  L    +K    RR V+  RL +D
Sbjct: 168 LLK----FSDMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKSRRDVQYKRLQYD 223

Query: 256 TLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTAEA 315
             + +      A AK + EA                    A   ++E  E++F   T  A
Sbjct: 224 VARSK-----LAQAKPEKEA--------------------ALRVEMESLEEQFAQATESA 258

Query: 316 VEFMTSIADATKLISLVKLFQNFQLVY 342
              M  +   +K +  +K     QL Y
Sbjct: 259 TVTMQDVISQSKFLDTLKNLVEAQLSY 285

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/296 (19%), Positives = 112/296 (37%), Gaps = 40/296 (13%)

Query: 54  KTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPT 113
           + ++R  QE LG   DISQ+P +Y  LE + D ++   + +L V++ +E   YD+P +  
Sbjct: 37  QVQQRLAQEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQ 96

Query: 114 ESISDWWNTSTKETRFLKFXXXXXXXXXXXXXXXAAGSSDPP-SFAHALHRAAKGSQGIX 172
           ES+ DW  +    +R  +                  G  + P +  +AL +A+     + 
Sbjct: 97  ESVQDW--SRAIGSRVQELSRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAVSTL- 153

Query: 173 XXXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHL 232
                                  L      ++D Q  +   +   D  +  +FN++L+ +
Sbjct: 154 -----------TSSNMPGPNGEGLSSGLIAYSDTQAKLAQIRIAQDTQVQTKFNKQLREI 202

Query: 233 LEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSST 292
           L     K +  R+ V+  R+ +D  +          A+ + EA                 
Sbjct: 203 LNNPIAKANKYRKDVQYKRVLYDIARTNLQN-----ARPEKEA----------------- 240

Query: 293 ADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348
              +   ++E  ED+F   T EA   M      T L+  V      Q  Y+++ ++
Sbjct: 241 ---SLRVEMETLEDQFAQITEEATIVMQETLSNTHLLKNVAELAEIQKNYYKQSLE 293

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 103/238 (43%), Gaps = 38/238 (15%)

Query: 60  LQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDW 119
           +QE  G   DIS LP +Y  LE++ D+I+ V    L ++  +E E YDYP +  +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 120 WNTSTKETRFLK--------FXXXXXXXXXXXXXXXAAGS------SDPPSFAHALHRAA 165
             T++   + L+                        + GS      + P +  +AL +AA
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKAA 120

Query: 166 K-GSQGIXXXXXXXXXXXXXXXXXXXXXXXSLIKMFGTWADAQYNMDIAKREMDQFMVKE 224
              ++ +                           +F ++++A+  +   + + D+ + K 
Sbjct: 121 LFAAEQLKMDKDSST-------------------VFHSFSEAESIISDERIKQDKIIQKS 161

Query: 225 FNEKLKHLLEVEFKKGHTLRRKVEESRLTFDT----LKYEQHERDAALAKKQDEAKQA 278
           FN +LK++L       +  R+ V+  RL +D     L +   +++++L    ++ KQA
Sbjct: 162 FNTELKNVLTNRIDVANKHRKDVQNKRLQYDISRTKLDHASEDKESSLRVAMEQHKQA 219

>KLLA0E22089g Chr5 complement(1970992..1972404) [1413 bp, 470 aa]
           {ON} weakly similar to uniprot|P18544 Saccharomyces
           cerevisiae YOL140W ARG8 Acetylornithine aminotransferase
           catalyzes the fourth step in the biosynthesis of the
           arginine precursor ornithine
          Length = 470

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 46/105 (43%), Gaps = 16/105 (15%)

Query: 27  KLSETQE----HLTHAIQNIKID-DPKTILSLKTRKRQLQETLGSAKDISQLPPQYGFLE 81
           K  ET+E     L H+++ + +D DP+TI  +      L ETL     +   PP  G+L 
Sbjct: 187 KKGETEEEYCARLIHSLEQLILDNDPETISVV------LVETL-PGSSLGTTPPPKGYLS 239

Query: 82  RKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKE 126
                I ++C K  VV    EV       NP   ++ W N  T E
Sbjct: 240 ----GIRRICNKYDVVFMLDEVMCGTGRSNPNGKLNCWENFLTAE 280

>Kwal_23.4663 s23 (806647..808272) [1626 bp, 541 aa] {ON} YNL189W
           (SRP1) - karyopherin alpha homolog of 60 kDa [contig 5]
           FULL
          Length = 541

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 244 RRKVEESRLTFDTLKYE--QHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQL 301
           R   +E R   DT + E  + +RD ALAK+++ A   +GA        +STAD  FY+QL
Sbjct: 25  RFSADELRRRRDTQQVELRKAKRDEALAKRRNFAAPPDGADSEDEDEATSTADQQFYSQL 84

Query: 302 E 302
           +
Sbjct: 85  Q 85

>ZYRO0C09944g Chr3 complement(755216..756829) [1614 bp, 537 aa] {ON}
           highly similar to uniprot|Q02821 Saccharomyces
           cerevisiae YNL189W SRP1 karyopherin alpha homolog of 60
           kDa
          Length = 537

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 244 RRKVEESRLTFDTLKYE--QHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQL 301
           R   +E R   DT + E  + +RD ALAK+++    A GA        S++AD  FYAQL
Sbjct: 21  RFSADELRRRRDTQQVELRKAKRDEALAKRRNYIPPANGADSEDEDDASASADQQFYAQL 80

Query: 302 E 302
           +
Sbjct: 81  Q 81

>TDEL0A01040 Chr1 (175963..177591) [1629 bp, 542 aa] {ON} Anc_2.63
           YNL189W
          Length = 542

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 244 RRKVEESRLTFDTLKYE--QHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQL 301
           R   +E R   DT + E  + +RD ALAK+++ A Q  GA        S++AD  FY QL
Sbjct: 27  RFSADELRRRRDTQQVELRKAKRDEALAKRRNFAPQTNGADSEDEDDASASADQQFYNQL 86

Query: 302 E 302
           +
Sbjct: 87  Q 87

>TPHA0C00220 Chr3 complement(34296..35954) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 14/87 (16%)

Query: 24  TQQKLSETQEH---------LTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKDISQLP 74
           T   L+  QE+          ++ IQNI   + +TI S K+  R+    L + K     P
Sbjct: 34  TNDCLAAVQEYASAMDINRTFSNTIQNIDAIN-RTITSEKSYNREASNDLENGKTNRGPP 92

Query: 75  PQYGFLERKCDAIEQVCK----KILVV 97
           P+YGFL+ +  A  ++      KIL +
Sbjct: 93  PKYGFLDPEMAATRKIVAFAYVKILTI 119

>Suva_14.152 Chr14 (280191..281819) [1629 bp, 542 aa] {ON} YNL189W
           (REAL)
          Length = 542

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 244 RRKVEESRLTFDTLKYE--QHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQL 301
           R   EE R   DT + E  + +RD ALAK+++     +GA        S +AD  FY+QL
Sbjct: 26  RFSAEELRRRRDTQQVELRKAKRDEALAKRRNFVPPTDGADSDEEDESSISADQQFYSQL 85

Query: 302 E 302
           +
Sbjct: 86  Q 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,754,852
Number of extensions: 1124157
Number of successful extensions: 5735
Number of sequences better than 10.0: 102
Number of HSP's gapped: 5916
Number of HSP's successfully gapped: 144
Length of query: 364
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 253
Effective length of database: 40,753,473
Effective search space: 10310628669
Effective search space used: 10310628669
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)