Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR308W3.490ON1921928291e-114
Ecym_12393.490ON1931963671e-43
SAKL0F02816g3.490ON1921892912e-32
Kwal_55.212263.490ON1961852331e-23
TDEL0D055803.490ON1931982285e-23
ZYRO0D10032g3.490ON2091972271e-22
KLTH0F14784g3.490ON1951922233e-22
Suva_7.4173.490ON2122092042e-19
NCAS0E008203.490ON2021951991e-18
KLLA0E04643g3.490ON2211881965e-18
CAGL0I10538g3.490ON2001931868e-17
Kpol_480.153.490ON2072011869e-17
NDAI0G009503.490ON2131331809e-16
YGR129W (SYF2)3.490ON2152141791e-15
Smik_6.2253.490ON2132121615e-13
Skud_7.4403.490ON2132081544e-12
TBLA0C044703.490ON2221791352e-09
TPHA0D042403.490ON2092021221e-07
KNAG0B008203.490ON20751760.14
ZYRO0G08294g6.190ON62477655.9
CAGL0G08426g8.408ON49049639.6
NOTE: 1 genes in the same pillar as AFR308W were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR308W
         (192 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...   323   e-114
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...   145   1e-43
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   116   2e-32
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    94   1e-23
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    92   5e-23
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    92   1e-22
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    91   3e-22
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    83   2e-19
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    81   1e-18
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    80   5e-18
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    76   8e-17
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    76   9e-17
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    74   9e-16
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    74   1e-15
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    67   5e-13
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    64   4e-12
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    57   2e-09
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    52   1e-07
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    34   0.14 
ZYRO0G08294g Chr7 complement(674545..676419) [1875 bp, 624 aa] {...    30   5.9  
CAGL0G08426g Chr7 complement(795459..796931) [1473 bp, 490 aa] {...    29   9.6  

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score =  323 bits (829), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 164/192 (85%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           MGIEDINRRLRQLKKKRVDASI                GKPRVYSM            TQ
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQ 60

Query: 61  SEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATN 120
           SEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATN
Sbjct: 61  SEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATN 120

Query: 121 GRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSLNDKNRHFN 180
           GRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSLNDKNRHFN
Sbjct: 121 GRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSLNDKNRHFN 180

Query: 181 EKLDREFRKRGQ 192
           EKLDREFRKRGQ
Sbjct: 181 EKLDREFRKRGQ 192

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score =  145 bits (367), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 117/196 (59%), Gaps = 9/196 (4%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXT- 59
           M I+DI+ RLR+LK KRVD SI                 KP VYS+            T 
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 60  QSEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRAT 119
            +E+ KLLNY + DYEKWDEK+K+     DG   G++A STY++E+ QL + G+ KG+ T
Sbjct: 61  NTERRKLLNYSLIDYEKWDEKEKQAN--FDGTYSGDIAYSTYKNEIKQLRKGGLTKGKIT 118

Query: 120 NGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSL----NDK 175
            GRIS SGKV ++DE ELV KLA  +++T++ R    +K+   DG +A    L    N+K
Sbjct: 119 KGRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRL--DGHKANTSELGNFVNEK 176

Query: 176 NRHFNEKLDREFRKRG 191
           NRHFNEKL R+F++ G
Sbjct: 177 NRHFNEKLSRQFKELG 192

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  116 bits (291), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 106/189 (56%), Gaps = 3/189 (1%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M + D+  +L+ LK+K VD S+                GKP+VYSM             +
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKE--E 58

Query: 61  SEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVV-KGRAT 119
             + KLLNY I DYEKW  K+    + SDG+   +LA  TY  E+ ++ + G + +G+ T
Sbjct: 59  DTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVT 118

Query: 120 NGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSLNDKNRHF 179
             R++  G++ ++D+ + +E+LA  + ++ KRR+ ER+K+A K     T G +NDKN+ F
Sbjct: 119 KARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGGFINDKNKQF 178

Query: 180 NEKLDREFR 188
           NEKL R+F+
Sbjct: 179 NEKLSRQFK 187

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 94.4 bits (233), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 97/185 (52%), Gaps = 4/185 (2%)

Query: 9   RLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQSEQLKLLN 68
           RL+ LK+KR+D S+                 KP VYSM              +E  KLL 
Sbjct: 9   RLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDV-TEANKLLK 67

Query: 69  YRIADYEKWDEKQKRHKQPSDG-ADLGELANSTYRSELHQLHR-RGVVKGRATNGRISAS 126
           Y + +YE+W +K K++    +G A   +LA STY  E+ QL +  G    + T  R++  
Sbjct: 68  YSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNKNTKYRVNNK 127

Query: 127 GKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS-LNDKNRHFNEKLDR 185
           GK+V++D+ +LV  L   + +TA  R+   QKK  +     T+G  +N+KN+ FN+KL+R
Sbjct: 128 GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKNKQFNDKLER 187

Query: 186 EFRKR 190
           + +KR
Sbjct: 188 QTKKR 192

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 92.4 bits (228), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 100/198 (50%), Gaps = 19/198 (9%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXX-XXXXXXT 59
           M +E I  R + LKK+ VD +I                GKP++YSM             +
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 60  QSEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRAT 119
           +  +LKL+NY + +YE+WD+KQK  +    GA++ ELA  +Y  +L         + +  
Sbjct: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLS--------RSKQN 112

Query: 120 NG----RISASGKV----VLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS 171
           NG    +IS   K     V DDE +LV KLA  +++T + R   R+K   K   RAT G 
Sbjct: 113 NGNRVVKISTDAKTNRLQVKDDE-KLVNKLANDLKKTTRERFLARKKDMEKADARATPGG 171

Query: 172 -LNDKNRHFNEKLDREFR 188
            +N+KN+ FN KLDR+ +
Sbjct: 172 YINEKNKQFNLKLDRQMK 189

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 92.0 bits (227), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 96/197 (48%), Gaps = 12/197 (6%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M ++   +    LKKK  + S+                 KPRVY +              
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDKH 70

Query: 61  SEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATN 120
             QL  +NY I  YE+W+ +Q+      D  +L ++A  TY  EL++LH+  +++ R TN
Sbjct: 71  GNQL--MNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRYTN 128

Query: 121 G-------RISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKD---GGRATAG 170
           G       R   +GK+ + D+ +LV+KLA  + +TA  R+E R+++  +       +  G
Sbjct: 129 GGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGG 188

Query: 171 SLNDKNRHFNEKLDREF 187
            +N+KN+ FNEKLDR+ 
Sbjct: 189 YINEKNKQFNEKLDRQM 205

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 90.5 bits (223), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 99/192 (51%), Gaps = 7/192 (3%)

Query: 5   DINR---RLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQS 61
           D+N+   RL+ LK+K V  S+                 KP VYSM             +S
Sbjct: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTE-ES 60

Query: 62  EQLKLLNYRIADYEKWDEKQKRHKQ-PSDGADLGELANSTYRSELHQLHRRGVVK-GRAT 119
           ++ KLL Y + D+E+W +K++R  Q  SD A   +LA  TY  E+ QL +    K  +  
Sbjct: 61  KEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPK 120

Query: 120 NGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS-LNDKNRH 178
              I+  GK+V+ D+P LV  LA ++ +TA  R+   +KK  +     T G  +N+KN+ 
Sbjct: 121 KVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNKQ 180

Query: 179 FNEKLDREFRKR 190
           FN+K++R+ +KR
Sbjct: 181 FNDKIERQTKKR 192

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 83.2 bits (204), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 99/209 (47%), Gaps = 21/209 (10%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M +E++  +L++LK++RVDAS+                 KPRVYSM              
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 61  SEQLKLLNYRIADYEKWDEKQKRHKQ---PSDGADLGELANSTYRSELHQL-------HR 110
            ++ +  +Y + +Y  W++KQK+ K       G    +LA  +Y   L  L       H 
Sbjct: 61  DDKDRAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHE 120

Query: 111 RGV----VKGRATNGRI------SASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKA 160
             V     KG     RI      S +GK+ + D+ ELV KLA+ ++  +K+RH+ R+++ 
Sbjct: 121 SSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQM 180

Query: 161 AKDGGRATAGS-LNDKNRHFNEKLDREFR 188
                 +   S +NDKN+ FNEKL RE R
Sbjct: 181 ENVKTPSGVESFINDKNKQFNEKLGRESR 209

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 81.3 bits (199), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 102/195 (52%), Gaps = 7/195 (3%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           + +E  +R+L++LK+K  DA+I                GKPRVY+M              
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61

Query: 61  SEQ--LKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYR---SELHQLHRRGVVK 115
           ++    KL+NY +  YE+W++KQK  K   D +D+ +LA  +Y    S L++        
Sbjct: 62  ADDKVAKLMNYTLRQYEEWEKKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNRFRTDKTTT 121

Query: 116 GRATNGRI-SASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKA-AKDGGRATAGSLN 173
            R    ++ S +GKV + DE +LV  LA  + +TA +R+   +KK  A+    +  G +N
Sbjct: 122 EREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYIN 181

Query: 174 DKNRHFNEKLDREFR 188
           ++N+HFNEKLDRE R
Sbjct: 182 ERNKHFNEKLDRESR 196

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 80.1 bits (196), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 95/188 (50%), Gaps = 11/188 (5%)

Query: 5   DINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQSEQ- 63
           +I ++L+ L+K++V+ SI                   RVYSM            ++ E  
Sbjct: 41  EIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER---RVYSMADDGEDKARSNKSEPEDP 97

Query: 64  LKLLNYRIADYEKWDEKQK--RHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATNG 121
           +KL NY I +YEKW+ K +  RH +   G D   +A ++Y+ E+  L +          G
Sbjct: 98  IKLANYSIREYEKWEAKTQNSRHNKSVMG-DFQTIAKNSYKKEVDALPKDI---SHPLKG 153

Query: 122 RISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGG-RATAGSLNDKNRHFN 180
            I+  GKV ++D PELVEK+   + + +K+R+  R++K  K        G +NDKN+ FN
Sbjct: 154 GITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNKRFN 213

Query: 181 EKLDREFR 188
            KL+ EF+
Sbjct: 214 AKLNSEFK 221

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 76.3 bits (186), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 94/193 (48%), Gaps = 9/193 (4%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M +ED N +L+ LKK   D  I                 KPRVYSM            + 
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 61  SE---QLKLLNYRIADYEKWDEKQKRHKQPSD----GADLGELANSTYRSELHQLHRRGV 113
            +   +  L  Y + D+  W+++Q+R K+       G  L  LA +TY  EL  L R   
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120

Query: 114 -VKGRATNGRISA-SGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS 171
            +K + T  RI+  SGKV + D  ELV++L+  +++TAK+R++  +K A      + +GS
Sbjct: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSLSGS 180

Query: 172 LNDKNRHFNEKLD 184
           +N KN  FN+ LD
Sbjct: 181 INAKNLQFNKSLD 193

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 76.3 bits (186), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 99/201 (49%), Gaps = 20/201 (9%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M I++     ++LK+K VD  I                 KP+ YSM            T 
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62

Query: 61  SEQLKLLNYRIADYEKWDEKQKRHKQ-----PSDGADLGELANSTYRSELHQLHRRGVVK 115
            E  +LLNY I +YE+W++KQ RHK+      S      ++A  TY         + + K
Sbjct: 63  DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTY-----DKQIKKLQK 117

Query: 116 GRATN---GRIS------ASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGR 166
            ++TN   G+IS       +GK+V++D  +L+++LA  + QT K R++   +K  K+  +
Sbjct: 118 QKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQ 177

Query: 167 ATAGS-LNDKNRHFNEKLDRE 186
               S +N+KN+ FN+KL+R+
Sbjct: 178 NENYSYINEKNKEFNDKLERQ 198

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 73.9 bits (180), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 78/133 (58%), Gaps = 5/133 (3%)

Query: 63  QLKLLNYRIADYEKWDEKQK-RHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATNG 121
           + KL+NY I +YE+WD++QK + ++  DG+DL ELA  TY  EL +L+ +          
Sbjct: 76  KFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKLNSKLENISHEQKH 135

Query: 122 RISAS---GKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS-LNDKNR 177
           +I  +   GK+ + DE  L+  L   + +TAK+R+  R+KK         AG+   DKN+
Sbjct: 136 QIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSDIAGNYFKDKNK 195

Query: 178 HFNEKLDREFRKR 190
            FNEKL+RE ++R
Sbjct: 196 QFNEKLERELKER 208

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 73.6 bits (179), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 97/214 (45%), Gaps = 32/214 (14%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M    ++ +L++LK+KRVD SI                 KPRVYSM            T+
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 61  S-EQLKLLNYRIADYEKWDEKQKRHKQPSDG------ADLGELANSTYRSELHQLHRRGV 113
           S E+ K  +Y + +Y+ W   ++RH Q   G          +LA  +Y   L  L  +  
Sbjct: 61  SPEKEKAFHYTVQEYDAW---ERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQ 117

Query: 114 VKGRATN-------------GRI------SASGKVVLDDEPELVEKLAAAVQQTAKRRHE 154
              +  +             GRI      + +GK+ + D+ +LV KLA ++Q  +K+R+E
Sbjct: 118 NSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYE 177

Query: 155 --ERQKKAAKDGGRATAGSLNDKNRHFNEKLDRE 186
             +RQ + AK         +NDKN+ FNEKL RE
Sbjct: 178 ARKRQMQNAK-TLYGVESFINDKNKQFNEKLSRE 210

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 66.6 bits (161), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 98/212 (46%), Gaps = 26/212 (12%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M ++ + +RL++LKKKRV+ SI                 KPRVY+M            T+
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 61  S-EQLKLLNYRIADYEKWDEKQKRHK---QPSDGADLGELANSTYRSELHQLHRRGVV-- 114
           S ++ +  +Y   +Y  W+++  + K       G    +LA  +Y   L  L  + +   
Sbjct: 61  SSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEY 120

Query: 115 ---------KGRATNGRI------SASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKK 159
                    K  +   RI      + +GK+ + D+ +LV KLA +++  +K+R+E R+++
Sbjct: 121 DNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQ 180

Query: 160 ---AAKDGGRATAGSLNDKNRHFNEKLDREFR 188
              A    G      +NDKN+ FNEKL RE R
Sbjct: 181 MESAVIPSG--VESFINDKNKQFNEKLSRESR 210

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 95/208 (45%), Gaps = 22/208 (10%)

Query: 1   MGIEDINRRLRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXXTQ 60
           M ++ ++++L+ LK+K V+ SI                 KP+VYSM             +
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 61  -SEQLKLLNYRIADYEKWDEKQKRHKQPS---DGADLGELANSTYRSELHQLHRRGVVKG 116
            S++ K  +Y + +Y  W +KQ + K       G    ++A  +Y   L  L  +   K 
Sbjct: 61  TSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKN 120

Query: 117 RAT-----------NGRISA------SGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKK 159
             +           NG I        +GK+ + D+ +LV KLA  ++  +K+R+E R+K+
Sbjct: 121 ENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQ 180

Query: 160 AAKDGGRATAGS-LNDKNRHFNEKLDRE 186
                  ++  S +NDKN+ FNEKL RE
Sbjct: 181 MENAKTPSSVESFINDKNKQFNEKLSRE 208

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 32/179 (17%)

Query: 39  GKPRVYSMXXX--------XXXXXXXXXTQSEQL-KLLNYRIADYEKWDEKQKRHKQPSD 89
            KP+VYSM                    ++ E++ KL+NY + +Y+ W+ KQ  +   S 
Sbjct: 40  NKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQ 99

Query: 90  G-------ADLGELANSTYRSELHQLHR--RGVVKGRATN--GRI-----SASGKVVLDD 133
                     L  LA  TY  ++ +L++  R    G  +N  G+I     + S K+V+ D
Sbjct: 100 TNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKD 159

Query: 134 EPELVEKLAAAVQQTAKRRHE---ERQKKAAKDGGRATAGSLNDKNRHFNEKLDREFRK 189
           +  LVE+L   ++  + R ++   ER+K  +       +G +N KN+ FNEKL RE++K
Sbjct: 160 DKFLVEELVNNLKTKSDRLYKHLGERRKNYST----TLSGHVNTKNQEFNEKLTREWKK 214

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 87/202 (43%), Gaps = 30/202 (14%)

Query: 10  LRQLKKKRVDASIXXXXXXXXXXXXXXXXGKPRVYSMXXXXXXXXXXXX---TQSEQLKL 66
            + LKK+ +D+ I                 KP+VYS+               T + +  L
Sbjct: 10  FKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDLLTNNSERAL 69

Query: 67  LNYRIADYEKWDEKQKR-HKQPSD----GADLGELANSTYRSELHQLHRRG--------V 113
           L Y I DYE+W+E  KR HK  ++     +   + A  TY  E+H++ +R         +
Sbjct: 70  LTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQGKFATDEEI 129

Query: 114 VKGRATNGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQK-----------KAAK 162
            +G A    +   GK+++ D+  LV    + + + +  R+ +R K           K + 
Sbjct: 130 TRGSAM-KEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNNDATGSKVSH 188

Query: 163 DGGRATAGSLNDKNRHFNEKLD 184
           D G+ +    N KN+ FN+KL+
Sbjct: 189 DKGKTSYN--NAKNKDFNDKLE 208

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 138 VEKLAAAVQQTAKRRHEERQKKAAKDGGRATA---GSLNDKNRHFNEKLDR 185
           VE+L   +   +K+R+  R+ K  + G R  +   G +N+KN+ FN+KL R
Sbjct: 152 VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>ZYRO0G08294g Chr7 complement(674545..676419) [1875 bp, 624 aa] {ON}
           similar to uniprot|P53154 Saccharomyces cerevisiae
           YGL084C GUP1 Multimembrane-spanning protein and similar
           to uniprot|Q08929 Saccharomyces cerevisiae YPL189W GUP2
          Length = 624

 Score = 29.6 bits (65), Expect = 5.9,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 64  LKLLNYRIADYEKWDEKQKRHKQPSDGA--DLGELANSTYRSELHQLHRRGVVKGRATNG 121
           LK+L+Y +   EKW EKQ      S  A   LG+++    RSE    +  G   G +   
Sbjct: 254 LKILSYNMDFLEKWQEKQSADINNSSIALKSLGKVSPPGSRSESPMSNASGSATGSSLEL 313

Query: 122 RISASGKVVLDDEPELV 138
             + S +  L+++  LV
Sbjct: 314 HKTRSNQHPLEEKERLV 330

>CAGL0G08426g Chr7 complement(795459..796931) [1473 bp, 490 aa] {ON}
           similar to uniprot|Q06001 Saccharomyces cerevisiae
           YLR238w
          Length = 490

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 133 DEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSLNDKNRHFNE 181
           D P  V     AV Q +K+ H  R + +  + G  TA   N+KNRH  E
Sbjct: 6   DSPRPVAVAPTAVLQDSKK-HSRRDRHSRNNVGTKTATQANNKNRHVAE 53

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,931,874
Number of extensions: 598299
Number of successful extensions: 2179
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2140
Number of HSP's successfully gapped: 36
Length of query: 192
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 89
Effective length of database: 41,670,801
Effective search space: 3708701289
Effective search space used: 3708701289
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)