Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR307C3.489ON65065033540.0
SAKL0F02838g3.489ON65466117010.0
KLTH0F14762g3.489ON65065815950.0
KLLA0E04665g3.489ON64765615580.0
TDEL0D055703.489ON64966014910.0
NCAS0E008303.489ON67167514880.0
Kpol_480.163.489ON65566414520.0
ZYRO0D10054g3.489ON66467114420.0
TBLA0C044603.489ON69872213531e-178
Suva_7.4163.489ON71372013161e-173
NDAI0G009603.489ON70071213051e-171
TPHA0D042303.489ON65266012981e-171
Smik_6.2243.489ON70571012931e-169
YGR128C (UTP8)3.489ON71371712801e-167
Skud_7.4393.489ON71372012641e-165
CAGL0I10560g3.489ON67869412491e-163
Kwal_55.212223.489ON3733799541e-123
KAFR0C019403.489ON6096787908e-96
KNAG0B008303.489ON6076377653e-92
Kwal_55.21225singletonOFF2152154443e-50
KLTH0H11176g1.343ON77442761.4
Skud_4.6395.437ON44284751.7
CAGL0I08415g7.519ON1308156761.8
TPHA0A004603.45ON37346732.8
Smik_4.6365.437ON44683733.4
Kpol_1011.58.68ON122186733.6
Ecym_62328.726ON651180724.4
YDR370C5.437ON44283698.8
Suva_10.1055.191ON186160709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR307C
         (650 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...  1296   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   659   0.0  
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   619   0.0  
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   604   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   578   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   577   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   563   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   560   0.0  
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   525   e-178
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   511   e-173
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   507   e-171
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   504   e-171
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   502   e-169
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   497   e-167
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   491   e-165
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   485   e-163
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   372   e-123
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   308   8e-96
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   299   3e-92
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   175   3e-50
KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {...    34   1.4  
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...    33   1.7  
CAGL0I08415g Chr9 (820773..824699) [3927 bp, 1308 aa] {ON} some ...    34   1.8  
TPHA0A00460 Chr1 complement(72464..73585) [1122 bp, 373 aa] {ON}...    33   2.8  
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...    33   3.4  
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...    33   3.6  
Ecym_6232 Chr6 complement(433068..435023) [1956 bp, 651 aa] {ON}...    32   4.4  
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...    31   8.8  
Suva_10.105 Chr10 complement(193819..199404) [5586 bp, 1861 aa] ...    32   9.9  

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score = 1296 bits (3354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/650 (97%), Positives = 635/650 (97%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEP               QYVINPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA 120
           KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA 120

Query: 121 SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY 180
           SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY
Sbjct: 121 SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY 180

Query: 181 FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFG 240
           FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFG
Sbjct: 181 FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFG 240

Query: 241 KLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFLLDLLH 300
           KLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFLLDLLH
Sbjct: 241 KLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFLLDLLH 300

Query: 301 NAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGT 360
           NAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGT
Sbjct: 301 NAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGT 360

Query: 361 GTLKDSLGKGFLSGEHRRTEALKPLFGTDDDESPNIDFAAILAELTSRTTPKAFDSIFYK 420
           GTLKDSLGKGFLSGEHRRTEALKPLFGTDDDESPNIDFAAILAELTSRTTPKAFDSIFYK
Sbjct: 361 GTLKDSLGKGFLSGEHRRTEALKPLFGTDDDESPNIDFAAILAELTSRTTPKAFDSIFYK 420

Query: 421 RLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLFPSSHTKGLLP 480
           RLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLFPSSHTKGLLP
Sbjct: 421 RLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLFPSSHTKGLLP 480

Query: 481 KLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIREL 540
           KLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIREL
Sbjct: 481 KLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIREL 540

Query: 541 SRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQ 600
           SRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQ
Sbjct: 541 SRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQ 600

Query: 601 VAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLDS 650
           VAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLDS
Sbjct: 601 VAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLDS 650

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/661 (52%), Positives = 464/661 (70%), Gaps = 20/661 (3%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           MA I+QPFRL  LPKI+SLNN++ QT YLQVA+ L P               QY+INPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAM------SDGAELWSYALTANGKVHTLHAVLRKAGA-AP 113
           KLV+N+ IPST++VT CDV  +      ++  E+W YAL AN K  TL+ +++   A AP
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVAN-KSFTLNTIIKPLTADAP 119

Query: 114 QETGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYT 173
                   E+  +K ++K +V  V+I  + K I+ VL  GL+QT+D+QL+LLHS DISY 
Sbjct: 120 SVNSTQTFEN--YKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYG 177

Query: 174 NVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAES 233
           N+ LV+YFT+   +D+M VL D+ + K CYKLF++ H   N+P+ ELNSVILE F+L  S
Sbjct: 178 NISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNS 237

Query: 234 KMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKI 293
           K  YQFGK+Y L + K+ +YSLPHFQLS+ + LPFV  ++ VS + ISTNR LLT  N+I
Sbjct: 238 KTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRI 297

Query: 294 FLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDV 353
           +LLDLLHNAIL +REL+++K FQLL  A+IPG T  E+N+T AIGVSTK  +N +SALD+
Sbjct: 298 YLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNT-AENNKTIAIGVSTKSDNNATSALDI 356

Query: 354 VTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDDE-----SPNIDFAAILAEL-TS 407
           V I VG+GTLKDS+ KGFL+ +    E L  LF   DDE     +   D+  IL+EL  +
Sbjct: 357 VNINVGSGTLKDSMSKGFLTQDATE-EVLNSLFDEQDDELDEDGTSQFDYNQILSELEKA 415

Query: 408 RTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTH 467
           ++  + FD++F+K L  KKEYYTE+DRF N+  FL  +L  IF  F  E+P+AL YLLTH
Sbjct: 416 KSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTH 475

Query: 468 PLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQE 527
           PLFP+ H   LL K K HPRLF+QA+VTCPNLPLD LLHELFTV+NDEL LDLSLR+LQ+
Sbjct: 476 PLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQD 535

Query: 528 FTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEG 587
           FTK+ IKQ I+++S+VD++NF+ FVI +  D EER K+KPQLFQLL+LV+D++GL AL+G
Sbjct: 536 FTKDSIKQSIKKMSKVDINNFIGFVINEDDD-EERNKSKPQLFQLLNLVLDSIGLFALDG 594

Query: 588 DILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEY 647
           + L  L  FI++QV + +Q +ELL LL+++S K    ++S +    +   A +P YSVEY
Sbjct: 595 ESLENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQA-LPSYSVEY 653

Query: 648 L 648
           L
Sbjct: 654 L 654

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/658 (49%), Positives = 450/658 (68%), Gaps = 18/658 (2%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           M  I+QPFRL  LPKI+SLNNYA Q +YLQVAD L P               QY+INPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAMS-----DGAELWSYALTANGKVHTLHAVLRKAGAAPQE 115
           KLVYN PI STNVV+ C V  ++     D  E+  Y + +N +V++L A ++   +   +
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSN-RVYSLCATIKPVSSTASD 119

Query: 116 TGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNV 175
           +    +   H K ++  ++V +++    K I+ VL  GLIQ +D++L+L HSLD SY NV
Sbjct: 120 SSFGETYAAH-KVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNV 178

Query: 176 GLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKM 235
             V++FT  +G+ Y F+L DI   K  +KLF++  S    P TEL+SVILE+  L +S++
Sbjct: 179 SYVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQI 238

Query: 236 VYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFL 295
            YQFG++YRL  + + +Y+LPHFQ S  + LPF+  +  +S + ISTNR LLT  NKIFL
Sbjct: 239 FYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFL 298

Query: 296 LDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVT 355
           LDLLHNAIL +RE+ ++K FQLL  AVIPG +   +N+T A+GVS K GSNPSS+LD++ 
Sbjct: 299 LDLLHNAILSQREMGHVKIFQLLETAVIPGNST-LNNKTIALGVSIKHGSNPSSSLDIIN 357

Query: 356 IAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGT-DDDESPNIDFAAILAELT-SRTTPKA 413
           I VGTGTL+DS+GKGF+S E+ +++ L+PL  T +D E+   ++  IL EL+ +    + 
Sbjct: 358 IDVGTGTLRDSMGKGFMSREN-KSQHLQPLISTLNDTEAAEFNYDRILKELSKAADNIEN 416

Query: 414 FDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLFPSS 473
           FDS+F+KRLG K  YYT+ DRF+N+ EFL  +   IF +F  E+PKAL YLLT+PLFP S
Sbjct: 417 FDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVS 476

Query: 474 HTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDI 533
           HT  LL KLK HPRLFKQA+VTCPNL LDEL+ ELFTV+NDEL LDLSLR+LQ+F K+ I
Sbjct: 477 HTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSI 536

Query: 534 KQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRL 593
           K+ I++ S++D++NF+NFVI ++ + E+R K KP+LFQLLSLV+D+VGL ALE ++L +L
Sbjct: 537 KEAIKQKSKIDVNNFINFVISENFE-EDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKL 595

Query: 594 SAFIDSQVAVADQLVELLYLLENSSTKK--GKHLNSVTRLDESPVAATIPLYSVEYLD 649
           + +ID Q++V  + VEL  L+E  + K   G+ L   +   E  + A    YS+E L+
Sbjct: 596 TKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITA----YSIEQLE 649

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/656 (47%), Positives = 445/656 (67%), Gaps = 17/656 (2%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           MA I+QPFRL+ LPKI SLNNYA QT YLQV D L P               QY+INPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA 120
           KLV+N+PIPSTN+VT CDV+  +   E+W Y L A  KV  LH +  K       +  +A
Sbjct: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEAR-KVSHLH-LATKPMIQDAVSSSNA 118

Query: 121 SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY 180
                FK  LK  VV ++I S  ++++V+L  GLIQT+DY+L+L +++DISY ++  V++
Sbjct: 119 EITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQF 178

Query: 181 FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFG 240
           F D  G D+ FVLC + ++K CYKLFQ+   +E++   ELNS+ILE++ L  +K+ ++FG
Sbjct: 179 FQDGQGNDFFFVLCQLSDEKICYKLFQVR--SESVSCIELNSIILENYTLENAKLCFEFG 236

Query: 241 KLYRLVDS-KMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFLLDLL 299
           KLY L +S ++ +Y LPH QL   + LPF+ KD  VS++ +S+NR+LLT  N I+L+DLL
Sbjct: 237 KLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLVDLL 296

Query: 300 HNAILYERELSNIKFFQLLRAAVIPGTTPGESNR-TFAIGVSTKQGSNPSSALDVVTIAV 358
           +NAIL++++L NIK  QLL  AV+   +  E NR T A+ V+TK G+NP+S LDV+ I V
Sbjct: 297 YNAILFQKDLQNIKAIQLLSTAVVQENS--EDNRKTIALDVTTKNGANPTSYLDVINIDV 354

Query: 359 GTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDD-ESPNIDFAAILAELTSRTTPKAFDSI 417
           GTGTLKD++GKGF+  + ++ + L      DDD E P+ D+  I+ +L      + FDSI
Sbjct: 355 GTGTLKDAMGKGFMVKQKQKLQKLFEESNEDDDVELPSPDYERIIKQLHICKKIENFDSI 414

Query: 418 FYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLFPSSHTKG 477
           F+K L   KEYYT++DRF+N+S+ L  I+D +F  F DE+PKAL YLLTHPLFP  H KG
Sbjct: 415 FFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHAKG 474

Query: 478 LLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGI 537
           LL KLK +PRLFKQA+VTCPN+PLD+LL ELF + N EL  D++LRVLQ++ KE IK GI
Sbjct: 475 LLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGI 534

Query: 538 RELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFI 597
           R++ ++D+ NFL+ ++  +    + +  KPQ+FQL+SL+ID++GL AL+ + L +LS+F+
Sbjct: 535 RKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFV 594

Query: 598 DSQVAVADQLVELLYLLE----NSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649
           D+QV+V  Q +ELL+L E    +SS    K  +S       P++A    Y+V+YL+
Sbjct: 595 DAQVSVVSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISA----YTVDYLE 646

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/660 (47%), Positives = 452/660 (68%), Gaps = 23/660 (3%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           M  ++Q F+LA LP+++SL+N+A QT++LQVAD +EP               QYV+NPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA 120
           KLV +IPIPSTN+VT CDV A SD  E+W YAL A GKV TL+   + + A   E G+++
Sbjct: 61  KLVLSIPIPSTNIVTACDV-ARSDEQEIWCYALQA-GKVCTLNVASKVSHA---ENGVNS 115

Query: 121 SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY 180
             D+  K  +  + V V +    K I+VVL  GLIQ YD+QL+LLHSLD+SY++V + ++
Sbjct: 116 --DDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKF 173

Query: 181 FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAEN-LPITELNSVILEDFALAESKMVYQF 239
           FT+ A  D++F+LC +   K C+KLF+L+    N +PI EL+S+ILEDF+LA SK+ YQ 
Sbjct: 174 FTEGAN-DFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQS 232

Query: 240 GKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFLLDLL 299
           G+LYRL+  ++ VY+LP  QL   V LP V+  D +S++ IS+NR+L+T  NKI+LL+L 
Sbjct: 233 GRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYLLNLT 292

Query: 300 HNAILYERELSNIKFFQLLRAAVIPGTTPGE--SNRTFAIGVSTKQGSNPSSALDVVTIA 357
           HN+IL++REL+++K FQLL++AVI         + +TF IGV TK G NP+S+L++V + 
Sbjct: 293 HNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVD 352

Query: 358 VGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDDES-------PNIDFAAILAEL-TSRT 409
           VGTGTLKDSLGKGF       ++ LKPLF  +D+E+        + DF  I   L  ++ 
Sbjct: 353 VGTGTLKDSLGKGFTVSNEPISQVLKPLFSDEDNEAEDEDNKFEHFDFNQIYQHLEKNKQ 412

Query: 410 TPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPL 469
           +  +FD IF + L  K+E+YTE DRFI + +FL+ ++  I   F +E+PKAL +LLTHPL
Sbjct: 413 SISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPL 472

Query: 470 FPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFT 529
           FP   T  LL +L+ HPRLFKQA+VTCPNLPL ELL ELF++ N ELSLD+SLR+LQ++T
Sbjct: 473 FPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYT 532

Query: 530 KEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDI 589
            + IKQ +R+L+++D+ NF+ FVI  S++ E   ++  QLFQLLSLV+D++GL AL+G +
Sbjct: 533 TDMIKQEVRKLNKIDVQNFIEFVI--SSNDENAIRSSHQLFQLLSLVLDSIGLFALDGVL 590

Query: 590 LHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649
           L RL+ +I  +VA+A++  +L +LL++    +G   +    +  +  A  +P Y+VEYLD
Sbjct: 591 LDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREA--VPKYTVEYLD 648

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/675 (47%), Positives = 435/675 (64%), Gaps = 31/675 (4%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPXXXXXXXXXXXXXXXQYVINPT 59
           M  ++QPFRL  LPKI+SL+N+A Q+ Y+QV D    P               QY++NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PKLVYNIPIPSTNVVTGCDVLAMSDGAE-LWSYALTANGKVHTLHAVLR-KAGAAPQETG 117
           PKL++N PIPSTN+VT C+V      +E  W +A  AN K  TL+ + + +     +E+G
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMAN-KTSTLNLINKNQYQTNEEESG 119

Query: 118 LDASEDEHFKQTLKGRV---VRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTN 174
             A  D       K +    V    +   K+I+VVL  G IQTYD++L+LL+S++++Y N
Sbjct: 120 DSAPSDSSVTSEFKIKADDHVVDIKILNKKKIIVVLKNGKIQTYDFELKLLNSINMAYNN 179

Query: 175 VGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAE--NLPITELNSVILEDFALAE 232
           V  VE+F +  GKD+MFVLCD++N K C KLFQ+N + E  N    EL S ILE+F L  
Sbjct: 180 VRFVEHFHED-GKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLEN 238

Query: 233 SKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFV----RKDDQVSLQAISTNRLLLT 288
           +K  YQFGK Y+L D K+ VYSLP FQ  + + LP +      +  VS + IS NR+LLT
Sbjct: 239 AKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLT 298

Query: 289 CCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPS 348
             NKI+LLDL+HN+IL EREL+++K FQLL+ AV+   T    NRT AIGVSTK GSNP+
Sbjct: 299 VNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVD--TNINQNRTLAIGVSTKFGSNPT 356

Query: 349 SALDVVTIAVGTGTLKDSLGKGF-LSGEHRRTEALKPLFGTDDDES------PNIDFAAI 401
           S+L+++ + VGT T+KDSLGK F  S      ++LK LF  ++D S       N ++  I
Sbjct: 357 SSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKI 416

Query: 402 LAELT-SRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKA 460
             EL  S+     FD IF+K    KKEYYTE DRFI N EFL  I+D IF TF +E+PK 
Sbjct: 417 YKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKT 476

Query: 461 LIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDL 520
             YLLT PLFP   TKGLL +L  HPRLFKQA+VTCPNLPL+ELL ELFT+ N ELSLD+
Sbjct: 477 FTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLDI 536

Query: 521 SLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAV 580
           SLR+LQ++T++ IK+ +++L ++++ NF+ F+I + +D+++   A P LFQLLSLV+D++
Sbjct: 537 SLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDTTNA-PHLFQLLSLVVDSI 595

Query: 581 GLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSST---KKGKHLNSVTRLDESPVA 637
           GL AL+  +L RLS +ID QVA+A    EL +LL+ S+    K  K + S ++   + + 
Sbjct: 596 GLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLK 655

Query: 638 ---ATIPLYSVEYLD 649
                +P YSVEYLD
Sbjct: 656 LQEEVLPKYSVEYLD 670

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/664 (45%), Positives = 436/664 (65%), Gaps = 25/664 (3%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           M   +QPFRLA LPKI SL+N   Q S LQ+AD                   QY+INPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDV---LAMSDGAEL--WSYALTANGKVHTLHAVLRKAGAAPQE 115
            LV+N+PIPSTN VT C++   ++ +DG++L  W+Y L+ N K HTL+  ++ +      
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYN-KNHTLNISIKTSDDDKYA 119

Query: 116 TGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNV 175
           T       E + Q    ++  ++I    K I+VVL  GLIQ YD+ L+LL S+++ Y+++
Sbjct: 120 TS-GGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDI 178

Query: 176 GLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKM 235
             VE+F +  GK +  +L +I+ KK  +KL++L  + +   I EL+S ILED  L ES++
Sbjct: 179 SFVEHFEED-GKQFAIILSNIEGKKISFKLYEL-FTNDKTSINELSSTILEDADLGESQI 236

Query: 236 VYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQ--VSLQAISTNRLLLTCCNKI 293
            YQFGK+YRL + ++Y+Y+LP  QL   + LPF++K D   +S   I+ NR+LLT  NKI
Sbjct: 237 CYQFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKI 296

Query: 294 FLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDV 353
           +LLDL+HN+IL ER+LS++K +QLL++ V+P     ++++T AIGVS K G +P S+L+V
Sbjct: 297 YLLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEV 356

Query: 354 VTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDD-----DESPNIDFAAILAEL-TS 407
           + + VG+GTLKDSLGK F     ++   L+ LF  D+      E  + D+  IL EL  +
Sbjct: 357 INVDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYAKGEQKSFDYKNILQELQNN 416

Query: 408 RTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTH 467
           +     FD IF+K+L   KEYYTE DRFI + +FL+ +LD IF+ F  ++P+AL +LLTH
Sbjct: 417 KNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPRALTFLLTH 476

Query: 468 PLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQE 527
           PLFP SHT+ LL K +  PRLFKQAVVTCPNLPL ELL ELFT+ N EL LD+SLR+LQ+
Sbjct: 477 PLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQD 536

Query: 528 FTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEG 587
           +T++ IKQ ++ LS+VD+ NF+ FVI   TD E++ +  PQLFQLLSLV+DA GL ALE 
Sbjct: 537 YTRDSIKQELKTLSKVDIQNFIEFVI--DTDSEDKSQFNPQLFQLLSLVLDASGLFALEE 594

Query: 588 DILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPL--YSV 645
           + L +LSA+ID+QV VA++   L +LL+ +S K+     ++ + ++  V  T  L  YSV
Sbjct: 595 ETLEKLSAYIDNQVNVAERNNRLWHLLDENSDKRS----TLNQANDQNVLQTKSLSAYSV 650

Query: 646 EYLD 649
           EYL+
Sbjct: 651 EYLE 654

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/671 (45%), Positives = 438/671 (65%), Gaps = 30/671 (4%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           M  I QPFRL+ LP+I +L+NY  Q+ YL+V+  + P               QY++NPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLR--KAGAAPQETGL 118
           KL+ NI IPSTNVV+ CDV  ++D  E+W Y + + GK H L+A ++   A       G 
Sbjct: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKS-GKSHFLNASVKPVDADTVLDTDGG 119

Query: 119 DASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLV 178
           D +ED  FK  +  +VV ++I+   K I+VVL+ GLIQ YD+QLQ L SLDISY NV +V
Sbjct: 120 DKTED--FKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVV 177

Query: 179 EYFTDSAGKDYMFVLCDIQNKKTCYKLFQL--NHSAENLPITELNSVILEDFALAESKMV 236
            YF+++ G+++MFVL   +N K C+KLF+L  +    + PI EL++ ILE+F L +SK+ 
Sbjct: 178 NYFSEN-GQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLC 236

Query: 237 YQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFV--RKDDQVSLQAISTNRLLLTCCNKIF 294
           YQ GKLY+L  S +  Y+LP   L     LP +      +VSL  +STNR+LLT  N+++
Sbjct: 237 YQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVY 296

Query: 295 LLDLLHNAILYERELSNIKFFQLLRAAV--IPGTTPGE--SNRTFAIGVSTKQGSNPSSA 350
           LLDL+H+++L ER L++ K FQLLR+A   +  +  G   + RT AIGV+TK G+NP+SA
Sbjct: 297 LLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSA 356

Query: 351 LDVVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDD-DESPNID--------FAAI 401
           L+V+ + VGTGTLKDSLGK F S    +T  L+PLF  D+ D   N D        +  I
Sbjct: 357 LEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDI 416

Query: 402 LAELT-SRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKA 460
             EL+ +  +   FDS F KRL  ++E+YT+ +RFI + EFL+ ++  I  +F  E+P+A
Sbjct: 417 FKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRA 476

Query: 461 LIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDL 520
           L +LLTHPLFP+  T+GLL + + HPRLFKQA+VTCPNLPLD+LL ELF++ N EL LD+
Sbjct: 477 LTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDI 536

Query: 521 SLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAV 580
           SLR+LQ+FT + IK  +++L++VD+HNF+NF+I    +   + K+  +LFQLLSLVIDA+
Sbjct: 537 SLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAI 596

Query: 581 GLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGK--HLNSVTRLDESPVAA 638
           GL AL+G +L RLS +ID QV +A++   L  LL+  +  +G    L   +R  E     
Sbjct: 597 GLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQ---- 652

Query: 639 TIPLYSVEYLD 649
           T+P Y+VEYL+
Sbjct: 653 TLPKYTVEYLE 663

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  525 bits (1353), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 315/722 (43%), Positives = 438/722 (60%), Gaps = 98/722 (13%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVA-DVLEPXXXXXXXXXXXXXXXQYVINPT 59
           M  ++QPFRLA LPKI+SL+NY+ QT YLQVA D                   QY+INPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PKLVYNIPIPSTNVVTGCDV--------------------LAMSDG-------------- 85
           PKL++NI IPSTN VT  ++                    L   D               
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 86  -----AELWSYALTANGKVHTLHAVLRKAG-----AAPQETGLDASEDEHFKQTLK--GR 133
                 ELW+Y L AN K +TL+  ++  G       P E           K+T+K   +
Sbjct: 121 VTKRSVELWAYGLVAN-KSNTLNISVKTTGLDEFSTTPGEIIR--------KKTIKVDSK 171

Query: 134 VVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVL 193
           VV ++I    K I+VVL  GL++ +D+ L L  SLDI+Y +V  V++FT+S  ++++ +L
Sbjct: 172 VVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESK-QNFLLIL 230

Query: 194 CDIQNKKT--CYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMY 251
            +I  +K+  C+KL+QL   +++  ++EL+  IL+DF L++SK+ YQFGKLYRL  S+++
Sbjct: 231 SNIDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELF 290

Query: 252 VYSLPHFQLSHCVPLP--FVRKDDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYEREL 309
           VYSLP  QL   + L   F    D  S++ ++ NRL+L   N ++L+D LH +IL ERE 
Sbjct: 291 VYSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREF 350

Query: 310 SNIKFFQLLRAAVIPGTTPGESN---RTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDS 366
           +++K FQLL++A I     G+SN   RT AIGVSTK G   +SAL+++ I VG+GTLKDS
Sbjct: 351 THVKTFQLLQSATI-----GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDS 405

Query: 367 LGKG----FLSGEHRRTEALKPLFGTDDDES------------PNIDFAAILAELTSRTT 410
           LGKG       G H     LKPLF  +D++S             + +F  ILA+L S  T
Sbjct: 406 LGKGVSKKLSEGSHSD---LKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDT 462

Query: 411 PKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLF 470
              FD  F++ L  K+ +YTE+DRFI++ +F+A  +D IF  F  EFPKA  +LLTHPLF
Sbjct: 463 ISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLF 522

Query: 471 PSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTK 530
           P   T GLL KLK HPRLFKQA+VTCPNLPL ELL +LFTV N EL+LD+SLRVLQ++++
Sbjct: 523 PIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSR 582

Query: 531 EDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDIL 590
            D+KQ I++L  VD+ NF+ F+I  +T  EE Q   PQLFQLLSLV+D++GL AL+G +L
Sbjct: 583 NDVKQEIKKLDNVDIENFIEFIITPTT--EEIQTNTPQLFQLLSLVLDSIGLFALKGPLL 640

Query: 591 HRLSAFIDSQVAVADQLVELLYLLENSSTK---KGKHLNSVTRLDESPVAATIPLYSVEY 647
            RLS +I+ QV +A++  EL +LL+ S+T    K  +L SV    E     T+ +YSV+Y
Sbjct: 641 ERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKE-----TLSVYSVDY 695

Query: 648 LD 649
           LD
Sbjct: 696 LD 697

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  511 bits (1316), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/720 (41%), Positives = 445/720 (61%), Gaps = 79/720 (10%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADV-LEPXXXXXXXXXXXXXXXQYVINPT 59
           M  ++QPFRLA LPKI+SL+N++ Q  Y+QVAD                    QY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVYNIPIPSTNVVTGCDVL----------AMSDG---------------AELWSYALT 94
           PKL ++ PIPSTN++T C+ +            SD                 E+WS+ L 
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 95  ANGKVHTLHAVLR-------KAGAAPQETGLD----ASEDE---HFKQTLKGRVVRVRIL 140
            N   +TL+ + +        +     E G D    A  D+    +K   K +V+ ++I 
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 141 SACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNKK 200
           +    ++ VL  GL++ YD++L+LLHS DISY N+   ++FT++ G +++FVLC +++ K
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTEN-GTEFVFVLCPLEDDK 239

Query: 201 TCYKLFQLN--HSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHF 258
            CYKLF+L+     E+ PI EL+S I+E F+   SK  YQFGKLY+L   K++VYSLPH 
Sbjct: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299

Query: 259 QLSHCVPLPFVRK----DDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKF 314
           QL   + +P + K    +D +S Q +S NR+LLT  N I+LLDLLH +IL +REL++++ 
Sbjct: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359

Query: 315 FQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSG 374
           FQLLR+AVI  +   ++++T AIG+STK G NP+S+L+++ I VGT TLKDSLGK F  G
Sbjct: 360 FQLLRSAVI-DSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIG 418

Query: 375 EHRRTEA-LKPLFGTDDDES-----------------PNIDFAAILAELTS--RTTPKAF 414
           ++  +   LKPLF   DDE+                 P   +  I+ ++++       +F
Sbjct: 419 KNDTSSVVLKPLF---DDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASF 475

Query: 415 DSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATF-ADEFPKALIYLLTHPLFPSS 473
           D IF+K L  K+E+YTE DRFI++SEFL  +LD IF  F  +++PKAL +LLTHPLFP +
Sbjct: 476 DDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLN 535

Query: 474 HTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDI 533
            T  LL +L+  PRLFKQA+VTCPNLPL+ELL ELF++ N EL LD+S R+LQ+FT++ I
Sbjct: 536 RTHNLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSI 595

Query: 534 KQGIRELSRVDLHNFLNFVI---KDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDIL 590
           KQ ++ LS++D+ NF++F+    +DST          QLFQLLSLV+D++GL +LEG +L
Sbjct: 596 KQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALL 655

Query: 591 HRLSAFIDSQVAVADQLVELLYLLENSSTKKG-KHLNSVTRLDESPVAATIPLYSVEYLD 649
             L+++ID QV +A++  EL  L+E   ++ G  ++NS +R  +      +P Y++EYL+
Sbjct: 656 DNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQ---KQALPTYTMEYLE 712

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  507 bits (1305), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 305/712 (42%), Positives = 439/712 (61%), Gaps = 76/712 (10%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVA-DVLEPXXXXXXXXXXXXXXXQYVINPT 59
           M  ++QPFRL  LPKI+SL+NY+ Q  Y+QV      P               QY+INPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PKLVYNIPIPSTNVVTGCDVLAMSDGAE---LWSYALTANGKVHTLHAVLRKAGAAPQET 116
           PKL++N PIPSTN+VT CDVL   +      +W + L AN K +TL  + +    +    
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVAN-KTYTLTLITKDKQKSSATM 119

Query: 117 GLDASEDEHFKQTLKGRVVRVRILSACK------------RIMVVLDCGLIQTYDYQLQL 164
             D    +    T+K     V++ S                IM+VL+ GLIQ ++  L+L
Sbjct: 120 EDDEDVVDVIDTTIKDEF-NVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKL 178

Query: 165 LHSLDISYTNVGLVEYFTDSAGKDYMFVLCDI-QNKKTCYKLFQLNHSAENLPITELNSV 223
           L+++ I+Y NV  VE+F +   KD+MF +CD+  N K C KLFQ+N+ +      ELNS+
Sbjct: 179 LNTVKINYKNVKFVEHFKED-NKDFMFTICDLGDNNKVCIKLFQINNDSA----IELNSI 233

Query: 224 ILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQ-VSLQAIST 282
           I+E+F    +K  YQFGK Y+L ++ + VYSLP FQL H   +P ++ DDQ VS++ IST
Sbjct: 234 IMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPIST 293

Query: 283 NRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESN-RTFAIGVST 341
           NR+LLT  NKI+LLDL+HN+IL EREL+++K  QLLR+AVI     GE+N +T  IGVST
Sbjct: 294 NRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIG---KGENNNKTITIGVST 350

Query: 342 KQGSNPSSALDVVTIAVGTGTLKDSLGKGF--LSGEHR---RTEALKPLF--GTDDDESP 394
           K G NP+S+L+++ + VG+ TLKDSLGK F  L+ +++    T+ALKPLF   TD D+  
Sbjct: 351 KFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDD 410

Query: 395 NI----------DFAAILAELTSRTTP-KAFDSIFYKRLGPKKEYYTEHDRFINNSEFLA 443
           ++          ++  IL +L+  T     FD IF++    KKE+YTE+DRFI N EF  
Sbjct: 411 DLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFL 470

Query: 444 GILDHIFATFA--------DEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVT 495
            ++D IF  F         +E+PK L +LLTHPLFP   T+ LL +   HPRLFKQA+VT
Sbjct: 471 KLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVT 530

Query: 496 CPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKD 555
           CPNLPL ELL+EL T+ N+ELSLD+SLR+LQ+++K+ IKQ +R L R+++ NF++F++ D
Sbjct: 531 CPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILND 590

Query: 556 STDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLE 615
             ++++ Q + PQLFQLL+LV+D++GL AL  +IL  LSA+ID QV++ ++  EL YL++
Sbjct: 591 --EIKDDQNS-PQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLID 647

Query: 616 NSST--KKGKHLNSVTRLDESPV----------------AATIPLYSVEYLD 649
           +++      K  NS +    S                     +P+YSV+YL+
Sbjct: 648 SNNNIFSHNKKDNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLE 699

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  504 bits (1298), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 286/660 (43%), Positives = 405/660 (61%), Gaps = 20/660 (3%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           M  ++QPFRLA LPKI+ L++Y  Q+  LQVAD                   QYVINPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAMSDGA-----ELWSYALTANGKVHTLHAVLRKAGAAPQE 115
            +   +PIPSTN VT C+V    D       E+W Y L  N K +TLH  ++     P +
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKK-NTLHVAIKTVD--PDK 117

Query: 116 TGLDASED-EHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTN 174
                S+  E +       VV ++I    K I+V L  G IQ +D++L+LL+S++ SY N
Sbjct: 118 FSTTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDN 177

Query: 175 VGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESK 234
           +   E+F ++  K +  +L  I+  K  YKL++L    +   I EL+S ILED    +SK
Sbjct: 178 IYFSEHFVENK-KSFAIILSTIEGNKLSYKLYEL-FGQDKTSIKELSSTILEDIQCKDSK 235

Query: 235 MVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFV--RKDDQVSLQAISTNRLLLTCCNK 292
           + YQFGKLYRL  ++M+VYSLP  QL   + LP +  +K   +S + +S NR+LLT  NK
Sbjct: 236 ISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNK 295

Query: 293 IFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALD 352
           IF+LDL+H A L ER L ++K FQLL++ VI       +++T AIGVS K G +P +AL+
Sbjct: 296 IFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALE 355

Query: 353 VVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDDESPNIDFA--AILAELTSRTT 410
           ++   VGTGTLKDSLG  F   +  ++  L+PLF  D +     DF   AIL +L+S   
Sbjct: 356 IINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTEN 415

Query: 411 P-KAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPL 469
             K FD IF+  L  ++ YYT+++RFI +  FL+ ++D IF  F  E+P AL +LLTHPL
Sbjct: 416 DIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPL 475

Query: 470 FPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFT 529
           FP   TK LL KL+ HPRLFKQAVVTCPNLP+DELL ELF++ N ELS+D+SLR+LQ++T
Sbjct: 476 FPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYT 535

Query: 530 KEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDI 589
           K+ IK  ++ L+++D+ NF++FVI  +   EE +K   QLF LLSLV+DA GL ++EG +
Sbjct: 536 KDSIKLELKNLNKIDIQNFIDFVIDPNN--EEEKKHNEQLFVLLSLVLDASGLFSIEGPL 593

Query: 590 LHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649
           L +LS +ID QV + ++  +L +L++ +  K+  H    T     P    +  YSVEYL+
Sbjct: 594 LTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQ--TSGATVPEIKALTAYSVEYLE 651

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  502 bits (1293), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 293/710 (41%), Positives = 430/710 (60%), Gaps = 67/710 (9%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPXXXXXXXXXXXXXXXQYVINPT 59
           M  ++QPFRLA LPKI+SL+N++ Q +Y+QVAD                    QY+INPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PKLVYNIPIPSTNVVTGCDV----LAMSD--------------GAELWSYALTANGKVHT 101
           PKL+++ PIPSTN++T C+     + + D                E+WS+ L  N   +T
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 102 LHAVLRKAGAAPQETGLDASEDE--------------HFKQTLKGRVVRVRILSACKRIM 147
           L+ + +        T  +  E++               +K   K +V+ ++I +    I+
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 148 VVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQ 207
            +L  GLI+ YD++L+LLHS DISY N+   ++FT++ G +++FVLC +Q+ K CYKL +
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTEN-GIEFIFVLCPLQDDKVCYKLLE 239

Query: 208 LN--HSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVP 265
           L    + EN PI EL+S I+E F+  +SK+ YQFGKLY+L   K+YVYSLPH QL   + 
Sbjct: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIE 299

Query: 266 LPFVRKDD----QVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAA 321
           LP +   D     +S Q +S NR+LLT  N ++LLDLLH + L +RELS++K FQLL  A
Sbjct: 300 LPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTA 359

Query: 322 VIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHRRTEA 381
           VI  +    S++T AIG+STK G+NP+S+L+++ I VGT TLKDSLGK F + +   +  
Sbjct: 360 VI-NSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVI 418

Query: 382 LKPLFGTDDDES----------------PNIDFAAILAELTSRTTPK--AFDSIFYKRLG 423
           LKPLF  DD+E                 P   +  I+ +L++  +    +FD IF+K L 
Sbjct: 419 LKPLF--DDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLK 476

Query: 424 PKKEYYTEHDRFINNSEFLAGILDHIFATF-ADEFPKALIYLLTHPLFPSSHTKGLLPKL 482
            K+E+YTE DRFI++  FL  +LD IF  F  +++PK L +LLTHPLFP   T+ LL  L
Sbjct: 477 IKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLL 536

Query: 483 KAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSR 542
           +  PRLFKQA+VTCPNLPL+ELL ELF++ N EL LD+S R+LQ+FT++ IKQ ++ LS+
Sbjct: 537 RDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSK 596

Query: 543 VDLHNFLNFVIKDSTDVEER---QKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDS 599
           +D+ NF+ F+     D            QLFQLLSLV+D++GL +LEG +L  L+++ID 
Sbjct: 597 LDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDK 656

Query: 600 QVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649
           QV +A++  EL  L++  S++ G    ++     S     +P Y++EYLD
Sbjct: 657 QVKIAERNTELWNLIDIKSSQHG--FTNLAFESASSQKQALPTYTMEYLD 704

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  497 bits (1280), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 297/717 (41%), Positives = 431/717 (60%), Gaps = 73/717 (10%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPXXXXXXXXXXXXXXXQYVINPT 59
           M  ++QPFRLA LPKI+SL+N++ Q  Y+QVAD                    QY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVYNIPIPSTNVVTGCDV---LAMSDG-----------------------AELWSYAL 93
           PKL ++ PIPSTN++T C+     A  DG                        E+W++ L
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 94  TANGKVHTLHAVLRKAGAAPQETGLD------------ASEDE---HFKQTLKGRVVRVR 138
             N   +TL+ V+ KA     +T  D               DE    +K   K +V+ ++
Sbjct: 121 MVNKGNYTLN-VITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIK 179

Query: 139 ILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQN 198
           I +    ++ +L  GLI+ +D++L LLHS DISY N+   ++FT++ G +Y+FVLC +Q+
Sbjct: 180 IDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTEN-GTEYVFVLCPLQD 238

Query: 199 KKTCYKLFQLNH--SAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLP 256
            K CYKL +L    S E+ PI EL+S I+E F+   SK+ YQFGKLY+L   K+Y+YSLP
Sbjct: 239 DKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLP 298

Query: 257 HFQLSHCVPLPFVRK----DDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNI 312
           H QL   +  P V K    DD +S Q +S NR+LLT  N I+LLDLLH + L +REL+++
Sbjct: 299 HCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHV 358

Query: 313 KFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFL 372
           K FQLL++AVI  +    +++T AIG+STK G NP+S+L+++ I VGT TLKDSLGK F 
Sbjct: 359 KTFQLLKSAVI-NSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417

Query: 373 SGEHRRTEALKPLFG--------------TDDDESPNIDFAAILAELTS--RTTPKAFDS 416
            G +  +  LKPLF               + D   P +    ++ +L++       +FD 
Sbjct: 418 VGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDD 477

Query: 417 IFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFA-DEFPKALIYLLTHPLFPSSHT 475
           IF+K L  K+E+YTE DR+I++  FL  +LD IF  F+ +++PK L +LLTHPLFP S T
Sbjct: 478 IFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRT 537

Query: 476 KGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQ 535
           + LL  L+  PRLFKQA+VTCPNLPL+ELL ELF++ N EL LD+S R+LQ+FT++ IKQ
Sbjct: 538 RNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQ 597

Query: 536 GIRELSRVDLHNFLNFVI---KDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHR 592
            +++LS++D+ NF+ F+    +DS+          QLFQLLSLV+D++GL +LEG +L  
Sbjct: 598 EMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLEN 657

Query: 593 LSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649
           L+ +ID QV +A++  EL  L++    + G    S T  + +     +P Y++EYLD
Sbjct: 658 LTLYIDKQVEIAERNTELWNLIDTKGFQHG--FASSTFDNGTSQKRALPTYTMEYLD 712

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  491 bits (1264), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 297/720 (41%), Positives = 433/720 (60%), Gaps = 79/720 (10%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPXXXXXXXXXXXXXXXQYVINPT 59
           M  ++QPFRLA LPKI+SL+N++ Q  Y+QVAD                    QY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVYNIPIPSTNVVTGC-----------DVLAMSDGA---------------ELWSYAL 93
           PKL ++ PIPSTNV+T C           D+   +D +               E+WS+  
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 94  TANGKVHTLHAVLRKAGAAPQ-------ETGLD----ASEDEHFKQ---TLKGRVVRVRI 139
             N   +TL+   +   +          E  +D    A  D+   Q     K +V+ ++I
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 140 LSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNK 199
            +    I+ VL  GLI+ YD +L+LL+S DISY N+   ++FT++ G D++FVLC +++ 
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTEN-GTDFVFVLCPLEDD 239

Query: 200 KTCYKLFQLN--HSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPH 257
           K CYK+ +L+   S +N PI EL+S I+E F+   SK+ YQFGKLY+L   K+YVYSLPH
Sbjct: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299

Query: 258 FQLSHCVPLPFVRK----DDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIK 313
            QL   + LP + K    DD +S Q +S NR+LLT  N I+LLDLLH +IL  REL+++K
Sbjct: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359

Query: 314 FFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLS 373
            FQLL++A+I  +    +++T AIG+STK G NP+S+L+++ I VGT TLKDSLGK F  
Sbjct: 360 TFQLLKSALI-DSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQV 418

Query: 374 GEHRRTEALKPLFGTDD---------DESPNID-----FAAILAELT--SRTTPKAFDSI 417
           G++  +  LKPLF  +D         D   NI+     +  ++ +L+        +FD I
Sbjct: 419 GKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEI 478

Query: 418 FYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFA-DEFPKALIYLLTHPLFPSSHTK 476
           F+  L  K+E+YTE DRFI++  FL  +LD IF  F  +++PKAL +LLTHPLFP + T 
Sbjct: 479 FFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTH 538

Query: 477 GLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQG 536
           GLL  L+  PRLFKQA+VTCPNLPL+ELL ELF++ N EL LD+S RVLQ+FT++ IKQ 
Sbjct: 539 GLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQE 598

Query: 537 IRELSRVDLHNFLNFVIKDSTDVEE-------RQKAKPQLFQLLSLVIDAVGLLALEGDI 589
           +++LS++D+ NF+  +    T+ EE             QLFQLLSLV+D++GL +LEG +
Sbjct: 599 MKKLSKLDIQNFIECI----TNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGAL 654

Query: 590 LHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649
           L  L+ +ID QV +A++  EL  L++   ++ G    +++    +     +P Y++EYLD
Sbjct: 655 LENLTLYIDKQVKIAERNTELWNLIDIKGSQHG--FATLSSGSTTSQKQALPAYAMEYLD 712

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  485 bits (1249), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/694 (39%), Positives = 434/694 (62%), Gaps = 62/694 (8%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           M  ++QPFRLA LPKI+SL+N++Q+ +Y++VAD   P               +YVI PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVLAMSDGA------------------------------ELWS 90
           +L++N+PIPST++V+ C++   S+ +                              E+W 
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 91  YALTANGKVHTLHAVLRKAGAAPQETGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVL 150
           YAL+AN K HTL+ ++R+       T +    +  F    K +++ + + +  K I+++ 
Sbjct: 121 YALSANNKTHTLNCLIREVDN--NNTSI-TENNPQFNAKFKEQIINIEVDTKHKVIVILF 177

Query: 151 DCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNH 210
           + GL+Q YD QL+LL+S++  Y ++ +V+ F ++ G +YM ++ D++++K   +L+++  
Sbjct: 178 ETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEEN-GLEYMLLISDLKDQKVALQLYEV-- 234

Query: 211 SAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVR 270
           S E   + EL S I+E+F L +S + YQFG++YRL   ++ VYS+P  QL+  V +PF+ 
Sbjct: 235 STEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLS 294

Query: 271 ----KDDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGT 326
               K+  +SL+ I+TNR+LLT  NKI+LLDLLH +IL ERE+S++K FQ+L+ A+    
Sbjct: 295 EIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAM--NR 352

Query: 327 TPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLF 386
              ES  T A+G+STK G NP+SAL+++ I VG+ +LKDSLGK FL   ++    LK LF
Sbjct: 353 DGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLF 412

Query: 387 GTDDDESPNIDFAAILAELTSRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGIL 446
                E P+I+F  IL +L +  + + FD  F+  L  K+E +TE+ RF+N+  FLA +L
Sbjct: 413 PEPKYELPSINFPEILGKLKNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVL 472

Query: 447 DHIFAT--FADEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDEL 504
           D IF    +    P++L++LLTHPLFP     GLL K+K++ RLFKQA+VTCPNLPL EL
Sbjct: 473 DLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNLPLQEL 532

Query: 505 LHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQK 564
           L ELFT+ N EL +D+S+R+LQ++TK+ IK+ I++L +V + NF+NF+IK    +  R+ 
Sbjct: 533 LQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIK----MNNREA 588

Query: 565 A-------KPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENS 617
           A        PQ+F+LLSL++D++GL  LE  IL +LS+ I+ +V +A++ VEL  +++  
Sbjct: 589 AVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIMDAK 648

Query: 618 --STKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649
             S KK     + ++L E+   +  P Y VEY+D
Sbjct: 649 MLSVKKSSS-TAASKLAEN---SQTP-YIVEYID 677

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/379 (52%), Positives = 268/379 (70%), Gaps = 11/379 (2%)

Query: 275 VSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRT 334
           +S   IS NR LLTC NK++LLDLLHNAIL +RE +++K FQLL  AVIPG +   +N T
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNS-SSNNST 59

Query: 335 FAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGT-DDDES 393
            AIGV+TK G+  +S+LDVV I VGTGTLKDS+GKGFLS +  + +  + L GT +D E 
Sbjct: 60  IAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSK-TKVQCPQSLLGTPNDTEV 118

Query: 394 PNIDFAAILAELT-SRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFAT 452
              ++  IL +L  +++    FDS+F+K+L  K +YYT+ DRF+N+ EFL   L  IF  
Sbjct: 119 QEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFEN 178

Query: 453 FADEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVL 512
           F  E+PKAL YLLTHPLFP + T  LL KLK HPRLFKQA+VTCPNLPL +LL ELFTV+
Sbjct: 179 FQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVI 238

Query: 513 NDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQL 572
           NDEL LDLSLR+LQ+F+K+ IK  I++ S+VD++ F+NFV+ ++ D E+R K KP+LFQL
Sbjct: 239 NDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVD-EDRVKNKPRLFQL 297

Query: 573 LSLVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTKK--GKHLNSVTR 630
           L+LV+D+VGL ALE + L +LS +ID Q++V  Q V+L  L++  + K   G+H      
Sbjct: 298 LNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNFKNILGQHHADSLS 357

Query: 631 LDESPVAATIPLYSVEYLD 649
           + E  + A    YSVE L+
Sbjct: 358 VGEGAITA----YSVEQLE 372

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  308 bits (790), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 223/678 (32%), Positives = 350/678 (51%), Gaps = 99/678 (14%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPXXXXXXXXXXXXXXXQYVINPT 59
           M  I+QPF +  +PK SS       TS + V+   L                 ++VINPT
Sbjct: 1   MPSISQPFAITTVPKQSS-------TSPIIVSSHSLTANSNSLDVAISKYAVSKFVINPT 53

Query: 60  PKLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLD 119
           PKL+ +IPIPS  VVT       +       Y L  NGK                     
Sbjct: 54  PKLINSIPIPSNEVVTAFHDTVFATATVNQKYTLHLNGK--------------------- 92

Query: 120 ASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVE 179
                  K  ++ ++++  + S   + + +L+ G I+ YD  L +  +    + ++  VE
Sbjct: 93  -------KVPIQSKIMK--LFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVE 142

Query: 180 YFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQF 239
           +       +  + L   QN      L+ +N   E   +  +  ++  DF   + K+ YQF
Sbjct: 143 FI------ESKYALLISQN---SISLYDINTMIELRNVANVQDIVDSDFKSLDGKL-YQF 192

Query: 240 GKLYRLVDSKMYVYSLPHFQLSHCVPLPFVR--KDDQVSLQAISTNRLLLTCCNKIFLLD 297
            +      SK  ++ +    + + + +PF+   + D VS   +  N +++   + I+ L+
Sbjct: 193 NQKL----SKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYALN 248

Query: 298 LLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIA 357
           L  ++++   EL N+K+F+L+            SN+ F +G+S    +N +   +++ + 
Sbjct: 249 LHLSSVISMSELLNLKWFKLIDNL---------SNQ-FVLGLS---FNNENYKFELINLD 295

Query: 358 VGTG-TLKDSLGKGFLS-----GEHRRTEALKPLFGTDD-----------DESPNIDFAA 400
           + +   LKDSLGKGF +        + T  LK LF  D+           D     ++  
Sbjct: 296 LNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNYDK 355

Query: 401 ILAELTSRT-TPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHI-----FATFA 454
           I+ +L      P  FD IF+++   KKE+YTE DRF+ N +FLA +++ I     F T  
Sbjct: 356 IIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDTDG 415

Query: 455 DEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLND 514
           + +PK L YLLTHPLFP S TK LLPK +  PRL+KQA+VTCPNLPL ELL +LFT+ N+
Sbjct: 416 NNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENN 475

Query: 515 ELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLS 574
           ELSLD+SLRVLQ++TK+ IK+ I+ L +VD+ NF+ FV +D     E Q+   QLFQLLS
Sbjct: 476 ELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQD-----EDQQVSSQLFQLLS 530

Query: 575 LVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNS---VTRL 631
           L+ID++GL AL+ DIL R+S FI+ +  VA Q  ELL+LL+ + +K+     S   +   
Sbjct: 531 LIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLINNN 590

Query: 632 DESPVAATIPLYSVEYLD 649
           ++S    T+P Y+VE+LD
Sbjct: 591 NKSLHRKTLPTYTVEHLD 608

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  299 bits (765), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 224/637 (35%), Positives = 325/637 (51%), Gaps = 79/637 (12%)

Query: 2   AYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTPK 61
           A I+QPF +AN+P+       A QT  L     L                 QY+INPTPK
Sbjct: 3   ASISQPFTIANVPR------QASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 62  LVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDAS 121
           LV +  IPS   VT  D     +G     YA  +N K   L+                  
Sbjct: 57  LVNSKAIPSNLTVTAFD-----NGV----YATQSNNKSFCLYL----------------- 90

Query: 122 EDEHFKQTLKGRVVRV---RILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLV 178
            DE  +  LK  VV     +I         +L  G +Q Y    Q+  +  +   ++  V
Sbjct: 91  -DESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVF-AKHLPLKDIKQV 148

Query: 179 EYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQ 238
           E+       D  + L         Y+L       ENL  TEL   +       + K + Q
Sbjct: 149 EFI------DGQYALIVAAQSTALYEL-------ENL--TELR--VSTTLHFEQFKQIRQ 191

Query: 239 -FGKLYR--LVDSKMYVYSLPHFQLSHCVPLPFVR--KDDQVSLQAISTNRLLLTCCNKI 293
             GK+Y+  L  +   ++ L        V +PF+   K   ++   +  +R+ L   N+I
Sbjct: 192 HLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEI 251

Query: 294 FLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDV 353
           +LLDL   ++L     S+ KF QL +  +I G   G    +FAI +S     N  S LD+
Sbjct: 252 YLLDLHLGSVL-----SHNKFAQLKQVELIAGARDG----SFAIALSHGPQDNAVS-LDI 301

Query: 354 VTIAVGTGTLKDSLGKGFLS--GEHRRTEA---LKPLFGTDDDESPNIDFAAILAELTSR 408
           + + +G+ ++KDSLGKGF +   E R  E+   L+P+    D    + D+A+IL +LT+ 
Sbjct: 302 INLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYASILKKLTAA 361

Query: 409 TT-PKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADE----FPKALIY 463
              P  FD IF+K L   +E YTE DRFI +  FL+  +  I   ++ E    +P A  Y
Sbjct: 362 AKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTY 421

Query: 464 LLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLR 523
           LLTHPLFP+  T+ LL K+K  PRL+KQ +VTCPNLPLDELL E F + N+ELSLDLSL+
Sbjct: 422 LLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLK 481

Query: 524 VLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLL 583
           +LQ++TK+ IK+ ++ L RV++ NF+ FVI +  + +E   A PQLFQLLSLVID++GL 
Sbjct: 482 ILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGLF 541

Query: 584 ALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTK 620
           AL+G++L  L+ +ID+ V +A+   EL  LLE  + K
Sbjct: 542 ALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNK 578

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  175 bits (444), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 96/215 (44%), Positives = 126/215 (58%), Gaps = 10/215 (4%)

Query: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPXXXXXXXXXXXXXXXQYVINPTP 60
           M  I+QPFRL  LPKI+SLNNYA Q SYLQVAD L P               QYVINPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  KLVYNIPIPSTNVVTGCDVL--------AMSDGAELWSYALTANGKVHTLHAVLRKAGAA 112
           KLVYN+PI STNVVT CDV           ++  E+  YAL AN K  ++ AV +   +A
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQAN-KTFSICAVKKPIPSA 119

Query: 113 PQETGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISY 172
             ++    +   H K  L  + V V++  A K I+ VL  GLIQ +DY L+L HS+D SY
Sbjct: 120 ATDSSFGETYATH-KVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSY 178

Query: 173 TNVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQ 207
            NV  V++F   + +D+MF+L D+  +K  +KL +
Sbjct: 179 GNVQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {ON}
           weakly similar to uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 774

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 96  NGKVHTLHAVLRKAGAAPQETGLDASEDEHFKQTLKGRVVRV 137
           +G++   H    KA   P E GL+  +    K+ L+ R+VRV
Sbjct: 682 DGRLKIFHKAAPKAALKPPEDGLEKKDTSWIKEVLRARIVRV 723

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 167 SLDISYTNVGLVEYFTDSAGKDYMF-----VLCDIQNKKTCYKLFQLNHS-AENLPITEL 220
           SL ++Y   GL+  F+ +   D+          D   KK CY  F+  H   E++  T+L
Sbjct: 209 SLIVTYMGAGLIS-FSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDL 267

Query: 221 NSVILEDFALAESKMVYQFGKLYR 244
           N      F++ ESK+    G L R
Sbjct: 268 NGPKHPIFSVVESKLSEDIGLLMR 291

>CAGL0I08415g Chr9 (820773..824699) [3927 bp, 1308 aa] {ON} some
           similarities with uniprot|Q06211 Saccharomyces
           cerevisiae YPR164w KIM3 drug resistance
          Length = 1308

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 10/156 (6%)

Query: 173 TNVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPI--TELNSVILEDFAL 230
           T + LV    +    +++  +C I +  +   +  L  S E+L I  T  N+ I  D  L
Sbjct: 636 TKINLVTSDNEIMNFEHITKICAILDTSSNDDIALLVLSLESLKIFKTSTNTAICVDTKL 695

Query: 231 AE---SKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLL 287
                S MV     +    ++++Y Y L +++L  C              + +  NRLLL
Sbjct: 696 LNEFPSDMVTLGSTVVLFYETRIYAYKLDNYKLRDCKYTSIDNLIGGFKFKKVDNNRLLL 755

Query: 288 TCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVI 323
               K++LLD+ ++  + E     I+ F+ L+  +I
Sbjct: 756 YGSKKLYLLDIQNDLTIEE-----IEVFENLKNDII 786

>TPHA0A00460 Chr1 complement(72464..73585) [1122 bp, 373 aa] {ON}
           Anc_3.45 YOL126C
          Length = 373

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 424 PKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPL 469
           P+K   T  D FI N+E ++G+ D+I A + D   K  I L+++P+
Sbjct: 108 PRKPGMTRDDLFIKNAEIISGLADNI-AAYCD-MSKIFILLISNPV 151

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 5/83 (6%)

Query: 167 SLDISYTNVGLVEYFTDSAGKDYM----FVLCDIQNKKTCYKLFQL-NHSAENLPITELN 221
           SL  +Y   GL+ +  +      M        D   KK CY  F+  N   E +   +LN
Sbjct: 209 SLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLN 268

Query: 222 SVILEDFALAESKMVYQFGKLYR 244
              L  F++ ESK+  + G L R
Sbjct: 269 GSKLPVFSVVESKLSEEIGLLIR 291

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
           complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 42/86 (48%), Gaps = 17/86 (19%)

Query: 308 ELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVG-------T 360
           EL+N K +   +  V  G   GESN T  IG +   GS  S+ +D ++  +G       +
Sbjct: 8   ELNNFKSY---KGVVNVGF--GESNFTSIIGPN---GSGKSNMMDAISFVLGVQSSHLRS 59

Query: 361 GTLKDSLGKGFLSG--EHRRTEALKP 384
             LKD + +GFLSG  E    E + P
Sbjct: 60  NVLKDLIYRGFLSGDDEDNNNEDVNP 85

>Ecym_6232 Chr6 complement(433068..435023) [1956 bp, 651 aa] {ON}
           similar to Ashbya gossypii AER342C
          Length = 651

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 65/180 (36%), Gaps = 46/180 (25%)

Query: 369 KGFLSGEHRRTEALKPLFGTDDDESPNIDFAAILAELTSRTTPKAFDSIFYKRLGPKKEY 428
           +G L  E      ++ L+GT             +    SR+  K  ++ F  R+   KEY
Sbjct: 416 EGLLQQEQNNETEMRNLYGT-------------MQWNLSRS--KELNATFKNRISKIKEY 460

Query: 429 YTEHDRFINNSEFLAGILDHIFATFADEFPKA-------------LIYLLTHPLFPSSHT 475
            T+     N +  L  ++D    T   + P++               Y   H +   S T
Sbjct: 461 ITQGREITNETTKLLNMIDKKIVTTEIKLPESDDPIVRKVGKVTKERYDYIHNIEQKSLT 520

Query: 476 KGLLPKL----------------KAHPRLFKQAV--VTCPNLPLDELLHELFTVLNDELS 517
             +LPKL                  H +LF+Q +  V       +EL+ EL T  NDE S
Sbjct: 521 NRILPKLVTHYKNTGSLDFEDIFHEHLKLFQQDLLNVQSEKQRNEELIQELSTKKNDETS 580

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 5/83 (6%)

Query: 167 SLDISYTNVGLVEYF----TDSAGKDYMFVLCDIQNKKTCYKLFQL-NHSAENLPITELN 221
           SL ++Y   GL+ +      DS          D   KK CY  F+  N   EN  + +L 
Sbjct: 209 SLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKVADLT 268

Query: 222 SVILEDFALAESKMVYQFGKLYR 244
                 F+L ESK+  + G L R
Sbjct: 269 GSKCPIFSLVESKLSEEIGLLIR 291

>Suva_10.105 Chr10 complement(193819..199404) [5586 bp, 1861 aa]
           {ON} YLR024C (REAL)
          Length = 1861

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 506 HELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRV-------DLHNFLNFVIKDSTD 558
           H++ TVL  E   +++ R+ QEF KE+IK  +R++S +       DL N+L  +   ST+
Sbjct: 306 HDVVTVLQGENFFEMN-RIAQEFQKENIKVYVRKVSDIFNRKLTDDLTNWLYSMCFKSTE 364

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,756,431
Number of extensions: 2897662
Number of successful extensions: 8241
Number of sequences better than 10.0: 38
Number of HSP's gapped: 8342
Number of HSP's successfully gapped: 41
Length of query: 650
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 534
Effective length of database: 40,180,143
Effective search space: 21456196362
Effective search space used: 21456196362
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)