Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR306C3.488ON31931917120.0
Ecym_12413.488ON30530511141e-153
KLTH0F14740g3.488ON3022806382e-81
SAKL0F02860g3.488ON3052796122e-77
Kwal_55.212193.488ON3022795973e-75
TBLA0C044503.488ON3092845811e-72
NCAS0F035303.488ON3133065811e-72
CAGL0L08514g3.488ON3122885462e-67
TPHA0D042203.488ON3162845412e-66
Kpol_480.173.488ON3132875323e-65
Smik_16.4003.488ON3042825304e-65
Skud_16.4423.488ON3042825174e-63
TDEL0D055603.488ON3112895132e-62
ZYRO0D10076g3.488ON3052835105e-62
YPR147C3.488ON3042825071e-61
Suva_16.4763.488ON3042815043e-61
NDAI0B058303.488ON3293094369e-51
TBLA0H035408.524ON378177940.003
CAGL0M05467g8.524ON35481800.14
KAFR0E031208.524ON346116780.26
Skud_15.903.163ON95765750.82
KNAG0A037708.524ON35688731.2
TDEL0B032508.524ON348200721.6
Smik_15.953.163ON95758712.3
Skud_2.3318.524ON376147702.4
KAFR0E03110singletonON356115702.6
TPHA0F008204.114ON79483693.7
SAKL0F06402g3.442ON72147693.9
NCAS0B022608.524ON363108684.0
YBR204C (LDH1)8.524ON375123675.7
NCAS0G039601.450ON577676610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR306C
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   664   0.0  
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   433   e-153
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   250   2e-81
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   240   2e-77
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   234   3e-75
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   228   1e-72
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   228   1e-72
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   214   2e-67
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   213   2e-66
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   209   3e-65
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   208   4e-65
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   203   4e-63
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   202   2e-62
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   201   5e-62
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   199   1e-61
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   198   3e-61
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   172   9e-51
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    41   0.003
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    35   0.14 
KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.5...    35   0.26 
Skud_15.90 Chr15 complement(166454..169327) [2874 bp, 957 aa] {O...    33   0.82 
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    33   1.2  
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    32   1.6  
Smik_15.95 Chr15 complement(171618..174491) [2874 bp, 957 aa] {O...    32   2.3  
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    32   2.4  
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               32   2.6  
TPHA0F00820 Chr6 (185723..188107) [2385 bp, 794 aa] {ON} Anc_4.1...    31   3.7  
SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} simila...    31   3.9  
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    31   4.0  
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    30   5.7  
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    30   10.0 

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/319 (100%), Positives = 319/319 (100%)

Query: 1   MSSQTTKEAAKARTVVETLCDPDIDADMLHIWSEWIQPECILIFLPGNPGLINFYREFLR 60
           MSSQTTKEAAKARTVVETLCDPDIDADMLHIWSEWIQPECILIFLPGNPGLINFYREFLR
Sbjct: 1   MSSQTTKEAAKARTVVETLCDPDIDADMLHIWSEWIQPECILIFLPGNPGLINFYREFLR 60

Query: 61  SIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEHKVKAINDFVENRGNLAVKLV 120
           SIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEHKVKAINDFVENRGNLAVKLV
Sbjct: 61  SIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEHKVKAINDFVENRGNLAVKLV 120

Query: 121 GHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPKGVQLTRISEWFPRFYEYVSI 180
           GHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPKGVQLTRISEWFPRFYEYVSI
Sbjct: 121 GHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPKGVQLTRISEWFPRFYEYVSI 180

Query: 181 VDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRN 240
           VDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRN
Sbjct: 181 VDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRN 240

Query: 241 QWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDE 300
           QWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDE
Sbjct: 241 QWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDE 300

Query: 301 HISHSFVVKDTTKVVNIYF 319
           HISHSFVVKDTTKVVNIYF
Sbjct: 301 HISHSFVVKDTTKVVNIYF 319

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 245/305 (80%), Gaps = 1/305 (0%)

Query: 16  VETLCDPDIDADMLHIWSEWIQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGIS 75
           +ET    DI AD+LHI+S+   P  +L+F+PGNPGLINFY EFL+ IHE+NPTWE+VGI 
Sbjct: 1   METYLREDIFADILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIG 60

Query: 76  HTGMSAKTGPEDLK-RVYTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVV 134
           HTGMS+      L  RV+TL EQ+E KVK IN+FV+  G+  +KL+GHSIGAYM QK+ +
Sbjct: 61  HTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIAL 120

Query: 135 HPALRVNVEMVGLLTPTIIDIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATW 194
           H  LR  ++MV LLTPTIIDIHRS KGVQLTRIS+WFP+FYEY  +VDRVL +W+LP +W
Sbjct: 121 HKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSW 180

Query: 195 ISWLARKIIGGSDECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQE 254
           I W+ARK+IGGSDECVLQSA+KLV  P +V+QALG+AQ+EM+QVRNQWDFQ+EFI  CQ 
Sbjct: 181 IEWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQA 240

Query: 255 RRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKV 314
            +  +  LFSGHDHWVH DTMKDI+E YEAKY ++   LL ITID HI+HSFVVKDTTKV
Sbjct: 241 NKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKV 300

Query: 315 VNIYF 319
           VNIYF
Sbjct: 301 VNIYF 305

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  250 bits (638), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 179/280 (63%), Gaps = 7/280 (2%)

Query: 40  CILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVE 99
           C+ +F+PGNPGLI +Y  FL+ +HEKNP WEI+GISH GM++    +    VYTL EQ+ 
Sbjct: 30  CLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCN--DIACPVYTLQEQIN 87

Query: 100 HKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSP 159
           HKV  IN + +  GN  + ++GHS+GA++AQKVV    L   V  VGLLTPT+IDIH+S 
Sbjct: 88  HKVDVINSYAQ--GNKKITIMGHSVGAFIAQKVVTSGLLNDEVARVGLLTPTVIDIHKSE 145

Query: 160 KGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVK 219
           KG++LT I+E FPRF++ VS +D +  E L P    SW+          C+  +   L+ 
Sbjct: 146 KGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADDPKTCLGAATRLLLT 205

Query: 220 NPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIV 279
           N  +V+QALG+A  EM  +R+ W++Q++F+  C+ + + +W LFS +DHWV S+T KD++
Sbjct: 206 NSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLFSDNDHWVSSETRKDLI 265

Query: 280 EFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
           +FYE     ++  L+ I +   I H+FV +    VV  YF
Sbjct: 266 QFYERH---SSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  240 bits (612), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 122/279 (43%), Positives = 176/279 (63%), Gaps = 6/279 (2%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKT-GPEDLKRVYTLVEQVE 99
           + +F+PGNPGLI FY+ FL  I +K+  WEI+GISH GM  K  G +   +VY+L +QV+
Sbjct: 31  LFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKKPTKVYSLKDQVQ 90

Query: 100 HKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSP 159
           HK+  INDF  +  N  + + GHSIGAY+ QK+ +  +L   V+ + LLTPT+IDIH S 
Sbjct: 91  HKIYVINDFCSS--NRPLIIAGHSIGAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSE 148

Query: 160 KGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVK 219
           KG +L  I+EW P F+ YV+    ++ E +LP T    +    +G    CV ++A+ LV 
Sbjct: 149 KGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVGSEQTCVREAAKLLVT 208

Query: 220 NPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIV 279
           N  +V+Q+LG+A+ EM +VR+ W+FQ  F++ C+ +   L  LF+  DHWV+S T  D+ 
Sbjct: 209 NYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLA 268

Query: 280 EFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIY 318
           EFY + Y  +    L I  DE ISHSFV+ DT  VV+ Y
Sbjct: 269 EFYNSNYYKD---FLTIDEDEKISHSFVLNDTKSVVDRY 304

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  234 bits (597), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 173/279 (62%), Gaps = 7/279 (2%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100
           + +F+PGNPGLI FY  FL  IHEKNP WEI+GISH GM++ +  E++  VY+L +Q++H
Sbjct: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCS--EEVSPVYSLEQQIDH 88

Query: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160
           K++ IN +  +     + ++GHS+GA+M QK+     L+  V  VGLLTPT+IDIH+S K
Sbjct: 89  KIEIINRYCLD--GKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHKSEK 146

Query: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVKN 220
           GV+LT I+ W P F+  VS ++  L E LLP      +   ++     C+  + E LV N
Sbjct: 147 GVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVDDPQSCLGATTELLVTN 206

Query: 221 PSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIVE 280
             +V+QALG+A  E+  +R+ W +Q+EF+  CQE  + +W LFS  DHWV   T  DI++
Sbjct: 207 SRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDIID 266

Query: 281 FYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
           FY      ++ +L +I +   I H+FV +    V+  YF
Sbjct: 267 FYRQH---SSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  228 bits (581), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 174/284 (61%), Gaps = 11/284 (3%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDL--KRVYTLVEQV 98
           + I++PGNPGL+ +Y + LRS+H+K PTWEI+G+SH GMS     +++   +VYTL EQV
Sbjct: 32  LFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQV 91

Query: 99  EHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRS 158
            HKV+ IN+F   + N+ +  +GHS+GAYMAQ+V++   L  NV  +GL+TPT++DIHRS
Sbjct: 92  SHKVEVINNFSSPKRNIII--MGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRS 149

Query: 159 PKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG--GSDECVLQSAEK 216
            KG+++TR    F     ++ ++  +    L PA +  WL   I+G   +D     ++  
Sbjct: 150 VKGIKMTRAFNLFRELPIFLGLLSTLAFSKLFPAIFTRWLLTIIMGCKNNDNHAADASTV 209

Query: 217 LVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMK 276
            + N S+V+Q LG+A  EM  +R+ W+FQ+  I  C +   S W LFS  DHWV  DT  
Sbjct: 210 FLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRN 269

Query: 277 DIVEFYEAKYGTNADS-LLRITIDEHISHSFVVKDTTKVVNIYF 319
           +++ FY     TN  S +L +++   I HSFV+  +   VN YF
Sbjct: 270 ELINFYR----TNCKSDILDVSVSNIIPHSFVINFSDFTVNSYF 309

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  228 bits (581), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 185/306 (60%), Gaps = 12/306 (3%)

Query: 22  PDIDADMLHIWSEWIQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSA 81
           P     +L I +  I P  + +++PGNPG++ +Y+E L ++HEK+PTWEI+ ISH GM+ 
Sbjct: 12  PTCVVHILPIKTAEINP--VFVWIPGNPGILEYYQEMLINLHEKHPTWEILAISHIGMNT 69

Query: 82  KTGP------EDLKRVYTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVH 135
           KT        +D  RV+TL EQ++HK+K IN+FV++  N+ + + GHS+GAYM QK+V  
Sbjct: 70  KTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKD-SNVPIYISGHSVGAYMVQKIVAS 128

Query: 136 PALRVNVEMVGLLTPTIIDIHRSPKGVQLTRISEWFPRFYEYV-SIVDRVLLEWLLPATW 194
             L   V  +GL+TPTIIDIH S KG  +TR + W  R   ++ S +  ++  WL+P   
Sbjct: 129 DELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIVFGWLVPGIL 188

Query: 195 ISWLARKIIGGS-DECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQ 253
            S++   ++G   D     S E  +  P++VRQ+LG+AQ EM  + + W FQ E I+ C 
Sbjct: 189 RSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCL 248

Query: 254 ERRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTK 313
           +    +  LFS  DHWV   T K+I++FY+ +    A +LL+I + +   HSFVV+ +  
Sbjct: 249 KNSIKIQFLFSATDHWVREATRKEIIQFYQER-CKGAKALLKIDVSDQFPHSFVVRRSKY 307

Query: 314 VVNIYF 319
           VV  YF
Sbjct: 308 VVEHYF 313

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  214 bits (546), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 114/288 (39%), Positives = 171/288 (59%), Gaps = 15/288 (5%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR-------VYT 93
           + +++PGNPGL+ +Y+EFL  +H+KNPTWEI+GISH G   ++    LK+       +Y 
Sbjct: 31  LFVWIPGNPGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESS--QLKKFRKNPLPIYD 88

Query: 94  LVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTII 153
           L +Q +HK+  IN  + N  N  + ++GHS+GAY+AQ VV  P L   V  +GL+TPTI 
Sbjct: 89  LKQQTQHKIDIINK-INNDPNRELVIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIR 147

Query: 154 DIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGS-DEC-VL 211
           DIH+S  G+  TR+  +     EY+S +   +   L+PA W   L    +G S DE  ++
Sbjct: 148 DIHKSSHGLIFTRVFNYISNVNEYLSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHII 207

Query: 212 QSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVH 271
                L+     +RQ LG+A  EM ++R+ W FQE  +  C++  + LWLLFS +DHWV 
Sbjct: 208 LGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVS 267

Query: 272 SDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
             T  ++++F + +Y    + LLR+ +D+ I HSFVVKD   V   YF
Sbjct: 268 QHTQAELIKFLKDRY---PELLLRVDVDKDIKHSFVVKDVDLVTRRYF 312

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  213 bits (541), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 170/284 (59%), Gaps = 12/284 (4%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR----VYTLVE 96
           + +++PGNPGL+ +Y EFL+ +H KNP W+I+GISH GMS+  G  +LK     VYTL E
Sbjct: 40  LFVWIPGNPGLLEYYEEFLKLLHVKNPEWDILGISHAGMSS--GNSNLKENECSVYTLDE 97

Query: 97  QVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIH 156
           Q+ HK++ IN F      L V  +GHS+GA+MAQKVV+   L   V+ +GLL PT+IDIH
Sbjct: 98  QIHHKIEIINKFAAYGRELIV--MGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIH 155

Query: 157 RSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDEC-VLQSAE 215
            S KG Q++ I  W P   +    V   +    LP T + ++    +  ++E     +  
Sbjct: 156 LSEKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATY 215

Query: 216 KLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTM 275
             +K+ ++V Q+LG+A+ EM  +R+ W+FQ E +K C   +  LW LF+  DHWV + T 
Sbjct: 216 TFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTR 275

Query: 276 KDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
            +++E Y  +   N+D     +I + + H+FV+K++  VV+ YF
Sbjct: 276 SELIELY--RNSVNSD-YYSYSITDQVPHAFVIKNSCHVVDNYF 316

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  209 bits (532), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 170/287 (59%), Gaps = 14/287 (4%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMS-------AKTGPEDLKRVYT 93
           + +++PGNPGL+ +Y +FL  +H+KNPTWE++GISH GMS        KT   D  +V+ 
Sbjct: 33  LFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEKKKKTSSNDKFKVFD 92

Query: 94  LVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTII 153
           L EQV+HKV  IN F  +  N  + ++GHS+GAY+ Q+V++   L   +  VG LTPT++
Sbjct: 93  LEEQVQHKVDIINKF--SSKNRPLIIMGHSVGAYLTQRVIMTNKLNGKLIKVGYLTPTVV 150

Query: 154 DIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGS-DECVLQ 212
           DIH S KG+++T++  W      +V  + + +   LLP  ++ +   K+I  S D   + 
Sbjct: 151 DIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFVKFFISKMIKCSEDSNAVL 210

Query: 213 SAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHS 272
           ++  L++N + + QALG+A  EM  + + W F ++ I  C E     W LF+  DHWV  
Sbjct: 211 ASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFLFAEDDHWVAH 270

Query: 273 DTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
            T K++++FY+     N    +RI ID  I H+FV+K +  +V+ YF
Sbjct: 271 STRKEVIDFYQYH---NKPENIRIDIDT-IPHAFVIKKSKYIVDQYF 313

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  208 bits (530), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 168/282 (59%), Gaps = 11/282 (3%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100
           +L+++PGNPGL+ +Y+E L+ +H K+P WEI+GISH GM+          VY+L +QV+H
Sbjct: 31  LLVWIPGNPGLLYYYQEMLQYLHSKHPDWEILGISHAGMTLNAHSN--TPVYSLQDQVDH 88

Query: 101 KVKAINDFV-ENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSP 159
           +V+ IN+F  ENR    + ++GHS+GAY+ QKV +   L   V+ VGL+TPT++DIH S 
Sbjct: 89  QVEVINNFSHENR---KIIIMGHSVGAYILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSE 145

Query: 160 KGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG-GSDEC-VLQSAEKL 217
            GV+LT    + P     VS+   +   W+L   +  ++  K +G GS  C  + S    
Sbjct: 146 MGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIF 205

Query: 218 VKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKD 277
           + +  +VRQ+LG+A  EM ++   W+FQ++FI  C++  + +W LFS +DHWV   T   
Sbjct: 206 LTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSH 265

Query: 278 IVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
           +  +Y+ K   N    L I + + I HSFVVK     +N +F
Sbjct: 266 LSHYYKDKVDQNR---LEIDVTDKIPHSFVVKHAKYAINTFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  203 bits (517), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 168/282 (59%), Gaps = 11/282 (3%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100
           +L+++PGNPGL+ +Y+E L+ +H K+P WEI+G+SH GM+          +++L +QV+H
Sbjct: 31  LLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNAHSN--TPIFSLQDQVDH 88

Query: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160
           +V+ IN+F  +  N  + ++GHS+GAY+ QKV +   L  +V  +GL+TPT++DIH S  
Sbjct: 89  QVEVINNF--SHENRKIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEM 146

Query: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG-GSD--ECVLQSAEKL 217
           GV++T +  + P     VS++  V   W+L      ++  K +G GS   + VL S   L
Sbjct: 147 GVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGLSRFVIDKFMGCGSTGYQAVL-STRIL 205

Query: 218 VKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKD 277
           + +  +VRQ+LG+A  EM ++   W+FQ+EFI  CQE    +W LFS  DHWV   T   
Sbjct: 206 LTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTH 265

Query: 278 IVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
           +  +Y+ K        L+I + + I HSFVVK     VN +F
Sbjct: 266 LSHYYKDKI---KQERLKIDVTDKIPHSFVVKHAEYAVNTFF 304

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  202 bits (513), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 169/289 (58%), Gaps = 12/289 (4%)

Query: 37  QPEC-ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMS----AKTGPEDLKRV 91
           + EC + +++PGNPGLI +Y EFL  IH ++P WE++GISH GMS    +K+   +   V
Sbjct: 26  KSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDV 85

Query: 92  YTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPT 151
           Y+L +Q++HK++ I DF  +  N  + ++GHS+GAYM Q +V+   L   V  +GLLTPT
Sbjct: 86  YSLKQQIDHKLEIIKDF--SSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPT 143

Query: 152 IIDIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGG-SDECV 210
           I+DIH S KGV LT++  W     +       +L  + LP+  +  L    +G   +   
Sbjct: 144 ILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGFFLPSFILRILLSFFMGCHRNSSG 203

Query: 211 LQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWV 270
           + +   L++N  +V+QALG++  EM ++R+ W FQ   I  C ER  S WLLFS  DHWV
Sbjct: 204 VLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLLFSDSDHWV 263

Query: 271 HSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
              T +D+++FY   Y   AD +   T    I HSFV+  +  +++ YF
Sbjct: 264 ADTTREDLIKFYRDHY--RADKIKIHTCK--IPHSFVLNHSKYLISEYF 308

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  201 bits (510), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 166/283 (58%), Gaps = 10/283 (3%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR---VYTLVEQ 97
           + +++PGNPG++ +Y EFL  +HEK  ++EI+ ISH GM A   P+  KR   +YTL +Q
Sbjct: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGM-ATEDPDLQKRKATIYTLDDQ 87

Query: 98  VEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHR 157
           ++HKV+ IN F      L V  +GHS+GAYMAQ VV+   L   V  +GL+TPT++DIHR
Sbjct: 88  IQHKVEIINQFSAKDRPLIV--MGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHR 145

Query: 158 SPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECV-LQSAEK 216
           S KG QLTR   W     +  + V  +L   L    +   +    +G   E V + +++ 
Sbjct: 146 SQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKS 205

Query: 217 LVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMK 276
           LV+NP  +RQALG+A LEM Q+R  W FQ++ I  C         +FS +D WV + T +
Sbjct: 206 LVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATRE 265

Query: 277 DIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
            ++ FY   Y    D  L I++ + ++HSF+VK +  +V+ YF
Sbjct: 266 ALMVFYRENY---RDRNLEISVSQDLAHSFIVKHSKYIVDEYF 305

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  199 bits (507), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 168/282 (59%), Gaps = 11/282 (3%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100
           +L+++PGNPGL+ +Y+E L  +H K+P WEI+GISH GM+          +++L +QV+H
Sbjct: 31  LLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHSN--TPIFSLQDQVDH 88

Query: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160
           +V+ IN+F  +  N  + ++GHS+GAY+ QKV +   L  +V+ VGL+TPT++DIH S  
Sbjct: 89  QVEVINNF--SCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEM 146

Query: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG-GSD--ECVLQSAEKL 217
           G+++T    + P     VS+   +   W+L   +  ++  K +G GS   + VL S    
Sbjct: 147 GIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGCGSTGYQAVL-STRIF 205

Query: 218 VKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKD 277
           + +  +VRQ+LG+A  EM ++   W+FQ+ FI  C+E   S+W LFS +DHWV   T   
Sbjct: 206 LTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSH 265

Query: 278 IVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
           + ++Y+ K        L+I + + I HSFVVK     +N +F
Sbjct: 266 LSDYYKDKV---KQERLKIDVTDKIPHSFVVKHAEYAINAFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  198 bits (504), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 101/281 (35%), Positives = 164/281 (58%), Gaps = 9/281 (3%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100
           +L+++PGNPGL+++Y+E +  +H K+P WEI+GISH GMS+         +++L +QV+H
Sbjct: 31  LLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARSN--TPIFSLQDQVDH 88

Query: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160
           +VK IN+F  +  N  + ++GHS+GAY+ QKV +   L  +V  VGL+TPT++DIH S  
Sbjct: 89  QVKVINNF--SHDNRKIIIMGHSVGAYIVQKVCLSNELVGSVTKVGLITPTVMDIHASEM 146

Query: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG--GSDECVLQSAEKLV 218
           GV++T    + P     +S +  V   W+L       +  K +G   +    + S    +
Sbjct: 147 GVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFL 206

Query: 219 KNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDI 278
            +  +VRQ+LG+A  E+ ++   W+FQ++FI  C+E+    W LFS  DHWV+ +T K +
Sbjct: 207 THRQFVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHL 266

Query: 279 VEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319
             +Y  K        LRI + + + HSFVVK     +N +F
Sbjct: 267 SHYYHDKV---KQEHLRIDVTDKMPHSFVVKHAEYAINAFF 304

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  172 bits (436), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 169/309 (54%), Gaps = 42/309 (13%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTG----PEDLKRVYTLVE 96
           + I++PGNPG++ +Y++FL S+H+K+P WEI+ I H GM         P D  R+Y L E
Sbjct: 33  LFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGMDTSLPVYRHPND--RIYHLNE 90

Query: 97  QVEHKVKAINDFV--ENRGNLAVK-----LVGHSIGAYMAQKVVVHPALRVNV------- 142
           Q+EHK++ I  F+   N  +  +K     ++GHS+G YM Q++V+    +  +       
Sbjct: 91  QIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYL 150

Query: 143 EMVGLLTPTIIDIHRSPKGV------QLTRISEWFPRFYEYVS-IVDRVLLEWLLPATWI 195
           + +G +TPTIIDI+ S KG+      QLT    + P    Y+S  V  ++L++       
Sbjct: 151 KKIGFITPTIIDINLSSKGILISHGLQLTH--GYLPYILSYLSYFVFSLILKYF------ 202

Query: 196 SWLARKIIGGSDECVLQ-----SAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIK 250
             + R++I     C +        E L+ N   V+Q+LG+A +EM ++R  WD Q++F++
Sbjct: 203 DNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIRKNWDVQKQFVE 262

Query: 251 TCQERRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKD 310
            C      LWLLF   DHWV++ T  D+++FY++ Y     S L+I +     HSFVV  
Sbjct: 263 NCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNY--KDISRLQIEVSSEFPHSFVVNH 320

Query: 311 TTKVVNIYF 319
           +  VV  +F
Sbjct: 321 SDWVVERFF 329

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 76/177 (42%), Gaps = 37/177 (20%)

Query: 30  HIWSEWIQPECILIFLPGNPGLINFYREFLRS---IHEKNPTWEIVGISHTGMSAKTGPE 86
           ++ SE +  + I +FLPG  G ++ Y   LR    ++EK   +++ G   +      G  
Sbjct: 85  NVGSEVLTNKPIYVFLPGLGGSLDQYEPLLRLMDILNEKFIGFDLPGFGGSEEDTSEGGY 144

Query: 87  DLKRVYTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYM----------------AQ 130
           ++ +V  ++ +    +   N     R  + ++LVGHS+G Y+                +Q
Sbjct: 145 NMIKVCHIINEALQSIITQN--YSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQ 202

Query: 131 KVVVHPAL----------RVNVEMVGLL--TPTIIDIHRS----PKGVQLTRISEWF 171
            ++  P            R+N   + LL   P I D +RS    PKG++   I+ +F
Sbjct: 203 LILTSPPKKKIEPLDKNNRLNQFGLQLLYKLPIIQDFYRSWFDQPKGLKSVGIANFF 259

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 8/81 (9%)

Query: 70  EIVGISHTGMSAKTGPEDLKRVYTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMA 129
           ++ G   +G S  T   D+  V ++V++V      +++ +EN+ ++  K+VGHS+G Y+A
Sbjct: 109 DLPGFGQSGSS--TNGYDMLYVTSVVKKV------VDNNIENKTDIDFKVVGHSMGCYIA 160

Query: 130 QKVVVHPALRVNVEMVGLLTP 150
              V       N++ + L  P
Sbjct: 161 SHFVQMYHEEYNIDKLVLTCP 181

>KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.524
           YBR204C
          Length = 346

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 50/116 (43%), Gaps = 7/116 (6%)

Query: 39  ECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQV 98
           + + + LPG  G ++ Y + LR I + N ++  +               +  +  L E+ 
Sbjct: 82  DSVYLMLPGLGGNMDQYIQLLRLIDKCNQSFVSIDPPDFTSDKALSNYSMYNIAKLYEET 141

Query: 99  EHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIID 154
             ++   + F        + +VGHS+G Y++         + NVE + LLTP + D
Sbjct: 142 LSRLVGTSKF-------KLNIVGHSLGTYISIHFYHLFNYKYNVEKLILLTPPMSD 190

>Skud_15.90 Chr15 complement(166454..169327) [2874 bp, 957 aa] {ON}
           YOL063C (REAL)
          Length = 957

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 34  EWIQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYT 93
           +W    C L     +P  I    E LRS+ E + +W+I   SH  +S KT  ED K   +
Sbjct: 60  KWPNSSCSLF----HPKTIELIEERLRSLEEHDSSWKITNTSH--LSKKTFLEDTKAALS 113

Query: 94  LVEQV 98
            +E V
Sbjct: 114 NLEPV 118

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 84  GPEDLKRVYTLVEQVEHKVKAINDFVENRGNLA---VKLVGHSIGAYMAQKVVVHPALRV 140
           G  D    Y +++ V+H    I++ + N   LA   V+L+GHS+G Y+    +   + + 
Sbjct: 121 GKSDEHTDYPMIQVVKHIDAVISELL-NEARLAFDTVRLIGHSMGCYLTLHFMTLFSKKY 179

Query: 141 NVEMVGLLTPT---IIDIHRSPKGVQLT 165
            +  V LL P    +I++++  + VQ+ 
Sbjct: 180 RIGKVVLLAPPKPEMIELNKDKRLVQVA 207

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 76/200 (38%), Gaps = 49/200 (24%)

Query: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100
           + +F+ G  G +  +   LR + ++N ++    +   G S      D    Y +++ V+ 
Sbjct: 80  LFLFIHGLGGTLEQFEPVLRELDQRNKSFLAFDLPGFGKS------DEWDQYPMLDVVKS 133

Query: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMA-------------QKVVVHPALRVNVEMV-- 145
               I+    N     + L+GHS+G Y+A              ++V+    + NV+ +  
Sbjct: 134 IDWLIHQLTNNLKFEKLNLIGHSMGCYLAVHFYLLFHESWCISRLVLLAPPKPNVDQLSK 193

Query: 146 -----------GLLTPTIIDIHRS----PKGVQLTRISEWFPR-------------FYEY 177
                      G   P + DI+R+     KG+  + I ++F R             F+  
Sbjct: 194 SKYLIQFGLQTGFRFPWMFDIYRTRFDQSKGLSSSGIKQFFYRDGDITDKYRKLWQFHNN 253

Query: 178 VSIVDRVLLEWLLPATWISW 197
           V I  R +  + L    I W
Sbjct: 254 VQIKSRSIFGYFLGWEEIDW 273

>Smik_15.95 Chr15 complement(171618..174491) [2874 bp, 957 aa] {ON}
           YOL063C (REAL)
          Length = 957

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 49  PGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEHKVKAIN 106
           P  ++F +E L ++ + + +W+I  ISH+  S K   ED+K  ++ +E V    + +N
Sbjct: 71  PKTVDFIKERLHNLEKHDSSWKIPNISHS--SKKIFVEDIKSAFSNLEPVWGPARLLN 126

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 63/147 (42%), Gaps = 18/147 (12%)

Query: 33  SEWIQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRV- 91
            E I+ + + +F+PG  G +  +   L+ I      +  + +   G S++     + +V 
Sbjct: 81  DEGIRGDTVFLFVPGLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKVV 140

Query: 92  ---YTLVEQVEHKVKA-------INDFVENRGNLAVKLVGHSIGAYMAQKVVVH--PALR 139
              + LV  V  K  A       +N F     N  + L GHS+G ++A  +      AL+
Sbjct: 141 ELIFVLVCDVLKKWPAAVPKDREVNPF----DNRKIVLTGHSMGCFLACHLYEQHLAALK 196

Query: 140 VNVEMVGLLTPTIIDIHRSPKGVQLTR 166
           V VE + LLTP    I +  K   L +
Sbjct: 197 V-VEKMVLLTPPKAHIEQLSKDRHLIQ 222

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/115 (20%), Positives = 48/115 (41%), Gaps = 5/115 (4%)

Query: 36  IQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLV 95
           I  + + + +PG  G +  +   +R I   N  +  + +   G S       +  + TL+
Sbjct: 77  IDSDSLFLCIPGLGGNLEQFEPLVRLIDASNKNFLAIDLPGFGKSEDYSNYSMTHIATLI 136

Query: 96  EQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTP 150
           +Q+   V           N  + ++GHS+G ++A         +  VE + L++P
Sbjct: 137 DQMLETVIGTAP-----DNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSP 186

>TPHA0F00820 Chr6 (185723..188107) [2385 bp, 794 aa] {ON} Anc_4.114
           YGL014W
          Length = 794

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 103 KAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPKGV 162
           +A N   E   N  ++L+  S G Y+ QK++    L   + ++ +  P  IDI  +P G 
Sbjct: 498 QAANTIFEEIKNHCIELMTDSFGNYLIQKLLERITLEQRLIIINISAPYFIDIALNPHGT 557

Query: 163 Q-LTRISEWFPRFYEYVSIVDRV 184
           + L ++ E      E   IVD +
Sbjct: 558 RALQKLVECIKTDEEAKIIVDSL 580

>SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} similar
          to uniprot|P53038 Saccharomyces cerevisiae YGR099W TEL2
          Essential DNA-binding protein specific to
          single-stranded yeast telomeric DNA repeats required
          for telomere length regulation and telomere position
          effect
          Length = 721

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 44 FLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR 90
          F+PG+ G +  + E L  IHE   TW +  I++T        E LKR
Sbjct: 15 FIPGH-GNLELFEEVLFHIHEFKKTWSVNSINYTMGKITANLEALKR 60

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/108 (20%), Positives = 41/108 (37%)

Query: 43  IFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEHKV 102
           +F+ G  G +  +   LR  H K   +  + +   G S +     +K V   +  V    
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSVIETIRSVVDLA 144

Query: 103 KAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTP 150
                 +     L + L GHS+G Y+        +   ++  + LL+P
Sbjct: 145 TGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 8/123 (6%)

Query: 36  IQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRV---- 91
           I+ + + +F+PG  G +  +   L  +      +  + +   G S++     + +V    
Sbjct: 83  IRGDTVFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELI 142

Query: 92  YTLVEQVEHKVKAI---NDFVENRGNLAVKLVGHSIGAYMAQKVV-VHPALRVNVEMVGL 147
           + LV  V  K       ND V       + LVGHS+G ++A  +   H A    V+ + L
Sbjct: 143 FVLVCDVLRKWSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVL 202

Query: 148 LTP 150
           LTP
Sbjct: 203 LTP 205

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 37  QPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVE 96
           +P  +L+   G PGLI+       S+  K P   I G S++      G +DL +V  L +
Sbjct: 72  KPAVLLVV--GGPGLIHALAGIYNSMSNKWPLIVIAGSSNSETDQVGGFQDLDQVSLLNK 129

Query: 97  QVEHKVK 103
            V++ VK
Sbjct: 130 YVKYTVK 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,744,498
Number of extensions: 1406663
Number of successful extensions: 3830
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3879
Number of HSP's successfully gapped: 38
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)