Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR305W3.487ON30930916760.0
Ecym_12423.487ON3113127641e-100
KLLA0E04687g3.487ON3063146079e-77
SAKL0F02882g3.487ON2983115791e-72
NCAS0E008403.487ON3363165569e-69
YGR127W3.487ON3123205496e-68
Kwal_55.212173.487ON3033095252e-64
Smik_6.2233.487ON3133215234e-64
CAGL0I10582g3.487ON3193225183e-63
NDAI0G009703.487ON3323325091e-61
Skud_7.4383.487ON3133235053e-61
KLTH0F14718g3.487ON3003075009e-61
TBLA0D029903.487ON3183114983e-60
Suva_7.4153.487ON3133214983e-60
KAFR0C019303.487ON3133084931e-59
Kpol_1017.93.487ON3103174887e-59
KNAG0B008403.487ON3133204522e-53
TDEL0D055503.487ON3103144495e-53
TPHA0D032603.487ON3143204487e-53
ZYRO0D10098g3.487ON2762583393e-37
YNL279W (PRM1)1.65ON66196780.31
TBLA0I022303.325ON96674770.47
Smik_14.591.65ON66096721.6
NCAS0A015505.208ON74878712.6
ZYRO0C06270g3.454ON430102702.6
CAGL0B02673g8.492ON47176703.1
NCAS0J023401.132ON290102658.2
NDAI0I014106.150ON64348668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR305W
         (309 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   650   0.0  
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   298   e-100
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   238   9e-77
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   227   1e-72
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   218   9e-69
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   216   6e-68
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   206   2e-64
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   206   4e-64
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   204   3e-63
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   200   1e-61
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   199   3e-61
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   197   9e-61
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   196   3e-60
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   196   3e-60
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   194   1e-59
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   192   7e-59
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   178   2e-53
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   177   5e-53
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   177   7e-53
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   135   3e-37
YNL279W Chr14 (110917..112902) [1986 bp, 661 aa] {ON}  PRM1Phero...    35   0.31 
TBLA0I02230 Chr9 complement(510907..513807) [2901 bp, 966 aa] {O...    34   0.47 
Smik_14.59 Chr14 (89830..91812) [1983 bp, 660 aa] {ON} YNL279W (...    32   1.6  
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...    32   2.6  
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...    32   2.6  
CAGL0B02673g Chr2 (255316..256731) [1416 bp, 471 aa] {ON} simila...    32   3.1  
NCAS0J02340 Chr10 (459674..460546) [873 bp, 290 aa] {ON} Anc_1.1...    30   8.2  
NDAI0I01410 Chr9 (338148..340079) [1932 bp, 643 aa] {ON} Anc_6.1...    30   8.7  

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSPYYVVSNGPSDGAKALGQW 180
           GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSPYYVVSNGPSDGAKALGQW
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSPYYVVSNGPSDGAKALGQW 180

Query: 181 PKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIFVPA 240
           PKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIFVPA
Sbjct: 181 PKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIFVPA 240

Query: 241 LYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVTREHVIHDSDQDLDSYSILNPKEQV 300
           LYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVTREHVIHDSDQDLDSYSILNPKEQV
Sbjct: 241 LYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVTREHVIHDSDQDLDSYSILNPKEQV 300

Query: 301 THRFSLQMH 309
           THRFSLQMH
Sbjct: 301 THRFSLQMH 309

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  298 bits (764), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 204/312 (65%), Gaps = 6/312 (1%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQD--ADGLDHGS 58
           MCIL ATT HP YKL+LISNRDE++ R+TH TCW  +  ILAPYD++  +  +D      
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 59  PCGTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYE 118
             GTW+GINR GHVSVLLNL       + G  +R SRG VT+ +L+D  + NWD WN YE
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPSDGAKAL 177
           KF  HF  L  T+ FT FYGD+    F +I+S  ++++PF S+ PY V+SN   +     
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG 180

Query: 178 GQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIF 237
            +W KVVEG QL K++++ +L+VS+E LLQ+CF LA  SQ+  N  I V D S+P++TIF
Sbjct: 181 PRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKTIF 240

Query: 238 VPALYNLSGQANLSFA--AGMYYGTRSTIVMLVSEDGNVVTREHVIHDSDQDLDSYSILN 295
           VP L   +G +++  +   G YYGTR+TIV+LV    +V   EHVIHDSD+D+   S +N
Sbjct: 241 VPTL-KAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNHVTMHEHVIHDSDKDIGLSSAMN 299

Query: 296 PKEQVTHRFSLQ 307
           PK +V + F +Q
Sbjct: 300 PKTKVAYEFDIQ 311

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  238 bits (607), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 125/314 (39%), Positives = 191/314 (60%), Gaps = 16/314 (5%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCILFAT AHP YKL+L+SNRDE+F RKTH TCW+H+  IL+PYDMA++       G   
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKK-----GQGY 55

Query: 61  GTWIGINRAGHVSVLLNL---APKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTY 117
           GTW+GINR G ++V+LNL   +P D++         SRG V +++L+  D+  +D+W+++
Sbjct: 56  GTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSW 115

Query: 118 EKFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSPYYVVSNGPSDGA--K 175
           EKF      L +T  FT FYGD  + +++VI+ L  + +PF +  + V+SN     A  +
Sbjct: 116 EKFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEHMVISNDIFHCAVGE 175

Query: 176 ALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRT 235
              +W K   G  L   + + +  +++EELLQ+CF L S   +   + +    DS+   +
Sbjct: 176 HTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV----DSVTTSS 231

Query: 236 IFVPALYNLSGQANL--SFAAGMYYGTRSTIVMLVSEDGNVVTREHVIHDSDQDLDSYSI 293
           I+VP L    G   +  S   G YYGTRS IV+LV +D  V   EHVI++SD+D ++YS 
Sbjct: 232 IYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCETYSF 291

Query: 294 LNPKEQVTHRFSLQ 307
           ++PKE +  +F+++
Sbjct: 292 MDPKEVIQFQFNME 305

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  227 bits (579), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 182/311 (58%), Gaps = 18/311 (5%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL  TTAHP+Y L+LISNRDE+F R+TH TC   +D I++P+DM++        G   
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSIT-----TKGRNF 55

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYL--KDFDHNNWDSWNTYE 118
           GTW G+N+ G V+V+LNL               SRG V M++L  KD D NNWDS   YE
Sbjct: 56  GTWCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDS---YE 112

Query: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSP-YYVVSNGPSDGAKAL 177
           KF  H+P + KT  F  FYGD    ++ +I+SL +T D F     Y VVSN   D   + 
Sbjct: 113 KFSHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSN---DLISSK 169

Query: 178 GQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIF 237
            +W K+     L + +++ S+D +++ +L +CF LAS+S    ++ I V  +S+   TI+
Sbjct: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHS--TCSEKIVVKHESVTNETIY 227

Query: 238 VPALYNLSGQ-ANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDLDSYSILN 295
           VP L   +GQ  ++S   G YYGTRS IV+LVS+D   +T  E V++  D+D+  Y   N
Sbjct: 228 VPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKN 287

Query: 296 PKEQVTHRFSL 306
           PKEQ+   F +
Sbjct: 288 PKEQIEFEFDI 298

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  218 bits (556), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 180/316 (56%), Gaps = 15/316 (4%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL ATTAHP+Y+L+LISNRDE+F RKTH +CW ++D IL+P+DMA   +  L      
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMA--KSCELHEKKIF 74

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTWIGINR   ++ +LNL  +            SRG +   +L + D ++++ W+TYEKF
Sbjct: 75  GTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHD-SDFNKWDTYEKF 133

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSPYYVVSN-----GPSDGAK 175
              +  L KT  F  FYGD +N ++ +I+S G T    S  PY  VSN     G     +
Sbjct: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTVSNDMFATGGITVER 193

Query: 176 A----LGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDS- 230
           A    + +W K+  G  L + +++ES  + E+ L+++CF LAS       +    + +S 
Sbjct: 194 ASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNST 253

Query: 231 IPKRTIFVPAL-YNLSGQANLSFAAGMYYGTRSTIVMLVSED-GNVVTREHVIHDSDQDL 288
           +P  TIFVP L   ++     S + G YYGTRS IV+L+S++   V   EH+++ SD D+
Sbjct: 254 LPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDI 313

Query: 289 DSYSILNPKEQVTHRF 304
             YS  NPKE  +  F
Sbjct: 314 QHYSSTNPKEVKSFEF 329

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  216 bits (549), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 181/320 (56%), Gaps = 22/320 (6%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL AT AHP Y+L+LISNRDE+ ARKTH TCW +ND IL+PYD+A   A+        
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAE----KQIF 56

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTW GIN+ G ++ +LNL     D +   +   SRG +   +L      +++ W+ Y+KF
Sbjct: 57  GTWSGINKEGKLATILNLK---LDNEQNNTKSRSRGLLPFIFLS-IHKADFEDWDNYKKF 112

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS------PYYVVSNGP-SDG 173
             H+  L  T  F  FYGDV+  Q+ VI+SLG+T D  S +       Y VVSNG   D 
Sbjct: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172

Query: 174 AKALGQ-WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQY---VSNQPI-GVHD 228
           +   GQ W KV       + ++ E+++  EE+++  CF LAS S     +SN  +  + D
Sbjct: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232

Query: 229 DSIPKRTIFVPALYN-LSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQ 286
            ++   TI+VP L          S   G YYGTRS IV+LVS+D   VT  E V++ SD+
Sbjct: 233 PNVTMNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292

Query: 287 DLDSYSILNPKEQVTHRFSL 306
           D+  YS+ +PKE+   +F L
Sbjct: 293 DVRKYSVTSPKEEKRFKFKL 312

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  206 bits (525), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 184/309 (59%), Gaps = 18/309 (5%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL A++AHP+Y L+LISNRDE+  R+T  TC +H+D +++P DM L+D    ++    
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKD----NNEPNL 56

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHR-HSRGAVTMEYLKDFDHNNWDSWNTYEK 119
           GTW G NR G ++V+LNL  +  + +   + R  SRG VTM YL   D      WN+Y K
Sbjct: 57  GTWCGANRNGRIAVILNL--RTGNTNQTKTKRIVSRGNVTMRYLT--DKQPASDWNSYAK 112

Query: 120 FGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPSDGAKALG 178
           F +  P + K+  F  FYGD  +  ++ I+S G + +   SQ+PY V+SN   D  ++  
Sbjct: 113 FASKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISN---DSIESAT 168

Query: 179 QWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIFV 238
           +WPK+    +L + ++++S++ SE++LL RCF+LAS+ Q  +     +  + +    IFV
Sbjct: 169 KWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVD--HMDKEKVTSSNIFV 226

Query: 239 PAL-YNLSGQANLSFAAGMYYGTRSTIVMLVS-EDGNVVTREHVIHDSDQDLDSYSILNP 296
           P L    S     S   G +YGTRS IV+LVS ED ++   EHV++DSD +   +   NP
Sbjct: 227 PPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANP 286

Query: 297 KEQVTHRFS 305
           K+ V+++ +
Sbjct: 287 KKCVSYKIN 295

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  206 bits (523), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 177/321 (55%), Gaps = 23/321 (7%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL AT AHP Y+L+LISNRDE+ ARKTH TCW ++D IL+PYD+A    +G +     
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEF---- 56

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTW GIN+ G ++ +LNL       +       SRG +   +L + + N  D W++Y KF
Sbjct: 57  GTWSGINKEGKLATILNLK---LGSERSTIKSKSRGLLPYIFLSNHEANFKD-WDSYSKF 112

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS------PYYVVSNGPSDGA 174
           G H+  L  T  F  FYGDV+  Q+ VI+SLG+T D  S +       Y V+SNG     
Sbjct: 113 GNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNT 172

Query: 175 KALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQY---VSNQPI--GVH 227
            ++ +  W KV       + ++ +++ + EE ++  CF LAS S     VS   +   + 
Sbjct: 173 SSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLV 232

Query: 228 DDSIPKRTIFVPALYNLSG-QANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSD 285
           D ++   TI+VP L    G     S   G +YGTRS IV+L+S+D    T  E +I+ SD
Sbjct: 233 DPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSD 292

Query: 286 QDLDSYSILNPKEQVTHRFSL 306
           +D+  YS+  PKE+    F L
Sbjct: 293 EDVRQYSVSAPKEEKRFEFEL 313

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  204 bits (518), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 178/322 (55%), Gaps = 18/322 (5%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCILFAT  HP Y+L++ISNRDE+  RKTH+TCW ++D IL+PYD+A   A         
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAG--QSNDTF 58

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTW G+NR G V+ +LNL   D           SRGA+   +L D    N++ W+TY KF
Sbjct: 59  GTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLND-RQGNFEDWDTYAKF 117

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQ--SPYYVVSNGPSDGAKALG 178
              +P + +T  F  FYGD    ++++I+SLG T   FS+    Y V+SN   D      
Sbjct: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177

Query: 179 Q--------WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYS---QYVSNQPIGVH 227
           Q        W K+ +G Q+ ++ ++ + ++ +E++++ CF LAS +     ++ +   V 
Sbjct: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237

Query: 228 DDSIPKRTIFV-PALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSD 285
              + K TI+V P L     +      AG YYGTRS IV+LV +     T  E +I+ SD
Sbjct: 238 SLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSD 297

Query: 286 QDLDSYSILNPKEQVTHRFSLQ 307
           QD+  YS  NPKE++ + + ++
Sbjct: 298 QDISLYSTSNPKEELRYEYDIE 319

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  200 bits (509), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 120/332 (36%), Positives = 170/332 (51%), Gaps = 28/332 (8%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL ATTAHP Y+L+LISNRDE+  RKTHT+CW ++D IL+PYDMA +     +     
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECK--YNDKKVF 58

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTW+GIN+ G ++ +LNL    +          SRG +   YL D   +++  W+ Y+ F
Sbjct: 59  GTWLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPSDGAKALGQ 179
              +P L  T  F  FYGDV   Q+ +++S+G T+    S   Y VVSN        LG+
Sbjct: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178

Query: 180 --------------------WPKVVEGNQLFKKMIQESLDVSEEE--LLQRCFNLASYSQ 217
                               W KV  G  L + ++ +S+   ++E  ++  CF L+S   
Sbjct: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238

Query: 218 YVSNQPIGVHDDS-IPKRTIFVPALY-NLSGQANLSFAAGMYYGTRSTIVMLVSEDG-NV 274
                    H +S +P  TI VP L   ++     S   G YYGTRS IV+L+      V
Sbjct: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298

Query: 275 VTREHVIHDSDQDLDSYSILNPKEQVTHRFSL 306
              EHVI+ SD D+ ++S  NPKE V   F+L
Sbjct: 299 KFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  199 bits (505), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/323 (38%), Positives = 178/323 (55%), Gaps = 27/323 (8%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL AT AHP Y+L+LISNRDE+ ARKTH TCW ++D IL+PYD+A    +        
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKE----KQIF 56

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLK--DFDHNNWDSWNTYE 118
           GTW GINR G ++ +LNL     DG        SRG +   +L     D  NWD+   Y+
Sbjct: 57  GTWSGINREGKLATILNLK---LDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDN---YD 110

Query: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQT---LDPFSQS---PYYVVSNGPSD 172
           KF  ++  L  T  F  FYGDV+  Q+ +I+SLG+T   LD   +S    Y  VSNG   
Sbjct: 111 KFEMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFY 170

Query: 173 GAKALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQY--VSNQPIGVH- 227
            + ++ +  W KV       +K++  ++D  EE ++  CF LAS S     +++P  +  
Sbjct: 171 NSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQM 230

Query: 228 --DDSIPKRTIFVPALYN-LSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHD 283
             D ++   TI+VP L          S   G YYGTRS IV+LVS++ + VT  E +++ 
Sbjct: 231 LADPNVIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290

Query: 284 SDQDLDSYSILNPKEQVTHRFSL 306
           SD+D++ YS+  PKE+    F L
Sbjct: 291 SDEDVNHYSVATPKEEKRFEFKL 313

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  197 bits (500), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 179/307 (58%), Gaps = 23/307 (7%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL A+ AHPKY L+ ISNRDE+F RKT  TC +H+D IL+P D AL+     ++    
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRS----NNKPAL 56

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTW G+NR G V+V+LNL  K+           SRG+V M+YL   D      WN++EKF
Sbjct: 57  GTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYL--MDRGPSTDWNSFEKF 114

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFS-QSPYYVVSNGPSDGAKALGQ 179
            + +P + + + F  FYGD +  +++ I+SLG + +  +   P  V+SN   D +    +
Sbjct: 115 VSKYPQITECE-FNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSS---SR 170

Query: 180 WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHD---DSIPKRTI 236
           WPKV + + L ++++Q S   SEEEL+++CF LAS     + +P  + +   +     +I
Sbjct: 171 WPKVQKADILLQELVQSSQHDSEEELIEKCFALAS-----NTEPAEIDNSDKEEFTCSSI 225

Query: 237 FVPALYNLSGQANL--SFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDLDSYSI 293
           F+P +  +  + ++  S   G +YGTRS IV+LV      ++  E V+HDSD ++  +S 
Sbjct: 226 FIPPV-EIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSE 284

Query: 294 LNPKEQV 300
            +PKE++
Sbjct: 285 KHPKEKL 291

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  196 bits (498), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 172/311 (55%), Gaps = 26/311 (8%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMA---LQDADGLDH- 56
           MCIL  TTAHP YKL+LISNRDE F R+TH+TCW+HN +IL PYDM+     D  G +  
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 57  GSPCGTWIGINRAGHVSVLLNLAPKDA---DGDHGYSHRHSRGAVTMEYLKDFDHNNWDS 113
            S  GTW G+N+ G +  +LNL  ++    DGD   S   SRG + ++YL DFDH  +  
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS-LQSRGLIPIKYLCDFDH-GFQD 118

Query: 114 WNTYEKFGAHFPTL-YKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPS 171
           WNTY+KF     ++  K  LF  F GD+ ++++S+INS+GQ+      ++PY VVSN   
Sbjct: 119 WNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINW 178

Query: 172 DGAKALGQWPKVVEGNQLFKKMIQESLDVS---EEELLQRCFNLASYSQYVSNQPIG-VH 227
              K +G+W K+  G +L + +I + LD S   E E+L+ CF ++S       +  G + 
Sbjct: 179 GDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIE 238

Query: 228 DDSIPKRTIFVPALYNLSGQAN----------LSFAAGMYYGTRSTIVMLVSEDGNVVT- 276
                K  IFVP L    G+                +  YYGTRS IV+L     N VT 
Sbjct: 239 RLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNKVTF 298

Query: 277 REHVIHDSDQD 287
            E ++H  ++D
Sbjct: 299 VERILHCKNED 309

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  196 bits (498), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 169/321 (52%), Gaps = 23/321 (7%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL AT AHP Y+L+LISNRDE+  RKTH TCW ++D IL+PYD+A    +        
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME----KQIF 56

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTW GIN+ G ++ +LNL     D     +   SRG +   +L        D W+ Y KF
Sbjct: 57  GTWSGINKEGKLATILNLK---MDDQRSCTKSKSRGMLPFTFLTSHKARFQD-WDDYNKF 112

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS------PYYVVSNGPSDGA 174
             H+  L  T  F  FYGDV+  ++ VI+SLG T D    +       Y V+SNG    +
Sbjct: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNS 172

Query: 175 KALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSN--QPIGVH--- 227
            ++ +  W KV       + +I ++++  EE L+  CF LAS S       +P  +    
Sbjct: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232

Query: 228 DDSIPKRTIFVPALYNLSG-QANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSD 285
           D ++   TI+VP L    G     S   G YYGTRS IV+LVS+D + VT  E V++ SD
Sbjct: 233 DPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSD 292

Query: 286 QDLDSYSILNPKEQVTHRFSL 306
           +D+  YS   PKE+    F L
Sbjct: 293 EDVSHYSASAPKEEKRFEFEL 313

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  194 bits (493), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 178/308 (57%), Gaps = 14/308 (4%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCILFAT +H +Y+L+LISNRDEY  RKTH TCW +++ IL+PYDM+ ++    +HG+  
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREE----NHGNKI 56

Query: 61  -GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYL-KDF-DHNNWDSWNTY 117
            GTW+G+N+ G ++ +LNL    +          SRG +   +L  D+ + ++++ W T+
Sbjct: 57  FGTWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETF 116

Query: 118 EKFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGP---SDG 173
           EKF + +P L  +  F  FYGD+    + +I+SLG T     + +   ++SN      D 
Sbjct: 117 EKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDE 176

Query: 174 AKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVH-DDSIP 232
            +    W K+  G +   K ++E+   +E+E+L +CF LASY    S+     + +  + 
Sbjct: 177 YEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELA 236

Query: 233 KRTIFVPALYNLSGQ-ANLSFAAGMYYGTRSTIVMLVSEDGNVVTR-EHVIHDSDQDLDS 290
             TI+VP L     +   L+   G YYGTR+ IV+LV +D   VT  EH IH+SD+++  
Sbjct: 237 AETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYK 296

Query: 291 YSILNPKE 298
           YS LNPKE
Sbjct: 297 YSGLNPKE 304

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  192 bits (488), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 111/317 (35%), Positives = 182/317 (57%), Gaps = 18/317 (5%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHND--SILAPYDMALQDADGLDHGS 58
           MCIL A+  HP Y L+LISNRDE+  R+TH TCW+  +   IL PYDM+  +   ++   
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNK-- 58

Query: 59  PCGTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYE 118
             GTW GIN  G VS +LNL   D+      S + SRGA+ +++L + + ++  +W++YE
Sbjct: 59  -IGTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYE 117

Query: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFS-QSPYYVVSN---GPSDGA 174
           KF   +P + +T  F  FYGDV   +++VI+S+G T +  +  +PY V+SN   G S+G 
Sbjct: 118 KFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNG- 176

Query: 175 KALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKR 234
           K+  +W K+     L K +    L  +E++L+ +CF++AS +    +    V    +   
Sbjct: 177 KSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTE 233

Query: 235 TIFVPALYNLSGQANLSFAA----GMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDLD 289
           TI VP L  ++ +      A    G YYGTRS IV+LV+++   V   E ++++SD D+ 
Sbjct: 234 TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVT 293

Query: 290 SYSILNPKEQVTHRFSL 306
           +  + +P + +T+ F++
Sbjct: 294 TQKLSSPIQDLTYNFTI 310

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  178 bits (452), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 161/320 (50%), Gaps = 23/320 (7%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL  T  HP Y LVLISNRDE+F R TH T W   D IL+PYDM      GL     C
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDM----TKGLYDPGKC 56

Query: 61  --GTWIGINRAGHVSVLLNLAPKDADGDHGYSH------RHSRGAVTMEYLKDFDHNNWD 112
             GTW+G+NRAG VS +LNL     +G+    H      R SRG +   +L   D    D
Sbjct: 57  VRGTWMGLNRAGRVSTVLNLK---LEGEALRKHSKNPVKRRSRGLIPFMFLS--DRGFID 111

Query: 113 SWNTYEKFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSP--YYVVSNGP 170
            W+++EKF   +P L K+  F  F GD+    + V++S G T    +++     VVSN  
Sbjct: 112 QWDSFEKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDT 171

Query: 171 SD--GAKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHD 228
                   + +W KV  G     +++  ++++ +   + +CF+ AS+     +       
Sbjct: 172 YKEFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKT 231

Query: 229 DSIPKRTIFVPALYNLSGQ-ANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQ 286
             +   TIFVP L     Q   L+ + G+Y+GTRS +V LVS+D   VT  E ++H SD 
Sbjct: 232 PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDL 291

Query: 287 DLDSYSILNPKEQVTHRFSL 306
           D D  S  NPKE     F L
Sbjct: 292 DRDFNSPHNPKEVKQFTFDL 311

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  177 bits (449), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 116/314 (36%), Positives = 159/314 (50%), Gaps = 14/314 (4%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60
           MCIL AT+ HPKY LVL+SNRDEYFARK     W+ ++ +L P D  L  +     G   
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSS-----GEDL 55

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120
           GTWIG NR G +  +LNL               SRG + + +L      N+  W+TY+KF
Sbjct: 56  GTWIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSS-RGANFKDWDTYDKF 114

Query: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS--PYYVVSNGPSDGAKALG 178
              F  L  T+ F  FYGD     + VI+SLG T     ++   Y VVSN    G     
Sbjct: 115 CHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKN 174

Query: 179 Q-WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIG---VHDDSIPKR 234
           + W K+   +Q    +++E  D  E++ +Q CF +AS + + S    G   +    +  +
Sbjct: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQ 234

Query: 235 TIFVPALYNLSGQA-NLSFAAGMYYGTRSTIVMLVSEDGNVVTR-EHVIHDSDQDLDSYS 292
           T+FVP L          S   G YYGTRS  V+LVS+D + +T  E +IHDSD D   YS
Sbjct: 235 TVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYS 294

Query: 293 ILNPKEQVTHRFSL 306
             + KEQ  + F L
Sbjct: 295 RDHYKEQKRYDFDL 308

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  177 bits (448), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 176/320 (55%), Gaps = 21/320 (6%)

Query: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSH--NDSILAPYDMALQDADGLDHGS 58
           MCILF T +HP Y+L+LISNRDE+  RKT  +CW+   N  +L PYD++  + D     S
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDP----S 56

Query: 59  PCGTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYE 118
             GTW GIN  G VS +LNL   +   +     + SRG + +++L +   N+++ WN+Y 
Sbjct: 57  KFGTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYS 116

Query: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQT---LDPFSQS--PYYVVSNGPSDG 173
           KF   +P L KT  F  F GDV   ++++I+S GQT   LD   ++     V+SN     
Sbjct: 117 KFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF-I 175

Query: 174 AKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDD--SI 231
           +    +W K+  G +L  + + + +   E  +++ CF +AS S+ ++N+ +  HDD   +
Sbjct: 176 SNDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSE-LTNEYLHSHDDILDL 233

Query: 232 PKRTIFVP--ALYNLSGQANL--SFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQ 286
              T+FVP   L N   + N+  S   G +YGTRS IV+LV+++   V   E V+++ D 
Sbjct: 234 MTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDD 293

Query: 287 DLDSYSILNPKEQVTHRFSL 306
           D+    I  P  ++   +++
Sbjct: 294 DVSKAGIEKPINELNFEYNI 313

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  135 bits (339), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 136/258 (52%), Gaps = 18/258 (6%)

Query: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYS-HRHSRGAVTMEYLKDFDHNNWDSWNTYEK 119
           GTW GIN+ G V  +LNL   D     G+  H  SRG V   +L   D + W+ WN+Y K
Sbjct: 24  GTWCGINKDGRVGTVLNLK-LDQGAQRGHPLHLSSRGKVPTAFLSQHDLD-WEQWNSYNK 81

Query: 120 FGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQ------SPYYVVSNGPSDG 173
           F   F  L  T  F  FYGD  N Q+ +I+SL QT D  +       S Y VVSN   D 
Sbjct: 82  FANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSN---DV 138

Query: 174 AKALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDS- 230
            +  G+  WPKV    +  +K+I+++++  ++  + +CF +AS S  +  Q   +   S 
Sbjct: 139 YRYQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSSD 198

Query: 231 IPKRTIFVPALYNLSGQANLSFAA-GMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDL 288
           + K++IFVP L       NL       +YGTRS IV+LVS+D   VT  E V+H+SD+ +
Sbjct: 199 VTKQSIFVPPL-KFPPDLNLGTTTHAGFYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQV 257

Query: 289 DSYSILNPKEQVTHRFSL 306
              S  +P EQ+  +F L
Sbjct: 258 SQRSPDHPAEQLKFQFDL 275

>YNL279W Chr14 (110917..112902) [1986 bp, 661 aa] {ON}
           PRM1Pheromone-regulated multispanning membrane protein
           involved in membrane fusion during mating; predicted to
           have 5 transmembrane segments and a coiled coil domain;
           localizes to the shmoo tip; regulated by Ste12p
          Length = 661

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 12/96 (12%)

Query: 190 FKKMIQESLDVSEEELLQRCFNLAS-YSQYVSNQP--IGVHD--------DSIPKRTIFV 238
           F K IQ +++VSE  +L  C+++ S YS+   N P  +G+          +   K T+  
Sbjct: 36  FSKSIQHAIEVSETYILSNCYSIDSLYSKMTDNTPHYLGIMGNYLIEKGMEETVKATLET 95

Query: 239 PALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNV 274
            +L   + +  ++FA  +Y GT + +++  + DG V
Sbjct: 96  LSLIVYASEGLVNFAIDLYLGTYACLIV-SAVDGTV 130

>TBLA0I02230 Chr9 complement(510907..513807) [2901 bp, 966 aa] {ON}
           Anc_3.325 YBL037W
          Length = 966

 Score = 34.3 bits (77), Expect = 0.47,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 140 VVNSQFSVINSLGQTLDPFS--QSPYYVVSNGPSDGAKALGQWPKVVEGNQLFKKMIQES 197
           ++N    V+N L   + PF    +P YV+ N       +L    K    NQ F  +I++ 
Sbjct: 750 IINQTEGVLNGLSSEIIPFKIRDNPEYVIGNNSGVSRLSL---QKNERSNQTFDIIIRKP 806

Query: 198 LDVSEEELLQRCFN 211
            D+ E  +L+ C N
Sbjct: 807 FDIEESPILRVCCN 820

>Smik_14.59 Chr14 (89830..91812) [1983 bp, 660 aa] {ON} YNL279W
           (REAL)
          Length = 660

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 12/96 (12%)

Query: 190 FKKMIQESLDVSEEELLQRCFNLAS-YSQYVSNQP--IGVHDDSI--------PKRTIFV 238
           F K IQ +++VS+  +L  C ++ S YS+   N P  +GV  + +         K T+  
Sbjct: 36  FSKSIQHAIEVSQTYVLSNCHSIDSFYSKVTDNTPHYLGVMGNYLIEKGMEETVKATLET 95

Query: 239 PALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNV 274
            +L   + +  L+FA  +Y GT + + ++ + DG V
Sbjct: 96  LSLIVYASEGLLNFAIDLYLGTYACL-LVSAVDGTV 130

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 166 VSNGPSDGAKALGQ---WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQ 222
           VS   SDG++ALG+   W +V E N+L +KM     DV  EE  ++   L +  Q    +
Sbjct: 598 VSKIKSDGSRALGRQVNWNQVEETNKLVEKMSDTIEDVLVEEKQEKEI-LRAEMQLKKGE 656

Query: 223 PIGVHDDSI---PKRTIF 237
            +  H   I   P+RT F
Sbjct: 657 NMLKHKQEIQSRPRRTWF 674

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 42/102 (41%), Gaps = 14/102 (13%)

Query: 120 FGAHFPTLYKTKLFTHFYGDVVNSQFSVINS-----LGQTLDPF--------SQSPYYVV 166
            GA+   LY TK  THF   V+ S   V  S     +G T  P+        + SP+ +V
Sbjct: 220 LGAYLMALYTTKYTTHFKKLVMCSPAGVCKSTTAKNIGNTTPPWWYTKLWDLNISPFCLV 279

Query: 167 SNGPSDGAKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQR 208
            N  + G+     W      N+L +     +LD  + E L R
Sbjct: 280 RNAAALGSMVTSGW-SYRRFNKLLQSNSNTNLDRLQFEALHR 320

>CAGL0B02673g Chr2 (255316..256731) [1416 bp, 471 aa] {ON} similar
           to uniprot|P38907 Saccharomyces cerevisiae YDR254w CHL4
           chromosome segregation protein
          Length = 471

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 117 YEKFGAHFPTLY---KTKLFTHFYGDVVNSQFSVINSL---GQTLDPFSQSPYYVVSNGP 170
           Y  FG + P +    +  ++  F  D +    S  + +    +T  P       ++ +GP
Sbjct: 202 YLVFGINTPFIIHSPENDIYASFIHDCIERVLSFRDPIILEEKTKTPILNLEKILIIDGP 261

Query: 171 SDGAKALGQWPKVVEG 186
           S  +KA+GQW K  EG
Sbjct: 262 SRYSKAMGQWSKYAEG 277

>NCAS0J02340 Chr10 (459674..460546) [873 bp, 290 aa] {ON} Anc_1.132
           YJL203W
          Length = 290

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 17/102 (16%)

Query: 177 LGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTI 236
           + Q+  V +   L K +I+     S+ ELLQ CF+ A Y +Y S Q   V          
Sbjct: 84  IKQYRDVKKALPLTKNVIKNPGKDSQIELLQMCFDRAEYYEYSSEQKSEVE--------- 134

Query: 237 FVPALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVTRE 278
                  L     + FA+  +   +  I+ +V+E  +V+ +E
Sbjct: 135 ------KLKHLEKVQFAS--FEWNKFEIIKVVNEGASVIYKE 168

>NDAI0I01410 Chr9 (338148..340079) [1932 bp, 643 aa] {ON} Anc_6.150
           YBR238C
          Length = 643

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 181 PKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHD 228
           PK +  +++F K++    DV+ EELLQ+ +N+ +    +  Q I   D
Sbjct: 493 PKTIVTHRIFLKVLGSIDDVTTEELLQKWYNIINKEDQIGQQFISNAD 540

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,573,161
Number of extensions: 1572968
Number of successful extensions: 3876
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3869
Number of HSP's successfully gapped: 32
Length of query: 309
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 200
Effective length of database: 40,982,805
Effective search space: 8196561000
Effective search space used: 8196561000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)