Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR304W3.485ON1015101551000.0
SAKL0F02926g3.485ON1050106025330.0
KLTH0F14674g3.485ON1010103524300.0
Skud_7.4363.485ON1036105223820.0
Smik_6.2213.485ON1036105323790.0
Kwal_55.212013.485ON1011104823730.0
ZYRO0C07986g3.485ON1024101023680.0
Suva_7.4133.485ON1037101423600.0
YGR125W3.485ON1036105623460.0
CAGL0I10626g3.485ON1070104923400.0
TDEL0D055303.485ON1031104623320.0
NDAI0G009903.485ON1054106323130.0
NCAS0E009503.485ON1052103022960.0
KAFR0C019103.485ON1020103422660.0
KLLA0E04731g3.485ON1060104422430.0
KNAG0B008603.485ON1088109422270.0
Kpol_480.183.485ON1057107621700.0
TBLA0C044403.485ON115081821400.0
TPHA0D042103.485ON104982921090.0
Smik_16.2418.99ON7445071381e-07
Suva_16.3228.99ON7424951326e-07
Skud_16.2868.99ON7454931301e-06
YPR003C8.99ON7544961157e-05
TDEL0C012808.99ON7272891040.001
Kpol_1070.327.206ON42573910.035
SAKL0H16830g8.271ON86286870.12
SAKL0B03124g8.99ON744516870.13
NDAI0A027307.206ON32069830.26
ZYRO0D16104g7.206ON45269840.28
NCAS0B048008.99ON724499840.30
ZYRO0F04796g8.99ON735290820.47
AGR077C8.271ON848246810.74
TBLA0C052708.99ON776352800.89
KLLA0E04181g7.206ON46672790.91
KLTH0A03432g7.206ON46272791.0
KLLA0E14059g8.99ON706276791.0
KNAG0D023908.99ON716559791.0
Kwal_47.180817.206ON45872791.1
TDEL0H024107.206ON44779781.2
CAGL0L09207g8.99ON725536791.3
SAKL0F07788g7.206ON46679781.4
Kpol_1002.566.201ON92856781.5
SAKL0H08800gna 1ON620261781.5
Kpol_1036.363.228ON38939761.9
ADL099C7.206ON45866753.3
CAGL0I05236g7.206ON40469734.3
TBLA0D048007.206ON40669726.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR304W
         (1015 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...  1969   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...   980   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...   940   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...   922   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...   920   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...   918   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...   916   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...   913   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...   908   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...   905   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...   902   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...   895   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...   889   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....   877   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   868   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...   862   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...   840   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...   828   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....   816   0.0  
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    58   1e-07
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    55   6e-07
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    55   1e-06
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    49   7e-05
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    45   0.001
Kpol_1070.32 s1070 complement(72051..73328) [1278 bp, 425 aa] {O...    40   0.035
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...    38   0.12 
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    38   0.13 
NDAI0A02730 Chr1 complement(615038..616000) [963 bp, 320 aa] {ON...    37   0.26 
ZYRO0D16104g Chr4 (1345440..1346798) [1359 bp, 452 aa] {ON} simi...    37   0.28 
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    37   0.30 
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    36   0.47 
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...    36   0.74 
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    35   0.89 
KLLA0E04181g Chr5 (378888..380288) [1401 bp, 466 aa] {ON} simila...    35   0.91 
KLTH0A03432g Chr1 (296563..297951) [1389 bp, 462 aa] {ON} simila...    35   1.0  
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    35   1.0  
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    35   1.0  
Kwal_47.18081 s47 (675629..677005) [1377 bp, 458 aa] {ON} YIL033...    35   1.1  
TDEL0H02410 Chr8 complement(403240..404583) [1344 bp, 447 aa] {O...    35   1.2  
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    35   1.3  
SAKL0F07788g Chr6 (596801..598201) [1401 bp, 466 aa] {ON} simila...    35   1.4  
Kpol_1002.56 s1002 (154463..157249) [2787 bp, 928 aa] {ON} (1544...    35   1.5  
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    35   1.5  
Kpol_1036.36 s1036 complement(90884..92053) [1170 bp, 389 aa] {O...    34   1.9  
ADL099C Chr4 complement(506849..508225) [1377 bp, 458 aa] {ON} S...    33   3.3  
CAGL0I05236g Chr9 complement(496714..497928) [1215 bp, 404 aa] {...    33   4.3  
TBLA0D04800 Chr4 (1179762..1180982) [1221 bp, 406 aa] {ON} Anc_7...    32   6.3  

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score = 1969 bits (5100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 976/1015 (96%), Positives = 976/1015 (96%)

Query: 1    MTKNRRFSAWSHRPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVG 60
            MTKNRRFSAWSHRPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVG
Sbjct: 1    MTKNRRFSAWSHRPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVG 60

Query: 61   SFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEE 120
            SFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEE
Sbjct: 61   SFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEE 120

Query: 121  EEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFL 180
            EEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFL
Sbjct: 121  EEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFL 180

Query: 181  SPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGTRTVRYIPAVIXXXXXXXXXXX 240
            SPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGTRTVRYIPAVI           
Sbjct: 181  SPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGTRTVRYIPAVILGLLLNILDAL 240

Query: 241  SYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFHT 300
            SYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLV              EMIEVTPFFHT
Sbjct: 241  SYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFGYGTGSEMIEVTPFFHT 300

Query: 301  MALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCI 360
            MALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCI
Sbjct: 301  MALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCI 360

Query: 361  GGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHN 420
            GGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHN
Sbjct: 361  GGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHN 420

Query: 421  SMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHW 480
            SMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHW
Sbjct: 421  SMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHW 480

Query: 481  ELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQ 540
            ELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQ
Sbjct: 481  ELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQ 540

Query: 541  NYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELL 600
            NYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPW              FLLGYELL
Sbjct: 541  NYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCIVSSLIFLLGYELL 600

Query: 601  KEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEF 660
            KEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEF
Sbjct: 601  KEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEF 660

Query: 661  DGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEYKK 720
            DGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEYKK
Sbjct: 661  DGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEYKK 720

Query: 721  IIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLL 780
            IIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLL
Sbjct: 721  IIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLL 780

Query: 781  QDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKAQIPLENTPRNAQI 840
            QDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKAQIPLENTPRNAQI
Sbjct: 781  QDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKAQIPLENTPRNAQI 840

Query: 841  MTAAQAVYSGEQQLNKTLSKYKASHPALALLLVALKTYRSGHAYKETKEIRLWKHLCPYF 900
            MTAAQAVYSGEQQLNKTLSKYKASHPALALLLVALKTYRSGHAYKETKEIRLWKHLCPYF
Sbjct: 841  MTAAQAVYSGEQQLNKTLSKYKASHPALALLLVALKTYRSGHAYKETKEIRLWKHLCPYF 900

Query: 901  VRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSS 960
            VRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSS
Sbjct: 901  VRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSS 960

Query: 961  VVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            VVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING
Sbjct: 961  VVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/1060 (50%), Positives = 702/1060 (66%), Gaps = 73/1060 (6%)

Query: 12   HRPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEA----YLGRSYVGSFSNSGS 67
            +R SISEA+ I L +        N   P      + M PE     YLGRSYVGSFS S S
Sbjct: 6    NRKSISEAITISLGLHSD-----NIKQPSQANRRSSMNPENSSNYYLGRSYVGSFS-SPS 59

Query: 68   LMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALC---DDSRAYDGGPEEEEAL 124
             + RE+ A   D+  +      AS  +H    LHRQTAAL    DDS   DG  +E +  
Sbjct: 60   FLQRESSA---DTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSS--DGKSDEIDVA 114

Query: 125  V---FEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLF-- 179
                F+   + +E +      G Y+    ++N +  +   ++A+   ++     TRL   
Sbjct: 115  ASQEFQNEALQRELSLEN---GSYSNSNNNNNNNNQIAYSEDAITQENNGLNECTRLLSP 171

Query: 180  ----------------LSPITTDYIH-SYGAINEEQSASETASRAETGP----------- 211
                            LSP ++ Y    Y ++  + S S       TG            
Sbjct: 172  TSAAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSL 231

Query: 212  -SPL--------RLWGTRTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGL 262
              P+        + W  +T+ Y+PAVI           SYGMIIFPI EP+FSHLGP GL
Sbjct: 232  RQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGL 291

Query: 263  SMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTI 322
            SMFYVSTI+SQLV              EMIE+TPFFHTMALSI NSL     D+II+TTI
Sbjct: 292  SMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGH-DDEIISTTI 350

Query: 323  VCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFE 382
            VCYALS+I TG  F  LGKLRLGK+V FFP HILIGC+GGV YFL+ITGIEV TRV+KFE
Sbjct: 351  VCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFE 410

Query: 383  YSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALI 442
            YS  FLR LF + ++L KW++P +L +S+I+ Q   +NS++LP FY+   ALFHF+VA++
Sbjct: 411  YSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIV 470

Query: 443  PSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVP 502
            P+LSL++LR+ GWIFP+  S   WYD+ +LY+ Q +HW LVL ++PTMLALTFFGILHVP
Sbjct: 471  PNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVP 530

Query: 503  INVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAG 562
            INVPALA+S G+DK DVDKELIAHGYSN+ SG +GSIQNYLVYTNS LFIRAG+DS +AG
Sbjct: 531  INVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAG 590

Query: 563  FLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVII 622
            FLLA+ TF+ M  GP               FLLGYEL+KE L+D++ +L+ FEYIT+VII
Sbjct: 591  FLLALGTFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVII 650

Query: 623  ILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKV 682
            + TMG+FDFVLGIIVG+L+ACFSFLV+ST+ +TI+ EF+G+VA+S  +RDY+Q+ FL KV
Sbjct: 651  VFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKV 710

Query: 683  AEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSA 741
             EQI+VLKLQN LFFGTIISIEEKI  LLE  +    ++ IKYLILDFK+IN DNIDYSA
Sbjct: 711  GEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSA 770

Query: 742  AEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELL 801
            AEGFNRIKR  E KRI+LI+SSI+E D+IY  F+K+GLLQDVELF DLNSALEWCENE L
Sbjct: 771  AEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFL 830

Query: 802  CEYRSLLSRAH-RVKVRRRSKDIVPKAQIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSK 860
             +Y+ + +R   +++ +++ +  + K+ +P+ NTPRN QI+T AQ ++  EQ +    ++
Sbjct: 831  LQYKQIRTRTKAKLQAQKKQEKHLSKSLLPI-NTPRNNQIVTVAQKIFPDEQNVTHLRTQ 889

Query: 861  YKASHPALALLLVALKTYRSG-HAY-KETKEIR--LWKHLCPYFVRKSFSPQTSISDEGD 916
            Y+   P L LLLVALK +R    +Y K+ K+     W  LCPYFVRK F+P + +    +
Sbjct: 890  YQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSLLLHNNN 949

Query: 917  MFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVV--RTETECVLWMID 974
            +FF+VESG+LKITY L QG   E ++SKTCYG ISG    + +  V  +TET+C +W+ID
Sbjct: 950  LFFLVESGMLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLYVNIKTETDCAVWIID 1009

Query: 975  APGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLIN 1014
            A  L  L+E+NL LY ELL+V +S+ Q+R KELLG+SL++
Sbjct: 1010 ATNLANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVS 1049

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1035 (49%), Positives = 670/1035 (64%), Gaps = 55/1035 (5%)

Query: 7    FSAWSHRPSISEALNIQLNIPDSPSGGANA-----GGPVSERIPTLMRPEAYLGRSYVGS 61
            FS   ++ S+SEA+++ L +   P    +      G P S        P  YLGRSYV +
Sbjct: 3    FSRPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADG--SPHYYLGRSYVAN 60

Query: 62   FSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEE 121
             S    L  +E  +  P S   P    + S  +H    L RQTAAL ++   +DG  E E
Sbjct: 61   LS-PPPLAIKERFSGDPTSSSRP----EQSQSIHQSLSLRRQTAALSNE---FDGTFEFE 112

Query: 122  ---EALVFEGNM------ILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQ 172
               E L   GN       ++   A      GP      ++++S +LL       ++  D 
Sbjct: 113  DQLEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLP-----PNTQRDL 167

Query: 173  EAGTRLFLSPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGTRTVR----YIPAV 228
            E G+         ++ H Y ++  +++ S   SRA    + +R     T R    Y+PAV
Sbjct: 168  EYGS-------IDEFDHQYVSLQSQRAGSN--SRAIDPNASMRDKTLFTFRRLGNYVPAV 218

Query: 229  IXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXX 288
            I           SYGMIIFPI EP+FSHLGP GLSMFY+S+++SQLV             
Sbjct: 219  ILGLLLNILDALSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVG 278

Query: 289  XEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLV 348
             EMIE+TPF+H+MA SI  S+  EK D ++TTTIVCYA+S+I+TG VF  LG+L+LGK+V
Sbjct: 279  SEMIEITPFYHSMAASIMASMPGEK-DRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIV 337

Query: 349  SFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLA 408
             FFP HILIGCIGGV YFL+ITG EV+TR +KFEYS  FL +L  DP+IL KW +PAL+A
Sbjct: 338  GFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMA 397

Query: 409  VSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYD 468
            V ++++QR   NS++LP FY++A  LFHFIVALIPSLSL +LRD GW+FP T +   W+D
Sbjct: 398  VLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFD 457

Query: 469  YLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGY 528
            + +LYN + + W LVL ++PTMLALTFFGILHVPINVPALA+S G+DK+DVDKELIAHGY
Sbjct: 458  FYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGY 517

Query: 529  SNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXX 588
            SN  SG  GS+QNYLVYTNS+LFI+AGAD   AG +LA ATF  M  GP           
Sbjct: 518  SNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIV 577

Query: 589  XXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLV 648
                FLLGYELLKE L D++ +L+NFEY TVV I+ TMG FDFVLGIIVG+L+ACFSFLV
Sbjct: 578  GSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLV 637

Query: 649  ESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIG 708
            +ST+ +TI+ EFDG+VA+S   RDY+Q+ FL K+ EQI+VLKLQN LFFGTIISIEEKI 
Sbjct: 638  DSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKID 697

Query: 709  NLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISEC 767
             LLE  +    KK IKYLILDFK+IN DNIDYSAAEGFNRIKR    KRI LI+SSI   
Sbjct: 698  KLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTT 757

Query: 768  DKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKA 827
            D+IY  F+K+G L  VELF DLNSALEWCENE L ++R L ++     VR++ + +  K 
Sbjct: 758  DRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRDLRNKTKLKAVRKQERQL-SKG 816

Query: 828  QIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSKYKASHPALALLLVALKTYR-----SGH 882
             +P  NTPRN   ++ AQ +++ EQ +    + YK   P L LLL AL+ YR        
Sbjct: 817  ALPF-NTPRNNHFVSVAQKLFTDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEK 875

Query: 883  AYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIA 942
              KET+E ++W  L  +F ++  + Q+ +  + ++F VVESG++K+TY L QG L E ++
Sbjct: 876  PVKETEE-KMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILS 934

Query: 943  SKTCYGNISGPGS--LSYSSV-VRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISV 999
             KTCYG I+ P S  +  SSV ++ ET+C LW++D   L KL++ENL LYTELL+V + +
Sbjct: 935  GKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELLLVTLCM 994

Query: 1000 IQHRFKELLGHSLIN 1014
             Q R KELLGH L++
Sbjct: 995  NQDRLKELLGHCLVS 1009

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1052 (47%), Positives = 640/1052 (60%), Gaps = 85/1052 (8%)

Query: 18   EALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSREAGAAG 77
            EA+++ L I    S        VS   P L R       SY+  F   GS          
Sbjct: 16   EAISVSLGINQDSSKNKMHRASVSAMSPPLCR-------SYMSGFFTGGS----SPMVKN 64

Query: 78   PDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEGNMILQEGAP 137
                 LP    Q  + +H   +LHRQTA L   S  +     EE +   +  M + +   
Sbjct: 65   MSDSKLPFSNKQHPTVIHGSENLHRQTAQL---SNEFCSSSVEENSPTIKDYMDIIDSDD 121

Query: 138  PRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTDYIHSYGAINEE 197
                       K D ++  ++ N+DE   D  S      RL LSP +++         + 
Sbjct: 122  R----------KDDQSMRTIVENIDEEYSDEYS------RLLLSPASSNVDDERNRALQS 165

Query: 198  QSASETASRAETGPSPLR-------------LWGT----RTVRYIPAVIXXXXXXXXXXX 240
               SE       G   LR              W T    +   Y+PA +           
Sbjct: 166  GPISELEDDYGGGYQSLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDAL 225

Query: 241  SYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFHT 300
            SYGMIIFPI EP+FSHLGP G+SMFY+STIISQ V              EMIE+TPF+HT
Sbjct: 226  SYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHT 285

Query: 301  MALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCI 360
            MAL++K++L     D+IITTTI CY +S+++TG VF  LGKLRLGK+V FFP HILIGCI
Sbjct: 286  MALAVKDALEG-NDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCI 344

Query: 361  GGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHN 420
            GGV YFLIITGIEV+TRV KFEYS  F   LF + D LAKWL+P LL V +I  QR   N
Sbjct: 345  GGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKN 404

Query: 421  SMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHW 480
            S++LP FY+    LFHFIVA+IP+LSLDTLR+ GWIFP+  S  +WYD+ +L+N  ++HW
Sbjct: 405  SLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHW 464

Query: 481  ELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQ 540
             LVL +IPTM+ALTFFGILHVPINVPALA+S  +DK DVD+ELIAHGYSN FSG  GS+Q
Sbjct: 465  SLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQ 524

Query: 541  NYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELL 600
            NYLVYTNSVLFIRAGADS +AGFLL   T   M  GP               FLLGYELL
Sbjct: 525  NYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELL 584

Query: 601  KEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEF 660
             E L D++N+L+ FEY+TVVII+ TMG+FDFVLGIIVG+L+ACFSFLV+ST+ +TI+ E+
Sbjct: 585  VEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEY 644

Query: 661  DGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGSEYK 719
            +G VAKS  +RDY+Q+ FL+ + EQIYVLKLQN LFFGTIISIEEKI  LL+  N    K
Sbjct: 645  NGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKK 704

Query: 720  KIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGL 779
            + IKYLILDFK+IN DNIDYSAAEGFNRIKR    KRIKLI+SSI E D+IY  F+ +GL
Sbjct: 705  RRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGL 764

Query: 780  LQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKAQIPLE------- 832
            L DVELF DLNSALEWCENE L +Y+ L  +A +    R+   +        +       
Sbjct: 765  LNDVELFADLNSALEWCENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGL 824

Query: 833  ---------------------NTPRNAQIMTAAQAVYSGEQQLNKTLS-KYKASHPALAL 870
                                 NTPRN Q+++ AQ V+  ++Q  K    +YK   P L +
Sbjct: 825  GNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPI 884

Query: 871  LLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLL 926
            LL ALK YR    S       KEI+ W  LCPYF R+  + Q+ +    ++FF+VE+G+L
Sbjct: 885  LLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGML 944

Query: 927  KITYMLPQGSLQEAIASKTCYGNISGPGSL---SYSSVVRTETECVLWMIDAPGLQKLQE 983
            K TY LPQG+L E  ++ TC+G I  PG+         + TET+ VLW+ID+  L+K++E
Sbjct: 945  KATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKE 1004

Query: 984  ENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            ENL LY E+ ++ + +   RFKELLG++L++ 
Sbjct: 1005 ENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1053 (47%), Positives = 650/1053 (61%), Gaps = 87/1053 (8%)

Query: 18   EALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSREAGAAG 77
            EA+++ L I    S        VS   P L R  +Y+   + G  S   + MS       
Sbjct: 16   EAISVSLGINQDSSINKMHRASVSAMSPPLCR--SYMSGFFTGGNSPMINSMS------- 66

Query: 78   PDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEGNM-ILQEGA 136
             DS  LP    Q    +H   +LHRQTA L   S  +     EE +   +  M I+  G 
Sbjct: 67   -DSK-LPLSNKQHPKVIHGSENLHRQTAQL---SNEFCSSSVEENSPTIKDYMDIIDSG- 120

Query: 137  PPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTDYIHSYGAINE 196
                          D    + +  ++E +D+  SD+ +  RL LSP +++         +
Sbjct: 121  --------------DRKDDQSMRTIEEDIDEEYSDEYS--RLLLSPASSNINDDRNRGLQ 164

Query: 197  EQSASETASRAETGPSPLRL-----------------WGTRTVRYIPAVIXXXXXXXXXX 239
                SE     E G   LR                  + ++ + Y+PA +          
Sbjct: 165  NGLTSELEDDYEGGYQSLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDA 224

Query: 240  XSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFH 299
             SYGMIIFPI EP+FSHLGP G+SMFY+STIISQ V              EMIE+TPF+H
Sbjct: 225  LSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYH 284

Query: 300  TMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGC 359
            TMAL++K +L+ +  D+IITTTI CY +S+++TG VF  LGKL+LGK+V FFP HILIGC
Sbjct: 285  TMALAVKEALAGD-DDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGC 343

Query: 360  IGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIH 419
            IGGV YFLIITGIEV+TRV KFEYS  F   LF + D LAKWL+P +L V +I  QR   
Sbjct: 344  IGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFK 403

Query: 420  NSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIH 479
            NS++LP FY+    LFHFIVA+IP+LSLDTLR  GWIFP+  S  +WYD+ +L+N  ++H
Sbjct: 404  NSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVH 463

Query: 480  WELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSI 539
            W LVL +IPTM+ALTFFGILHVPINVPALA+S  +DK DVD+ELIAHGYSN FSG  GS+
Sbjct: 464  WSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSV 523

Query: 540  QNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYEL 599
            QNYLVYTNSVLFIRAGADS +AGFLL   T   M  GP               FLLGYEL
Sbjct: 524  QNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYEL 583

Query: 600  LKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSE 659
            L E L D++N+L+ FEY+TVVII+ TMGIFDFVLGIIVG+L+ACFSFLV+ST+ +TI+ E
Sbjct: 584  LVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGE 643

Query: 660  FDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGSEY 718
            ++G VAKS  +RDY+Q+ FL+ + EQIYVLKLQN LFFGTI+SIEEKI  LL+  N    
Sbjct: 644  YNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDAT 703

Query: 719  KKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIG 778
            K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR  E K+IKLI+SSI E D+IY  F+ +G
Sbjct: 704  KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVG 763

Query: 779  LLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKAQIPLE------ 832
            LL DVELF DLNSALEWCENE L +Y+ L  +A      R+  +IV       +      
Sbjct: 764  LLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINA 823

Query: 833  ----------------------NTPRNAQIMTAAQAVYSGEQQLNKTLSK-YKASHPALA 869
                                  NTPRN Q+++ AQ V+  ++Q  K   K YK   P L 
Sbjct: 824  LGNGLNKGNNIDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLP 883

Query: 870  LLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGL 925
            +LL ALK YR    S       KEI+ W  LCPYF R+  + Q+ +    ++FF+VE+G+
Sbjct: 884  ILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGM 943

Query: 926  LKITYMLPQGSLQEAIASKTCYGNISGPGSL---SYSSVVRTETECVLWMIDAPGLQKLQ 982
            LK TY LPQG+L E  ++ TC+G I  PG+         + TET+ +LW+ID+  L+K++
Sbjct: 944  LKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMK 1003

Query: 983  EENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            EENL LY E+ ++ + +   RFKELLG++L++ 
Sbjct: 1004 EENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1048 (49%), Positives = 667/1048 (63%), Gaps = 72/1048 (6%)

Query: 1    MTKNRRFSAWSHRPSISEALNIQLN-------------IPDSPSGGANAGGPVSERIPTL 47
            M  NR      ++PSISEA+++ L              IP +        G         
Sbjct: 1    MVSNRP----KNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFSHTGDG--------- 47

Query: 48   MRPEAYLGRSYVGSFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAAL 107
              P  YLGRSYV + S     ++R  G   P   PL  +R + S  +H    L RQTAAL
Sbjct: 48   -SPHYYLGRSYVANLSPPP--LARLPGGL-PGELPL-SYRPEQSQSIHQSVSLRRQTAAL 102

Query: 108  CDDSRAYDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDD 167
             +         E E+   FE  +    G     G   ++    + +++  L++   +V D
Sbjct: 103  SN---------EFEDTFEFEDQL---AGVSEDDG---HSTTAEEPSMNGTLISPVSSVPD 147

Query: 168  SDSDQEAGTRLFLSPITTDYIHSYGAIN--EEQSASETASRA-----ETGPSP-----LR 215
            +  D    +   L P   ++   YG+I+  E Q  S  + R+       GP       + 
Sbjct: 148  TPIDINEPSNALLPP-NAEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIGPDASLREKMM 206

Query: 216  LWGTRTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLV 275
                R V Y+PAVI           SYGMIIFPI EP+FSHLGP G+SMFYVS+IISQL+
Sbjct: 207  FTARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLI 266

Query: 276  XXXXXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAV 335
                          EMIE+TPF+H MA SI   L  EK D +++TTIVCYALS+IITG V
Sbjct: 267  YSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEK-DRVLSTTIVCYALSSIITGLV 325

Query: 336  FLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDP 395
            F  LG+LRLGK+V FFP HILIGCIGGV YFL+ITG+EV+TRV KFEYS  FL +LF + 
Sbjct: 326  FFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSSLFTNI 385

Query: 396  DILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGW 455
            ++L KW +PAL+AV ++++Q    NS++LP FY++A  LFHFIVALIPSLSLD LRD GW
Sbjct: 386  EVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGW 445

Query: 456  IFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGID 515
            IFP T+S   W+D+  LYN + + W ++L +IPTMLALTFFGILHVPINVPALA+S G+D
Sbjct: 446  IFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLD 505

Query: 516  KIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTA 575
            K+DVDKELIAHGYSN  SG  GS+QNYLVYTNSVLFIRAG D   AG +LA ATF  M  
Sbjct: 506  KLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATFGIMIV 565

Query: 576  GPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGI 635
            GP               FLLGYELLKE LYD++ +L+NFEY TVV I+ TMG FDFVLGI
Sbjct: 566  GPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGI 625

Query: 636  IVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNL 695
            IVG+L+ACFSFLV+ST+ +T++ EFDG+VA+S   RDY+Q+ FL K+ EQI+VLKLQN L
Sbjct: 626  IVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLL 685

Query: 696  FFGTIISIEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEI 754
            FFGTI+SIEEKI  LLE  +    KK IKYLILDFK+IN DNIDYSAAEGFNRIKR    
Sbjct: 686  FFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSS 745

Query: 755  KRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRV 814
            KRI LI+SSI   D+IY  F+K+G+L+ VELF DLNSALEWCENE L +++ L ++  ++
Sbjct: 746  KRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKT-KL 804

Query: 815  KVRRRSKDIVPKAQIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSKYKASHPALALLLVA 874
            K  ++    + K  +P  NTPRN Q ++ AQ +++ EQ +    S Y+   P L LLL A
Sbjct: 805  KAGKKQDRRMSKVPLPF-NTPRNNQFVSVAQKLFTDEQSMTHLKSSYRERPPVLPLLLSA 863

Query: 875  LKTYR-----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKIT 929
            L+ +R     S  + KE +E RLW  LC YF +K  +  + +  + ++FFV+E+G++K+T
Sbjct: 864  LQRFRPQIMSSDKSVKEGEE-RLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVT 922

Query: 930  YMLPQGSLQEAIASKTCYGNISGPGSLSYSSV---VRTETECVLWMIDAPGLQKLQEENL 986
            Y L QG L E ++ KTCYG +S P + +       V  ET+C LW+ID  GL KL+ ENL
Sbjct: 923  YNLRQGQLYETMSGKTCYGRMSIPNNNNNPISCVEVEMETDCSLWIIDDAGLAKLKRENL 982

Query: 987  PLYTELLVVYISVIQHRFKELLGHSLIN 1014
             LYTE+L+V + + Q R KELLGH L++
Sbjct: 983  NLYTEVLLVTLCINQDRLKELLGHCLVS 1010

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/1010 (48%), Positives = 635/1010 (62%), Gaps = 87/1010 (8%)

Query: 45   PTLMRPEAYLGRSYVGS-FSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQ 103
            P       Y GRSY+G  F ++   M+ +      DS  LP  R ++ S +H    +HRQ
Sbjct: 63   PPFYNSNNYAGRSYLGGGFLSASPKMNLQQ--RNDDSSVLPIDRSRSKS-IHGSQIIHRQ 119

Query: 104  TAALCDDSRAYDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDE 163
            TA L +                                           N S+    ++E
Sbjct: 120  TAELSN-------------------------------------------NFSDDTTGMEE 136

Query: 164  AVDDSDSDQEAGTRLFLSPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGTRTVR 223
              +  D+ ++  + L       DY    G  +E+ + +  +  A    S +  +G   + 
Sbjct: 137  VRNRYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLH 196

Query: 224  YIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXX 283
            Y P+ +           SYGMIIFPI EPIFSHLG  GLSMFY+STIISQ +        
Sbjct: 197  YFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSF 256

Query: 284  XXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLR 343
                  EMIEVTPFFHTMA +I++++  +  DDIITTTI CYA+S+++TG  F  LGKLR
Sbjct: 257  TSGIGSEMIEVTPFFHTMAFAIRDAIPGQ-DDDIITTTIFCYAISSVVTGITFYLLGKLR 315

Query: 344  LGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLI 403
            LGK+V FFP HILIGCIGGV YFL+ITG+ V+TR+ K EY+  FL+ LF+D DIL KWL+
Sbjct: 316  LGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLL 375

Query: 404  PALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESG 463
            P +L + ++  Q+   NS++LP FY+    LFHF+VA++PS+SLD LRD GWIFP   S 
Sbjct: 376  PVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSK 435

Query: 464  GRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKEL 523
             RW+D+ +L++  ++HW LVL +IPTMLALTFFGILHVPINVPALAIS  +DK DVDKEL
Sbjct: 436  DRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKEL 495

Query: 524  IAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXX 583
            IAHGYSN  SG  GSIQNYLVYTNSVLFIRAGADS +AG++LAI TF  M  GP      
Sbjct: 496  IAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFI 555

Query: 584  XXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVAC 643
                     FLLGYELL E L D+  +++NFEYIT+VII+LTMGI+DFVLG+IVG+L+AC
Sbjct: 556  PICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIAC 615

Query: 644  FSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISI 703
            FSFLV+ST+ +TI+ EFDGKVA+S  +RDY+QSNFL  V EQIYVLKLQN LFFGTIISI
Sbjct: 616  FSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISI 675

Query: 704  EEKIGNLLE--PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIV 761
            EEKI  LLE   + S  K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR  + KRIKLI+
Sbjct: 676  EEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLII 735

Query: 762  SSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHR-------- 813
            SSI E D IY +FS +GLL DVELF DLN ALEWCENE L EY+ L  RA          
Sbjct: 736  SSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYNV 795

Query: 814  ---------VKVRRRSKDIVPK----------AQIPLENTPRNAQIMTAAQAVYSGEQQL 854
                      KV   +  I  K          + +P+ NTPRN Q+++ AQ +++ E+ +
Sbjct: 796  TSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPM-NTPRNHQMLSVAQNMFNDEEDV 854

Query: 855  N--KTLSKYKASHPALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQ 908
            +  +  S      P L LLL ALK+YR    S   +   +E +LW  L PYFV++  + Q
Sbjct: 855  DALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQ 914

Query: 909  TSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISG---PGSLSYSSVVRTE 965
            + +    D FFVVESGLLKI   LPQG + E ++++TC GNI G     S  +   + TE
Sbjct: 915  SILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTE 974

Query: 966  TECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            T+  LW+ID  GLQKL+ ENL LYTEL+++ + +   RF++LLG++L++ 
Sbjct: 975  TDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1014 (49%), Positives = 636/1014 (62%), Gaps = 74/1014 (7%)

Query: 54   LGRSYVGSFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRA 113
            L RSY+  F   GS             P LP    Q    +H   +LHRQTA L   S  
Sbjct: 46   LCRSYMSGFFTGGS----SPMNYNMSDPKLPFSNKQHPKVIHGSENLHRQTAQL---SNE 98

Query: 114  YDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDD------ 167
            +     EE +   +  M + +              K D ++  +  N+DE   D      
Sbjct: 99   FCSSSVEENSPTIKDYMDIIDSDDR----------KDDQSMRTIEENIDEEYADEYSRLL 148

Query: 168  -----SDSDQEAGTRLFLSPITTDYIHSYGAINEEQSASETASRAETGPSPLRLWGT--- 219
                 S+ D E    L  SP T+D    +G   +    S        GP  +  W T   
Sbjct: 149  LSPASSNVDDERNRALQGSP-TSDLEDGHGGGYQSVHPSHDL---RFGPRSVWQWFTSFP 204

Query: 220  -RTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXX 278
             +  +Y+PA +           SYGMIIFPI EP+FSHLGP G+SMFY+STIISQ V   
Sbjct: 205  SKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSG 264

Query: 279  XXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLT 338
                       EMIE+TPF+HTMAL IK +L     D+IITTTI CY +S+++TG VF  
Sbjct: 265  GWSSFPSGVGSEMIEITPFYHTMALGIKEALVGS-DDEIITTTIFCYVISSMLTGVVFYV 323

Query: 339  LGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDIL 398
            LGKLRLGK+V FFP HILIGCIGGV YFLIITGIEV+TRV KFEYS  F+  LF + D L
Sbjct: 324  LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTL 383

Query: 399  AKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFP 458
            AKWL+P LL V +I  QR   NS++LP FY+    LFHFIVA+IP+LSLDTLRD GWIFP
Sbjct: 384  AKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFP 443

Query: 459  LTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKID 518
            +  S  +WYD+ +L+N  ++HW LVL +IPTM+ALTFFGILHVPINVPALA+S  +DK D
Sbjct: 444  IASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYD 503

Query: 519  VDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPW 578
            VDKELIAHGYSN FSG  GS+QNYLVYTNSVLFIRAGADS +AGFLL   T   M  GP 
Sbjct: 504  VDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPV 563

Query: 579  XXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVG 638
                          FLLGYELL E L D++++L+ FEY+TVVII+ TMGIFDFVLGIIVG
Sbjct: 564  IISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVG 623

Query: 639  VLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFG 698
            +L+ACFSFLV+ST+ +T++ E++G VAKS  +RDY+Q+ FL+ + EQIYVLKLQN LFFG
Sbjct: 624  ILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFG 683

Query: 699  TIISIEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRI 757
            TIISIEEKI  LLE  N    K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR  E KRI
Sbjct: 684  TIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRI 743

Query: 758  KLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVR 817
            KLI+SSI E D IY  F+ +GLL DVELF DLN ALEWCENE L +Y+ L  +A +    
Sbjct: 744  KLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYKQLREKAKKRLEE 803

Query: 818  RRSKDIVP------------KAQIPLE----------------NTPRNAQIMTAAQAVYS 849
            R+  ++V             ++ I L                 NTPRN Q+++ AQ V++
Sbjct: 804  RKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFA 863

Query: 850  GEQQLNKTLSK-YKASHPALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKS 904
             ++Q  K L K YK   P L +LL ALK YR    S       KEI+ W  LCPYF R+ 
Sbjct: 864  NDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFSRRR 923

Query: 905  FSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSL---SYSSV 961
             + Q+ +    ++FF++E+G+LK  Y LPQGSL E +++ TC+G I  PG+         
Sbjct: 924  LASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQKLT 983

Query: 962  VRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            + TET+ +LW+ID+  L+K++EENL LY E+ ++ + +   RFKELLG++L++ 
Sbjct: 984  IETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1056 (48%), Positives = 643/1056 (60%), Gaps = 93/1056 (8%)

Query: 18   EALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSREAGAAG 77
            EA+++ L I    S        VS   P L R  +Y+     G F+   S M      + 
Sbjct: 16   EAISVSLGINQDSSVNKMHRASVSAMSPPLCR--SYMS----GFFTGGNSPMINNLSDS- 68

Query: 78   PDSPPLPRFRDQASSYVHNGSHLHRQTAALCDD---SRAYDGGPEEEEALVFEGNMILQE 134
                 LP    Q    +H   +LHRQTA L ++   S   +  P  ++ +   GN     
Sbjct: 69   ----KLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG---- 120

Query: 135  GAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTDYIHSYGAI 194
                            D    + +  ++E +D+  SD+   +RL LSP +++        
Sbjct: 121  ----------------DRKDDQSMRTIEENIDEEYSDEY--SRLLLSPASSNVDDDRNRG 162

Query: 195  NEEQSASETASRAETGPSPLR-----------LWG------TRTVRYIPAVIXXXXXXXX 237
             +  S  E       G   LR           LW       ++   Y+PA +        
Sbjct: 163  LQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNIL 222

Query: 238  XXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPF 297
               SYGMIIFPI EP+FSHLGP G+SMFY+STIISQ V              EMIE+TPF
Sbjct: 223  DALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPF 282

Query: 298  FHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILI 357
            +HTMAL+IK +L A   D+IITTTI CY +S+++TG VF  LGKLRLGK+V FFP HILI
Sbjct: 283  YHTMALAIKEAL-AGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILI 341

Query: 358  GCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRR 417
            GCIGGV YFLIITGIEV+TRV KFEYS  F   LF D D LAKWL+P LL V +I  QR 
Sbjct: 342  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRY 401

Query: 418  IHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQR 477
              NS++LP FY+    LFHFIVA+IP+LSLD LR  GWIFP+  S  +WYD+  L+N  +
Sbjct: 402  FKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHK 461

Query: 478  IHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAG 537
            +HW LVL +IPTM+ALTFFGILHVPINVPALA+S  +DK DVD+ELIAHGYSN FSG  G
Sbjct: 462  VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521

Query: 538  SIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGY 597
            S+QNYLVYTNSVLFIRAGADS +AGFLL   T   M  GP               FLLGY
Sbjct: 522  SVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGY 581

Query: 598  ELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTIS 657
            ELL E L D++N+L+ FEY+TVVII+ TMGIFDFVLGIIVG+L+ACFSFLV+ST+ +TI+
Sbjct: 582  ELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTIN 641

Query: 658  SEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGS 716
             E++G VA+S  +RDY+Q+ FL+ + EQIYVLKLQN LFFGTIISIEEKI  LL+  N  
Sbjct: 642  GEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKD 701

Query: 717  EYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSK 776
              K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR  E KRIKLI+SSI E D+IY  F+ 
Sbjct: 702  ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNN 761

Query: 777  IGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKA--------- 827
            +GLL DVELF DLNSALEWCENE L +Y+ L  +A       +  ++V            
Sbjct: 762  VGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKI 821

Query: 828  --------------------QIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSK-YKASHP 866
                                 +P  NTPRN QI++ AQ V+  ++Q  K   K YK   P
Sbjct: 822  DTIGNGLNRGSNGDTARNLMSLP-TNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEP 880

Query: 867  ALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVE 922
             L +LL ALK YR    S       KEI+ W  LCPYF R+  + Q+ +    ++FF+VE
Sbjct: 881  VLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVE 940

Query: 923  SGLLKITYMLPQGSLQEAIASKTCYGNISGPGSL---SYSSVVRTETECVLWMIDAPGLQ 979
            +G+LK TY LPQG+L E  ++ TC+G I  PG+         + TET+ VLW+ID+  L 
Sbjct: 941  TGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLN 1000

Query: 980  KLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            KL+E+NL LY E+ ++ + +   RFKELLG++L++ 
Sbjct: 1001 KLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1049 (47%), Positives = 660/1049 (62%), Gaps = 80/1049 (7%)

Query: 24   LNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSREAGAAGPDSPPL 83
            LN+   P+   N G P ++          +LGRSYV     SG L S  +   G +   L
Sbjct: 45   LNVNARPNT-KNVGIPNND-------TNTFLGRSYV-----SGILGS--SLPQGGERNTL 89

Query: 84   PRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEGNMILQEGAPPRFGVG 143
            P      S  +H  + LHRQTAA+ ++    DG   E  + + E   +L E       + 
Sbjct: 90   PVSNKFGSRAIHEQNKLHRQTAAIAEEFD--DGTIGESPSSLKEYLNLLDEAQEEELDLR 147

Query: 144  PYNLCKVD---SNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTDYIHSYGAINEEQSA 200
                   D    N + V +N+  A   +D + E  T   L+P +++   +YG+++ E++ 
Sbjct: 148  NRRDLDNDLITDNKTPVSINLKRA---TDPELEQQTVALLTPSSSNN-DNYGSVSPEENF 203

Query: 201  SETASRAET-------------------GPSPLRLWGT--RTVRYIPAVIXXXXXXXXXX 239
                S  E                      +  + W T  R   Y+PA I          
Sbjct: 204  LSATSNYEQESTYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPAAILGLLLNILDA 263

Query: 240  XSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFH 299
             SYGMIIFPI EPIF+ LGP G+SMFY+STIISQ +              EMIE+TPF+H
Sbjct: 264  LSYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYH 323

Query: 300  TMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGC 359
            TMAL+I  +L   + D+IITTTI CY +S++ITG  F  LGKLRLGK+V FFP HILIGC
Sbjct: 324  TMALAISQALPG-RDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGC 382

Query: 360  IGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIH 419
            IGGV YFLIITG+EV+TR+ KFEYS+ FL  LF+D  +L KWL+P +L + +I+ Q+   
Sbjct: 383  IGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFK 442

Query: 420  NSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIH 479
            NS++LP FY+    LFHF+VA+ P+LSL  LR  GWIFP  E   +WYD+   ++  + H
Sbjct: 443  NSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAH 502

Query: 480  WELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSI 539
            W LV+ +IPTMLALTFFGILHVPINVPALA+S  +DK DVDKELIAHGYSN FSG  GS+
Sbjct: 503  WSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSV 562

Query: 540  QNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYEL 599
            QNYLVYTNSVLFIRAGADS  AG++L + T M M  GP               FLLGYEL
Sbjct: 563  QNYLVYTNSVLFIRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYEL 622

Query: 600  LKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSE 659
            L E + D + +++ FEY T+ II+LTMGIFDFVLGI+VG+L+ACFSFLV+ST+ +T++ E
Sbjct: 623  LVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGE 682

Query: 660  FDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEYK 719
            FDG VAKS  +RD+ Q+ FL ++ EQIYVLKLQN LFFGTIISIEEKI  LLE + ++  
Sbjct: 683  FDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVS 742

Query: 720  K-IIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIG 778
            K  IK+LILDFK+IN DNIDYSAAEGFNRIKR  E KRIKLI+S+I E D+IY +F+++G
Sbjct: 743  KHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVG 802

Query: 779  LLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDI-------------VP 825
            LLQD+ELF DLNSALEWCENE L +Y+ L  +A R K++RRSK+I               
Sbjct: 803  LLQDIELFNDLNSALEWCENEFLYQYKELREKA-RNKLQRRSKNINAAIGNQLRRYDQTN 861

Query: 826  KAQIPL-----------ENTPRNAQIMTAAQAVYSGEQQLNKTL-SKYKASHPALALLLV 873
            K Q P             NTPRN Q+++AAQ  +S EQQ++  + +K K   P L +LL 
Sbjct: 862  KNQGPTSSLMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLF 921

Query: 874  ALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKIT 929
            ALK YR    S    K T E+  WK LCPYF RK F+  T+     + FF+V++G+LK+ 
Sbjct: 922  ALKLYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVI 981

Query: 930  YMLPQGSLQEAIASKTCYGNI---SGPGSLSYSSVVRTETECVLWMIDAPGLQKLQEENL 986
            Y LP GS+ E +++ TCYG I       +++ +  V+ ET+ +LW+ID   ++ ++ +N+
Sbjct: 982  YNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNI 1041

Query: 987  PLYTELLVVYISVIQHRFKELLGHSLING 1015
             LYTEL+++ +++   RFKELLG++L++ 
Sbjct: 1042 VLYTELVLLILAIRDTRFKELLGYTLVSA 1070

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1046 (48%), Positives = 671/1046 (64%), Gaps = 72/1046 (6%)

Query: 13   RPSISEALNIQL-----NIPDSPSGGANAGGPVSERIPTLMRPEA-YLGRSYVGSFSNSG 66
            R SISEA+++ L     N P     G N   P   +    M P   YLGRSYV     SG
Sbjct: 15   RHSISEAISVSLGLQNTNTPRDHHDG-NHSNPYDSQNDQFMSPRNNYLGRSYV-----SG 68

Query: 67   SLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVF 126
             L     G+   +S  LP  R +  S +H   +LHRQTA LC+D       P  E+  + 
Sbjct: 69   FLSCSPYGSNSLESDRLPIARMRTKS-IHAAKNLHRQTAKLCEDFNE----PNVEDNNIQ 123

Query: 127  EGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTD 186
            +     +E  P           + D   + V +N ++  DD +   E+        + T 
Sbjct: 124  DYVSATEEPRPMEISDAERMYDQEDELRNPVHVNTEDRGDDIEDVYES--------LVTG 175

Query: 187  YIHSYGAINEEQSAS-ETASRAETGPSPLRLW------GTRTVRYIPAVIXXXXXXXXXX 239
                Y AI         T+SR+        LW       ++ V Y+PA I          
Sbjct: 176  AHGGYRAIPTSPGGGLRTSSRSA-------LWRQFMSSSSKLVHYLPATILGLLLNVLDG 228

Query: 240  XSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFH 299
             SYGMIIFPI EPIFSHLGP GLSMFYVSTIISQ++              EMIEVTPFFH
Sbjct: 229  LSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFH 288

Query: 300  TMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGC 359
            +MAL+IK++L   + D+I+TTTI CY +S+++TG  F  LGK++LGK+V FFP HILIGC
Sbjct: 289  SMALAIKDALPG-RDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGC 347

Query: 360  IGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIH 419
            IGGV YFL++TG+EV+TRV K EY+  F+ ++F D   L KW++P LL V +I+ QR   
Sbjct: 348  IGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQ 407

Query: 420  NSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIH 479
            NS++LP FY++    FHF+VA+IP++SL  LR+ GWIFP+  S  +WYD+ +L+ P R+H
Sbjct: 408  NSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVH 467

Query: 480  WELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSI 539
            W L+  + PTMLAL+FFGILHVPINVPALAIS  +DK DVDKELIAHGYSN+ SG  GSI
Sbjct: 468  WGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSI 527

Query: 540  QNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYEL 599
            QNYLVYTNS+LFIRAGADS  AG+LLA  TF+ M  GP               FLLGYEL
Sbjct: 528  QNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYEL 587

Query: 600  LKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSE 659
            L E L ++  +++NFEYIT+ II+LTMGIFDFVLG+IVG+L+ACFSFLV+ST+ +TI+ E
Sbjct: 588  LYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGE 647

Query: 660  FDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEY- 718
            +DGK+AKS  +RDY+QS FL+ + EQIYVLKLQ+ LFFGTIISIEEKI  LLE +  +  
Sbjct: 648  YDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKN 707

Query: 719  -KKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKI 777
             K+ IK LILD K+IN DNIDYSAAEGFNRIKR  + K I+LI+SSISE D IYT FSK+
Sbjct: 708  SKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKV 767

Query: 778  GLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSK-------------DIV 824
             LL DVELF DLN ALEWCENELL +Y+ L ++A R +++ + +             D V
Sbjct: 768  KLLDDVELFGDLNGALEWCENELLFKYKELRAKA-RDRLQNKMQMANLAANNDTKAIDGV 826

Query: 825  PKAQ-------IPLENTPRNAQIMTAAQAVYSGEQQLNKTLS-KYKASHPALALLLVALK 876
            PK+        +P  NTPRN Q+++ AQ V+  EQ+   +L   YK   P L LLL ALK
Sbjct: 827  PKSHHMQNLMSLPF-NTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLFALK 885

Query: 877  TYRSGHAYKETK----EIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYML 932
             YR G   ++T     E+ LW  LCPYF R+  + Q+ +    D+FFV+E+G+LKI Y L
Sbjct: 886  PYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDL 945

Query: 933  PQGSLQEAIASKTCYGNISGPGSLSYSS---VVRTETECVLWMIDAPGLQKLQEENLPLY 989
            PQG + E+++++TCYG +  PG+   S     ++TETE VLW+ID+  L +L++ENL LY
Sbjct: 946  PQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLY 1005

Query: 990  TELLVVYISVIQHRFKELLGHSLING 1015
            TEL+++  +V + R++++LG++L++ 
Sbjct: 1006 TELILLIATVKEQRYRQILGYTLVSA 1031

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1063 (47%), Positives = 665/1063 (62%), Gaps = 72/1063 (6%)

Query: 11   SHRPSISEALNIQLNIPDS-PSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLM 69
            ++R SIS+ +++ L + +  P       G  +  +  +     YLGRSYV     SG L 
Sbjct: 6    NNRHSISDTISVSLGLQNQDPQILQQPNGGPTVTLGNMSDTSNYLGRSYV-----SGFLS 60

Query: 70   SREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEGN 129
            +  A     ++  LP      +  +H   +LHRQTAA+ +D   ++  P  E+ +  +  
Sbjct: 61   ASPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISED---FNNDPTFEDDINMKEY 117

Query: 130  MI-LQEGAPPRFGVGPYNLCKVDSN--ISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTD 186
            +  L++ A    G   Y    +D+   I  +L    E V D    Q+  +RL LSPI +D
Sbjct: 118  ISNLEDDATGNNG-KRYTAYYIDNEDRIDNILTEEAEPVTDF-YPQDENSRLLLSPIPSD 175

Query: 187  YI----HSYGAINEEQSASETASRAETGP--------------SPLRLWG------TRTV 222
             +    +   +I+E++   ETA R  T                S +  W       +  +
Sbjct: 176  SLLAGENLLPSISEQEQ--ETAQRRRTSAYQSIRHRNSESTEYSSIPTWRKYIATPSEII 233

Query: 223  RYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXX 282
            +Y+PA I           SYGMIIFPI EPIFSHLGP G+SMFY+STIISQ +       
Sbjct: 234  QYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWSS 293

Query: 283  XXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKL 342
                   EMIEVTPFFHTMA +IK++L    +DDIITTT+ CY +S+++TG  F +LGKL
Sbjct: 294  FPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKL 353

Query: 343  RLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWL 402
             LGK+V FFP HILIGCIGGV YFLIITGIEVSTRV KF+Y++ F+ +LF D   L +WL
Sbjct: 354  HLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWL 413

Query: 403  IPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTES 462
            +P LL V +I+ Q+   NS++LP FY+    LFHF+VA+IPSLSL+ LRD GWIFP   +
Sbjct: 414  LPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAAT 473

Query: 463  GGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKE 522
              +WYD+ +L+N  ++HW L+L +IPTMLALTFFGILHVPINVPALA+S  +D+ DVDKE
Sbjct: 474  DSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDKE 533

Query: 523  LIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXX 582
            LIAHG SN  SG  GSIQNYLVYTNSVLFIRAGADS  AG +L + T + M  GP     
Sbjct: 534  LIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIISF 593

Query: 583  XXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVA 642
                      FLLGYELL E L D   ++S FEYIT+VII+ TMGIFDFVLG+IVG+L+A
Sbjct: 594  IPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIA 653

Query: 643  CFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIIS 702
            CFSFL++ST+ +TI+ EFDG VAKS  +RD +Q+ FL  + EQIYVLKLQN LFFGTIIS
Sbjct: 654  CFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIIS 713

Query: 703  IEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIV 761
            IEEKI  LLE  +    K  IKYLILDFK+IN DNIDYSAAEGFNRIKR  + KRI+LI+
Sbjct: 714  IEEKIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLII 773

Query: 762  SSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSK 821
            SSI E D IY  F+ +GLL+ VELF DLNSALEWCENE L +Y++L  R    + R+   
Sbjct: 774  SSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYKTL--REKTRQKRKNKI 831

Query: 822  DI------------------VPKAQIPLE-NTPRNAQIMTAAQAVYSGEQQLNKTLSKYK 862
            DI                  +P+  + L  NTPRN Q+++ AQ V+  E+Q  K L +  
Sbjct: 832  DINLAITNGNPTEERNMHLEIPRNIMSLPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQF 891

Query: 863  ASHPA-LALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDM 917
             + P+ L LLL  LK YR    S     E KEI+ W  LCPY   +    Q+++    + 
Sbjct: 892  KNEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNF 951

Query: 918  FFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLS-----YSSVVRTETECVLWM 972
            FF+VESG+LK T+ LP G+L E ++++TCYG I G  + +         ++TET+C LW+
Sbjct: 952  FFIVESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNEQDLTIKTETDCNLWV 1011

Query: 973  IDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            ID   L +++ ENL LY EL+++ +S+   RFKELLG++L++ 
Sbjct: 1012 IDMDALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1030 (48%), Positives = 659/1030 (63%), Gaps = 93/1030 (9%)

Query: 53   YLGRSYVGSF-SNSGSLMSREAGAAGPDSPPLPRFRDQASSY----VHNGSHLHRQTAAL 107
            Y+GRSYV  F S S +LM    G+   D   LP   +         +H    LH+QTAA+
Sbjct: 49   YMGRSYVSGFLSVSPALM----GSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAI 104

Query: 108  C-------------DDSRAYDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNI 154
                          D    + G   E+  L+ + N  L +    R G+G       D   
Sbjct: 105  SEDFEDDEDDTRIKDYITLFQG---EDNGLMADKNDSLDQ----RLGLGQ------DEEA 151

Query: 155  SEVLLN-VDEAVDDSDSDQEAGTRLFLSP---------------ITTDYIHSYGAINEEQ 198
             E  +  V EA D  +S     +RL +SP               +T + + SY +I   +
Sbjct: 152  EEDFIEPVAEAADVDES-----SRLLISPLSSNINPNIDDLLPTVTGEDVSSYQSI--YR 204

Query: 199  SASETASR-AETGPSPLRLWGTRTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHL 257
            +A+ + SR +ET    +  +  + + Y+PA +           SYGMIIFPI EPIFSHL
Sbjct: 205  TATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHL 264

Query: 258  GPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDI 317
            GP GLSMFY+STIISQ +              EMIEVTPFFHTMAL+IK +L   + D+I
Sbjct: 265  GPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPG-RDDEI 323

Query: 318  ITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTR 377
            ITTTI CY +S+++TG  F +LGKL LGK+V FFP HILIGCIGGV YFL++TGIEV+TR
Sbjct: 324  ITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTR 383

Query: 378  VTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHF 437
            V KFEYS+ FL +LF D   L KWL+P LL V +I+ QR   NS++LP FY+    LFHF
Sbjct: 384  VAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHF 443

Query: 438  IVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFG 497
            IVA+IPSL+L+ LRD GWIFP+  S  +WYD+ +L++ +++HW LV  +IPTMLALTFFG
Sbjct: 444  IVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFG 503

Query: 498  ILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGAD 557
            ILHVPINVPALA+S  +DK DVDKELIAHG SN  SG  GSIQNYLVYTNSVLFIRAGAD
Sbjct: 504  ILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGAD 563

Query: 558  SRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYI 617
            S  AG++L I T + M  GP               FLLGYELL E L+D + ++SNFEYI
Sbjct: 564  SAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYI 623

Query: 618  TVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSN 677
            T+VII+LTMGIFDFVLGIIVG+L+ACFSFL++ST+ +TI+ E+DG VAKS  +RD +Q+ 
Sbjct: 624  TIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTK 683

Query: 678  FLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEYKKI-IKYLILDFKHINIDN 736
            FL  + EQIYVLKLQN LFFGTIISIEEKI  LLE    +  ++ IKYLILDFK+IN DN
Sbjct: 684  FLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADN 743

Query: 737  IDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWC 796
            IDYSAAEGFNRIKR  + K+I+L++SSI E D IY  F  +GLL+ VELF DLNSALEWC
Sbjct: 744  IDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWC 803

Query: 797  ENELLCEYRSLL----SRAHRVKV------------------RRRSKDIVPKAQIPLE-N 833
            ENE L +Y+ L     SR HR ++                   ++S   +P+  + L  N
Sbjct: 804  ENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPIN 863

Query: 834  TPRNAQIMTAAQAVYSGEQQLNKTL-SKYKASHPALALLLVALKTYRSG-----HAYKET 887
            TPRN QI++ AQ V+  E+Q  K L ++ K   P L LLL  LK YR G        KE 
Sbjct: 864  TPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKE- 922

Query: 888  KEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCY 947
             EI+ W  LCPYFV+   + Q+++    ++FF+VE+G+LK T+ LPQG++ E ++++TCY
Sbjct: 923  NEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCY 982

Query: 948  GNISGPGSLSY--SSVVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFK 1005
            G I+G  + S   +  +R E + +LW+ID+  L K++ EN  L+TEL ++ ++V  +RFK
Sbjct: 983  GKITGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFK 1042

Query: 1006 ELLGHSLING 1015
            ELLG++L++ 
Sbjct: 1043 ELLGYTLVSA 1052

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1034 (47%), Positives = 645/1034 (62%), Gaps = 57/1034 (5%)

Query: 11   SHRPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMS 70
            S R S+S++++  L + D  S  A     +S           YL RSY+        L+ 
Sbjct: 13   SKRLSLSDSISRSLGLQDQESNIAGTDNELSNS------KSNYLSRSYMYG------LLP 60

Query: 71   REAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEGNM 130
                    ++  LP   D  +  +H    LH+QTAA+C+D    D G  ++     E   
Sbjct: 61   SATPVEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENT- 119

Query: 131  ILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSP-------- 182
                    R  +  +   K    ++ VL    + V+    +Q+  +RL L+P        
Sbjct: 120  -------DRDNINEH---KESLPVTVVLSTPADEVE----EQDESSRLLLTPSSSNAEVS 165

Query: 183  -ITTDYIHSYGAI--NEEQSASETASRAETGPSPLRLWGTRTVRYIPAVIXXXXXXXXXX 239
             I     H Y +I   ++ +      +  T    L  +   T++Y PA +          
Sbjct: 166  SIAEGLRHHYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDA 225

Query: 240  XSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXXXXXXXEMIEVTPFFH 299
             SYGMIIFPI+EPIFSHLGP G+SMFY+STII Q +              EMIE+TPFFH
Sbjct: 226  LSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFH 285

Query: 300  TMALSIKNSLSAEKSDD-IITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIG 358
            TMA +I  SL  E++ D IITTTI CY +S++ TG  FLTLGKLRLGK+V FFP HILIG
Sbjct: 286  TMAFAIMRSLPGEENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIG 345

Query: 359  CIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRI 418
            CIGGV YFL+ITGIEV+TR+ KFEYSL  ++ LF D  +L KWL P LL V +IL Q+  
Sbjct: 346  CIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCF 405

Query: 419  HNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRI 478
              S++LP FY++   LFHFIVA+IP LSL  LR+ GWIF  T     WYD+ +L++  ++
Sbjct: 406  KRSLVLPSFYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKV 465

Query: 479  HWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGS 538
            HW LV  +IPTMLALTFFGILHVPINVPALA+S  +DK DVDKELIAHG SN+ SG  GS
Sbjct: 466  HWLLVFKQIPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGS 525

Query: 539  IQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYE 598
            IQNYLVYTNSVLFIRAGADS +AG+LL   T + M  GP               FLLGYE
Sbjct: 526  IQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYE 585

Query: 599  LLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISS 658
            LL E L D++++L+ FEY+TVV+I+LTMGI DFVLGIIVG+L+ACF FL++S++ +TI+ 
Sbjct: 586  LLVEALLDTWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTING 645

Query: 659  EFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGSE 717
            EF GKVAKS  +RD +QS FL  + +QIYVLKLQN LFFGTIISIEEKI  LLE  + + 
Sbjct: 646  EFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNS 705

Query: 718  YKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKI 777
             K+ IKYLILDF++IN DNIDYSAAEGFNRIKR+ E K I+LI+SSI   D+IY  F+K+
Sbjct: 706  SKRQIKYLILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKV 765

Query: 778  GLLQDVELFQDLNSALEWCENELLCEYRSLLSR--AHRVKVRRRSKD---IVPKAQIPLE 832
            GLL  VELF DLN ALEWCENE L +Y+ +  R     VK    S D     P A     
Sbjct: 766  GLLVGVELFNDLNGALEWCENEFLYQYKMIRERIKIKNVKTATHSSDGNLSKPSAMTLSI 825

Query: 833  NTPRNAQIMTAAQAVYSGEQQ-LNKTLSKYKASHPALALLLVALKTYR----SGHAYKET 887
            NTPRN QI + AQ ++  E+Q +++  ++++   P L LLL ALK YR    S    K+ 
Sbjct: 826  NTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKG 885

Query: 888  KEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCY 947
            KEI  W  L PYF +K  + Q+ +    ++FF+VE G+LK+T+ LPQG + E ++ + CY
Sbjct: 886  KEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACY 945

Query: 948  GNISGPGSLSYSS-------VVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVI 1000
            G I G   +S +        +++TE + V+W+ID+  L+K+++EN+ LY EL+++ +++ 
Sbjct: 946  GKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIK 1005

Query: 1001 QHRFKELLGHSLIN 1014
              RFK LLGH+L++
Sbjct: 1006 DIRFKSLLGHALVS 1019

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1044 (46%), Positives = 637/1044 (61%), Gaps = 78/1044 (7%)

Query: 41   SERIPTLMRPEAYLGRSYVGSF----------SNSGSLMSREAGAAGPDSPPLPRFRDQA 90
            S ++PT      YLGRSYVGSF          SN+ S  +  +    P   P   F  + 
Sbjct: 24   SFQMPT---TSTYLGRSYVGSFISPPMEYRSNSNTTSNNNNNSNVGDPFKSP---FSSEG 77

Query: 91   SSYVHNGSHLHRQTAALCDDSRAYDGGPEEEEALVFEGN------------MILQE---- 134
            S  +H   +LH+QTA L + +   D G +E      +GN            MI++E    
Sbjct: 78   SKLIHESGNLHKQTAFLSN-TFDNDAGNDEGAGFPLDGNDDEFNLEQNDIDMIVEEDQML 136

Query: 135  -GAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSD--------------------SDQE 173
              +  R G    +        + ++   D A+  +D                    SD  
Sbjct: 137  QNSQRRRGRMSVDAAADIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDST 196

Query: 174  AGTRLFLSPITTDYIHSYGAINEE-QSASETASRAETGPS-----------------PLR 215
                L  +         YG  +EE Q A++  S    G S                   R
Sbjct: 197  ENLALLPTNSHNSMYVEYGTFDEENQPATQYISLLPDGASSGGFTSQGFRSSMSHYDKAR 256

Query: 216  LWGTRTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLV 275
                R  +Y PAV            SYGMIIFPI EP+FSHLGP GLSMFYVST+I QL 
Sbjct: 257  DLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQLC 316

Query: 276  XXXXXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAV 335
                          EMIE+TPFFHTMALSI NS+     + +I+TTIVCYALS+IITG  
Sbjct: 317  FSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSIITGLT 376

Query: 336  FLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDP 395
            F  LGK+RLGK+V FFP HILIGCIGGV YFLIITG+EV TRV +F+YS  FL +LF D 
Sbjct: 377  FFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTDF 436

Query: 396  DILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGW 455
            DIL KWL P +L + +I +Q RIHNS++LP FY+    LFHF+VAL+PSLSLD LRD GW
Sbjct: 437  DILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFGW 496

Query: 456  IFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGID 515
            IF    +   WYD+ +LY+ + + W L+  ++PTMLALTFFGILHVPINVPALA+S  +D
Sbjct: 497  IFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNVD 556

Query: 516  KIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTA 575
            K DVDKELIAHGYSN+ SG  GSIQNYLVYTNSVLFIRAGADS  AG +L I TF+ M  
Sbjct: 557  KYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVI 616

Query: 576  GPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGI 635
            GP               FLLGYEL++E + D++ +L  FEY+T+ II++TMG+ DFV+GI
Sbjct: 617  GPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIGI 676

Query: 636  IVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNL 695
            IVG+L+ACFSFLV ST+ +TI+ E+DGKVAKS  +RDY+QS FL  + EQIYVLKLQN L
Sbjct: 677  IVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNIL 736

Query: 696  FFGTIISIEEKIGNLLEPNGSE-YKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEI 754
            FFGTIISIEEK+ +LLE   S+  KK IKYLILDFK+I   +IDYSAAEGFNRIKR +E 
Sbjct: 737  FFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEK 796

Query: 755  KRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRV 814
            +RI LI+SSI + D+IY  F K+ L ++VELF DLN ALEWCENE L  Y+ + ++    
Sbjct: 797  ERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRAR 856

Query: 815  KVRRRSKDIVPKAQIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSKYKASHPALALLLVA 874
            K+ +  K     +++P+ NTPRN Q ++  + +Y+ E ++ K  ++ K     L + L++
Sbjct: 857  KLAQLKKSQNRMSKLPV-NTPRNHQFVSEVRNIYTEEMEIQKLSNELKERQQFLPIFLMS 915

Query: 875  LKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITY 930
            ++ +R    S +  K T E+ LWK L  YF +K F P T I    +MF VVESG+L +T+
Sbjct: 916  IRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTH 975

Query: 931  MLPQGSLQEAIASKTCYGNISGPGSLSYSSVVRTETECVLWMIDAPGLQKLQEENLPLYT 990
             L QG   E ++ KT YG IS   S   +  + T+TECVL  IDA  L  L+  +  L+T
Sbjct: 976  HLIQGEFYETMSPKTAYGVISNVNSDPLAVSITTDTECVLRYIDAESLADLKLTDPELFT 1035

Query: 991  ELLVVYISVIQHRFKELLGHSLIN 1014
            ELL++ +++ + RF+ELLG+SLI+
Sbjct: 1036 ELLILVMAIHRDRFRELLGYSLIS 1059

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1094 (45%), Positives = 655/1094 (59%), Gaps = 110/1094 (10%)

Query: 13   RPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSRE 72
            R SISE++++ L + ++ +  ++   P+      L    +YLGRSYV    +     ++ 
Sbjct: 14   RQSISESISVSLGLQNNDARQSDNENPLQ----VLPGESSYLGRSYVSGLWSP----TQR 65

Query: 73   AGAAGPDSPPLPRFRDQA-SSYVHNGSHLHRQTAALCD---DSRAYDGGP---------- 118
               +G D   LP   +QA S  +H    LHRQT A+ +   DS   +G            
Sbjct: 66   NNKSGYDL--LPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDL 123

Query: 119  -EEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTR 177
             E  E      + + Q G       GP     V  N +     V   + D     +  +R
Sbjct: 124  VEHNERKTANIDNVDQIGG---LATGPQ--TTVPGNKTH---PVTSPLSDEYGIPDENSR 175

Query: 178  LFLSPITT--------------DY----------IHSYGAINEEQSASETASRAETGPSP 213
            L L+P+++              DY          I+S         +S +++  + GP  
Sbjct: 176  LLLTPVSSLSVAISDASSLTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPI 235

Query: 214  LRLW------GTRTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYV 267
               W          V Y+PA I           SYGMIIFPI EPIFS LGP GLSMFY+
Sbjct: 236  TSKWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYI 295

Query: 268  STIISQLVXXXXXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYAL 327
            ST+ISQ                EMIEVTPFFHTMAL+I  +L  E+ ++IITTTI CY +
Sbjct: 296  STVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVI 355

Query: 328  STIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAF 387
            S++ TG  F TLGKL+LGKLV FFP HILIGCIGGV YFL+ITGIEV TR+ KFEYS+ F
Sbjct: 356  SSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPF 415

Query: 388  LRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSL 447
            L NLF D   L +WL+P +L + +I  Q R  NS++LP FY+    LFHFIVA++P+LSL
Sbjct: 416  LLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSL 475

Query: 448  DTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPA 507
              LR+ GWIFP+  S   WYD+ + +N   +HW LV+ +IPTM+ALTFFGILHVPINVPA
Sbjct: 476  TKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPA 535

Query: 508  LAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAI 567
            LA+S  +DK DVD+ELIAHGYSN FSG  GSI+NYLVYTNSVLFIRAGADS  AG++L +
Sbjct: 536  LAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIV 595

Query: 568  ATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMG 627
             T + M  GP               FLLGYELL E L D++ +L+ FEY+TV IIILTMG
Sbjct: 596  LTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMG 655

Query: 628  IFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIY 687
            IFDFVLGIIVG+L+ACF FL++ST  +T++ EF G+VAKS  +RD +Q+ FL+ V EQIY
Sbjct: 656  IFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIY 715

Query: 688  VLKLQNNLFFGTIISIEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFN 746
            VLKLQN LFFGTIISIEEKI  LLE  N    K+ IKYLILDFK+IN DNIDYSAAEGFN
Sbjct: 716  VLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFN 775

Query: 747  RIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRS 806
            RI+R  + K I+LI+SSI E D IY  F+ +GLL+DVELFQDLNS+LEWCENELL  Y  
Sbjct: 776  RIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNE 835

Query: 807  LLSRAHRVKVRR---------------RSKDIVPKAQIPLE---------------NTPR 836
            L ++A + ++R+                SK +  +A    +               NTPR
Sbjct: 836  LRTKA-KARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPR 894

Query: 837  NAQIMTAAQAVYSGEQQLNKTLSK-YKASHPALALLLVALKTYR----SGHAYKETKEIR 891
            N Q++T AQ V+  ++Q   +L K  K   P L LLL+ LK YR    S       KEI 
Sbjct: 895  NHQMLTVAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIA 954

Query: 892  LWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNIS 951
            +W  LCPYF +K+   QT++     +FF+V++G+LK  + LPQG + E +A++TCYG I 
Sbjct: 955  IWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKII 1014

Query: 952  GPGSL---------SYSSV-VRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQ 1001
              G+           +S + + TET+  LW+IDA  + +L+ E+  L+ +L ++ + +  
Sbjct: 1015 DSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKD 1074

Query: 1002 HRFKELLGHSLING 1015
             RFK+LLGH+LI+ 
Sbjct: 1075 KRFKDLLGHALISA 1088

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1076 (46%), Positives = 668/1076 (62%), Gaps = 92/1076 (8%)

Query: 2    TKNRRFSAWSHRPSISEALNIQLNI---------------PDSPSG-GANAGGPVSERIP 45
            + NRR      RPS SEAL++ L +               P+S SG   N    VS R  
Sbjct: 12   SSNRRV-----RPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNR-- 64

Query: 46   TLMRPEAYLGRSYVGSFS-NSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQT 104
                    +GRSY GS S NS SL    +      +  L   R   S  +     LHRQT
Sbjct: 65   ----EFGRIGRSYAGSISSNSPSLYLNTS-----RTDELLPIRKMPSKSILGPDALHRQT 115

Query: 105  AALCDD--SRAYDGGPEEEEALVFEGNMILQEGAPPRFGVG--PYNLCKVDSNISEVLLN 160
            A + +D    + D    +    +     I  E       V   P+   +  S +S +   
Sbjct: 116  AEISNDFNDTSMDEAKIKRYIELLNRKQIEAEEEGEESAVHLRPHTFIEGKSFLSPI--- 172

Query: 161  VDEAVDDSDSDQEAG--TRLFLSPITT------DYIHSYGAINEEQSASETASRAETGPS 212
                   S + Q  G   R  L+P ++      D   +Y  IN + ++       E   S
Sbjct: 173  ------GSSASQLDGLEQRALLTPSSSIVGNEFDLESTYDEINNDYNSILRIQSRELTSS 226

Query: 213  PLRLWGTRTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIIS 272
                 G   + Y+PA I           SYGMIIFPI EP+FS LGP G+SMFY+STI+ 
Sbjct: 227  SFATKGLELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVC 286

Query: 273  QLVXXXXXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIIT 332
            QLV              EMIE+TPF+HTMA +IK++L   + +++ITTTI CY +S+++T
Sbjct: 287  QLVLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDAL-PNQDNEVITTTIFCYVISSVVT 345

Query: 333  GAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLF 392
            G VF  LGKL++GK+V FFP HILIGCIGGV YFLIITGIEVSTR+ KFEY+  FL +L 
Sbjct: 346  GLVFFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLL 405

Query: 393  MDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRD 452
             + D L KWL+P LL +S+IL+QR++ NS++LP FY+    LFHFIVA++P+LSLD LR+
Sbjct: 406  TNLDTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRE 465

Query: 453  KGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISC 512
             GWIFP+T+S   WYD+ + +N   IHW LVL +IPTMLALTFFGILHVPINVPALA+S 
Sbjct: 466  NGWIFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSL 525

Query: 513  GIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMT 572
             +DK DVD+ELIAHGYSN+ SG  GS+QNYLVYTNSVLFIRAGADS  AGFLL   T + 
Sbjct: 526  HMDKYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVV 585

Query: 573  MTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFV 632
            M AG                FLLGYEL+ E L D+   +++FEYIT++II+  MGI+DFV
Sbjct: 586  MVAGSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFV 645

Query: 633  LGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQ 692
            LGIIVG+L+AC SF+V+ T+ +TI+ E+DG+VAKS  +RDY+Q+ FL  + +QIY+LKLQ
Sbjct: 646  LGIIVGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQ 705

Query: 693  NNLFFGTIISIEEKIGNLLEPNGSE-YKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRV 751
            N LFFGTIISIEEKI  LLE +  +  K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR 
Sbjct: 706  NVLFFGTIISIEEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRF 765

Query: 752  MEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRA 811
             + KRI+LI+SSI E DKIY++F+ + LL+DVELF DLNSALEWCENE L +Y  L  +A
Sbjct: 766  TQGKRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKA 825

Query: 812  -----HRVKV----------RRRSKDIVPKAQ------IPLENTPRNAQIMTAAQAVYSG 850
                  R+ +          R RS   +  A       +P+ NTPRN Q+++ A+ V+  
Sbjct: 826  KDRIHKRISISKDSGSTYFSRNRSDSGLSAADQQMLMSLPI-NTPRNNQVLSVARKVFKN 884

Query: 851  EQQLNKTLSKYKASH----PALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVR 902
            E Q   T SK+K  +    P L+LLL +++ +R    S       KEI  W  L PYF R
Sbjct: 885  EAQ---TASKFKTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRR 941

Query: 903  KSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISG-PGSLSY--S 959
              F   +++ +  + FFVVESG++++T+ LPQG + E ++++TCYG + G  G+++    
Sbjct: 942  SLFPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPK 1001

Query: 960  SVVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
             + +TETE ++WMID   + ++++ENL LYTELL++ +++ ++R+K L+G++L++ 
Sbjct: 1002 IIFKTETESIIWMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/818 (52%), Positives = 564/818 (68%), Gaps = 28/818 (3%)

Query: 225  IPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXXXXXXXX 284
            IPA I           SYGMI+FPI + +F HLGP GLSMFY+STIISQLV         
Sbjct: 334  IPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFP 393

Query: 285  XXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRL 344
                 EMIE+ PFFHTMAL++KNS+ ++  ++IITTTI CY +S I TG VF  LGK +L
Sbjct: 394  SGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKL 453

Query: 345  GKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIP 404
            GKLV FFP HILIGCIGGV YFLI+TGIEV+TRV K EYSL FL ++  +   L K ++P
Sbjct: 454  GKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLP 513

Query: 405  ALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGG 464
              L+V + +LQ+   +S+LLP FY+  F  FHFIVAL+P+LSLD+LR  GWIFP+ ES  
Sbjct: 514  ISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSD 573

Query: 465  RWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELI 524
             WY + + +N    HW+LV  +IPTM ALTFFGILHVPINVPALA+S  +DK DVDKELI
Sbjct: 574  TWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQMDKYDVDKELI 633

Query: 525  AHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXX 584
            AHGYSN+ SG  GS+QNYLVYTNSVLFIRAG ++  AG +LA  T + +  GP       
Sbjct: 634  AHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIP 693

Query: 585  XXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACF 644
                    FLLG+EL+ E L D++ +++ FEYIT++II+ TMGI+DFVLGI+VG+L+ACF
Sbjct: 694  VCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACF 753

Query: 645  SFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIE 704
            SFLV+ST+ +T++ EF+G VAKS  +RDY+QS FL  +AEQIYVLKLQN LFFGTIISIE
Sbjct: 754  SFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIE 813

Query: 705  EKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSS 763
            EKI  LLE  +    K+ IKYLILD K++N DNIDYSAAEGFNRIKR  + KRI+LI+SS
Sbjct: 814  EKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISS 873

Query: 764  ISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLS-RAHRVKVRRRSKD 822
            I + DKIY +F+ + LL++VELF DLN ALEWCENE L +YR + +    R K +  S+D
Sbjct: 874  IKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFLYQYRQVKNKARARAKRKATSRD 933

Query: 823  IV-----------------PKAQIPLENTPRNAQIMTAAQAVYSG-EQQLNKTLSKYKAS 864
            +V                     +P+ NTPRN Q+++ A+ ++   EQ +    +    S
Sbjct: 934  VVRTGYLSTSVSNTLNDRKSSGNLPI-NTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKS 992

Query: 865  HPALALLLVALKTYRSGHAYKET----KEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFV 920
             P L LL+ ALK YRS     +     KE+  W  LCPYF ++  + +TS+    ++FF+
Sbjct: 993  IPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFI 1052

Query: 921  VESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSV---VRTETECVLWMIDAPG 977
            VESG+LK+ + LPQGS+ E ++++TCYG I G G L  S+    ++ ET+C++W+I++ G
Sbjct: 1053 VESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEG 1112

Query: 978  LQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            L K++ ENL LYTEL ++ +SV   RF  LLG++LI+ 
Sbjct: 1113 LDKMKAENLELYTELTLLVMSVKDDRFNNLLGYALISA 1150

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/829 (50%), Positives = 559/829 (67%), Gaps = 36/829 (4%)

Query: 219  TRTVRYIPAVIXXXXXXXXXXXSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVXXX 278
            ++ + Y PA +           SYGMIIFPI EPIF+++G  G+SMFY+S+II Q +   
Sbjct: 225  SQILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMGTAGISMFYISSIICQYILSG 284

Query: 279  XXXXXXXXXXXEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLT 338
                       EMIE+TPF+HTMAL+IKNSL  +  ++II+TTI CY +S+++TG VF +
Sbjct: 285  GFSSFPTGIGSEMIEITPFYHTMALAIKNSLDVQ--EEIISTTIFCYVISSLVTGLVFYS 342

Query: 339  LGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDIL 398
            LGKL+LGK+V+FFP HILIGCIGGV YFL++TG+EV+TRV K EYS  FL  L  D +I+
Sbjct: 343  LGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNII 402

Query: 399  AKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFP 458
             KWL P LL   +I  Q    NS++LP FY+    LFHFIVAL+P LSL+ LRD GWIFP
Sbjct: 403  GKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFIVALVPMLSLNKLRDSGWIFP 462

Query: 459  LTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKID 518
            LT S  +W+D+ + +N   + W L+L ++PTMLALTFFGILHVPINVPALA+S  IDK D
Sbjct: 463  LTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGILHVPINVPALAMSLNIDKFD 522

Query: 519  VDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPW 578
            VD+E IAHGYSN  SG  GS+QNYLVYTNSVLFIRAGADS  AG+LL + T + M  GP 
Sbjct: 523  VDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPV 582

Query: 579  XXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVG 638
                          FLLGYELL E L D+  +++ FEY T++II+ TMGI+DFVLGIIVG
Sbjct: 583  IISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVG 642

Query: 639  VLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFG 698
            +L+AC  F+V+ T+ +TI++E+DG +AKS  +RD++QS FL+ + EQIY++KLQN LFFG
Sbjct: 643  ILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFG 702

Query: 699  TIISIEEKIGNLLEPNGSEYKK-IIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRI 757
            TIISIEEKI  LL+ + S+  K  I+YLILDFK+IN DNIDYSAAEGFNRIKR    + I
Sbjct: 703  TIISIEEKIDTLLQLSDSDSSKHRIRYLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHI 762

Query: 758  KLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVR 817
            KLI+SSI+  DKIY  F+KIGLLQD+ELF DLN+ LEWCEN+ L +YR L  +A +    
Sbjct: 763  KLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWCENKYLEKYRELHEKAKKRLHS 822

Query: 818  RRS----KDIVPKA------------------QIPLENTPRNAQIMTAAQAVYSGEQQLN 855
            R S    K+I  +                    +PL NTPRN Q+++ A+ V+  E Q  
Sbjct: 823  RMSILQDKNISSRQINSTSSDGNEYQSSQRLMSLPL-NTPRNHQLLSVARNVFKNETQAV 881

Query: 856  KTLSKYKASHPALA-LLLVALKTYRSGHAYKETKEIR-----LWKHLCPYFVRKSFSPQT 909
                       A   LLL +++ +R    + E+K+IR      W  L PYF +      +
Sbjct: 882  SRFKNLDNGEDAFTQLLLQSIRRFRPD-VFSESKDIRAQEIKFWTQLAPYFNKIFVETNS 940

Query: 910  SISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVVRT---ET 966
            +  +E + FF+++SG++K+T+ L  G L E + S+T YG +S   + +Y +   T   ET
Sbjct: 941  TFLNENNFFFLLDSGVIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTHKVTFIPET 1000

Query: 967  ECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015
            + V+W+ID+ GL+K+++ENL LY+EL ++ +S+  +RFK LLG++L+N 
Sbjct: 1001 KSVIWLIDSEGLKKMEKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 103/507 (20%), Positives = 208/507 (41%), Gaps = 41/507 (8%)

Query: 329 TIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKF------E 382
           T ++GA+ L  G  R G L +     +L G I  V   +II  +    ++ KF       
Sbjct: 198 TFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQH 257

Query: 383 YSLAFLRNLFMDPDILAKWLIPALL--AVSIILLQRRIHNSMLLPLFYLSAFALFHFIVA 440
           Y   F + LF+     A++ +P  +     +I+L         L  ++  A      ++ 
Sbjct: 258 YHTPFEKILFLIDYAPAQYHMPTAIFSGCCLIILFLMRLLKRKLLKYHKGAIFFPDILLV 317

Query: 441 LIPSLSLDTLRDKGWIFPLTESGGRWYD-YLELYNP-QRIHWELVLGEIPTMLALTFFGI 498
           +I ++ +    D    + +T  G    D + +L NP  R   +L+       L +   G 
Sbjct: 318 VIVTILISMKFDLKHRYGITIVGDFSMDNFDKLKNPLTRSRRKLIPDLFSASLIVAMLGF 377

Query: 499 LHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADS 558
                   +L  +  +  +  ++EL+A G+ NI     G++ ++  Y  S +   +GA S
Sbjct: 378 FESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQS 436

Query: 559 RYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYIT 618
             +G  + + T +TM                    ++G  LL+EV  D    L    Y  
Sbjct: 437 VISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSE 496

Query: 619 VVIIILTMGI---FDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHR---D 672
           + +  +T G+   +    GI +G + +  + +  S +++    +   +VA ++      D
Sbjct: 497 LFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRI---QILARVAGTSNFTNLDD 553

Query: 673 YLQSNFLEKVA-------EQIYVLKLQNNLFFGTIISIEEKIGNL-------LEPNGSEY 718
           YL +     ++       E   ++++   L F     +++++  +       + P    +
Sbjct: 554 YLMNMKRNPLSIENTEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSF 613

Query: 719 --KKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSK 776
             K  IKY+I D     + ++D SAA+  + I    + + + + ++++S  DKI T  SK
Sbjct: 614 RSKDSIKYVIFDLG--GMTSLDSSAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSK 671

Query: 777 IGLLQDVELFQDLNSALEWCENELLCE 803
            G++ +VE  Q   S+ +   N  +C 
Sbjct: 672 AGVIPNVERAQ---SSTQENNNGNICS 695

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 106/495 (21%), Positives = 206/495 (41%), Gaps = 45/495 (9%)

Query: 329 TIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKF------E 382
           T ++GA+ L  G  R G L +     +L G I  V   +II  +    ++ KF       
Sbjct: 198 TFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQH 257

Query: 383 YSLAFLRNLFMDPDILAKWLIPALL---AVSIILLQRRIHNSMLLPLFYLSAF---ALFH 436
           Y   F + LF+     A++  P  +      IIL+  R+    L+     + F    L  
Sbjct: 258 YHTPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSAVFFPDILLV 317

Query: 437 FIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNP-QRIHWELVLGEIPTMLALTF 495
            IV ++ S+ L +L+ +  I  + +     +D L+  NP      +L+       L +  
Sbjct: 318 VIVTILISMKL-SLKQRYGISIVGDFSMDNFDKLK--NPLTHSRRKLMPDLFSASLIVAM 374

Query: 496 FGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAG 555
            G         +L  +  +  +  ++EL+A G  N+F    G++ ++  Y  S +   +G
Sbjct: 375 LGFFESTTASKSLGTTYNL-TVSSNRELVALGCINMFISLFGALPSFGGYGRSKINALSG 433

Query: 556 ADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFE 615
           A S  +G  + I T +TM                    ++G  LL+EV  D    L    
Sbjct: 434 AQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGG 493

Query: 616 YITVVIIILTMGI---FDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHR- 671
           Y  + +  +T G+   +    GI +G + +  + +  S +++    +   ++A ++    
Sbjct: 494 YSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRI---QILARIAGTSNFTN 550

Query: 672 --DYLQSN-----FLEKVAEQI---YVLKLQNNLFFGTIISIEEKIGNL-------LEPN 714
             DYL++       +E   E+I    ++++   L F     +++++  +       + P 
Sbjct: 551 LDDYLRTTKKNPPAVEGRIEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPG 610

Query: 715 GSEY--KKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYT 772
              +  K  IKY+I D     + +ID SAA+  + I    + + + + ++++S  DKI T
Sbjct: 611 RKSFRSKDSIKYVIFDLG--GMTSIDSSAAQVLDEIISCYKRRNVFIYLANVSINDKIRT 668

Query: 773 IFSKIGLLQDVELFQ 787
              K G+  +VE  Q
Sbjct: 669 RLLKAGVTPNVERVQ 683

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 107/493 (21%), Positives = 204/493 (41%), Gaps = 47/493 (9%)

Query: 329 TIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKF------E 382
           T ++GA+ L  G  R G L +     +L G I  V   +II  +    ++ KF       
Sbjct: 198 TFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQH 257

Query: 383 YSLAFLRNLFMDPDILAKWLIPALL---AVSIILLQRRIHNSMLLPLFYLSAF---ALFH 436
           Y   F + LF+     A++  P  +      I+L   R+    L+     + F    L  
Sbjct: 258 YHTPFEKVLFLIDYAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFPDILLV 317

Query: 437 FIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNP-QRIHWELVLGEIPTMLALTF 495
            IVA+  S+   +L+ +  I  + +     +D L+  NP      +L+       L +  
Sbjct: 318 VIVAIFISMKF-SLKHRYGITIIGDFSMDNFDKLK--NPFTHSRRKLIPDLFSASLIVAM 374

Query: 496 FGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAG 555
            G         +L  +  +  +  ++EL+A G+ NI     G++ ++  Y  S +   +G
Sbjct: 375 LGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSG 433

Query: 556 ADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFE 615
           A S  +G  + I T +TM                    ++G  LL+EV  D    L    
Sbjct: 434 AQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGG 493

Query: 616 YITVVIIILTMGI---FDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHR- 671
           Y  + +  +T G+        GI +G + +  + +  S +++    +   +VA ++    
Sbjct: 494 YSELFVFAVTFGVTILCSIEAGICIGCVYSILNIIKHSAKSRI---QILARVAGTSNFTN 550

Query: 672 --DYLQS---------NFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNL-------LEP 713
             DYL++         N LE+V E   ++++   L F     +++++  +       + P
Sbjct: 551 LDDYLRTMKKNPLGGENRLEEV-EGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHP 609

Query: 714 NGSEY--KKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIY 771
               +  K  IKY+I D     + +ID SAA+  + I    + + + + V+++S  DKI 
Sbjct: 610 GRKSFRSKDSIKYVIFDLG--GMTSIDSSAAQVLDEIITSYKRRNVFIYVANVSINDKIR 667

Query: 772 TIFSKIGLLQDVE 784
           T   K G++ ++E
Sbjct: 668 TRLLKAGVIPNLE 680

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 197/496 (39%), Gaps = 48/496 (9%)

Query: 329 TIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKF------E 382
           T ++G + L  G  R G L +     +L G I  V   +II  +    ++ KF       
Sbjct: 208 TFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQH 267

Query: 383 YSLAFLRNLFMDPDILAKWLIPALL---AVSIILLQRRIHNSMLLPLFYLSAF---ALFH 436
           Y   F + LF+     A++ IP  +      I+L   R+    L+     + F    L  
Sbjct: 268 YHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAIFFPDILLV 327

Query: 437 FIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNP-QRIHWELVLGEIPTMLALTF 495
            IV ++ S+  + L+ +  I  + +     +D  EL NP  R   +L+       L +  
Sbjct: 328 VIVTILISMKFN-LKHRYGISIIGDFSMDNFD--ELKNPLTRPRRKLIPDLFSASLIVAM 384

Query: 496 FGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAG 555
            G         +L  +  +  +  ++EL+A G+ NI     G++  +  Y  S +   +G
Sbjct: 385 LGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPAFGGYGRSKINALSG 443

Query: 556 ADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYD--SYNRLSN 613
           A S  +G  + + T +TM                    ++G  LL+EV  D   + R   
Sbjct: 444 AQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGG 503

Query: 614 FEYITVVIIILTMGIF-DFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSA---- 668
           F  + V  +     IF     GI +G + +  + +  S +++    +   +VA ++    
Sbjct: 504 FSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRI---QILARVAGTSNFTN 560

Query: 669 -------CHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGS----- 716
                    R+ L     E++ E   ++++   L F     +++++ + +E  GS     
Sbjct: 561 LDDYMMNMKRNSLDVEGTEEI-EGCMIVRIPEPLTFTNSEDLKQRL-DRIERYGSSKIHP 618

Query: 717 -----EYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIY 771
                  K  IKY+I D     + +ID SAA+    I    + + + + + ++S  DK+ 
Sbjct: 619 GRKSLRSKDSIKYVIFDLG--GMTSIDSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVR 676

Query: 772 TIFSKIGLLQDVELFQ 787
               K G+   VE  Q
Sbjct: 677 RRLFKAGVAASVERAQ 692

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/289 (20%), Positives = 122/289 (42%), Gaps = 26/289 (8%)

Query: 517 IDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAG 576
           I  ++EL+A G  N+ +   G++  +  Y  S +   +GA +  +G  + +   +T+   
Sbjct: 382 ISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFF 441

Query: 577 PWXXXXXXXXXXXXXXFLLGYELLKEVLYD---SYNRLSNFEYITVVIIILTMGIFDFVL 633
                            ++G  LL+E   D    +N     E +   + +LT   +   +
Sbjct: 442 LSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEM 501

Query: 634 GIIVGVLVACFSFLVESTRAKT---ISSEFDGKVAK------SACHRDYLQSNFLEKVAE 684
           G+ +G   +  S +  S +++       E  G+         SA H D L +  +E++ E
Sbjct: 502 GVCIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPN--IEEL-E 558

Query: 685 QIYVLKLQNNLFFGTIISIEEKIGNL-------LEP--NGSEYKKIIKYLILDFKHINID 735
              V+K+   L F  +  ++E++  L       + P   GS  ++ IKYL+ D   +   
Sbjct: 559 GCLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF- 617

Query: 736 NIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVE 784
            +D SAA+    I +    +R+K+ ++ +   +++ +      +L  VE
Sbjct: 618 -MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>Kpol_1070.32 s1070 complement(72051..73328) [1278 bp, 425 aa] {ON}
           complement(72051..73328) [1278 nt, 426 aa]
          Length = 425

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSS----VVRTETEC 968
           DEGD F+VVE G +          + ++  S +  G+  G  +L Y+S     V  ET+C
Sbjct: 221 DEGDYFYVVEQGTVDFF-------VNDSKVSTSGPGSSFGELALMYNSPRAATVLAETDC 273

Query: 969 VLWMIDAPGLQKL 981
           VLWM+D    +K+
Sbjct: 274 VLWMLDRLTFRKI 286

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 11/86 (12%)

Query: 315 DDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGI-- 372
           D  IT  I+  ALS ++ GA+ L +G LRLG LV    L+ + G + G A F IITG   
Sbjct: 213 DTEITGPIIATALS-LLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSA-FSIITGQLP 270

Query: 373 -------EVSTRVTKFEYSLAFLRNL 391
                  +V+TR T ++  +  L++L
Sbjct: 271 ALMGYNEKVNTRDTTYKVVINTLKHL 296

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 102/516 (19%), Positives = 200/516 (38%), Gaps = 61/516 (11%)

Query: 329 TIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKF------E 382
           T I+G V  T G  R G L +      L G I  V   ++I  + V  ++ K        
Sbjct: 200 TFISGVVLFTFGVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSH 259

Query: 383 YSLAFLRNLFMDPDILAKWLIP-ALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVAL 441
           Y   F + LF+     A + +P +LL++   L+   +       L    +   F  I+ +
Sbjct: 260 YHSPFEKVLFLIKYAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPEILLV 319

Query: 442 IPSLSLDT----LRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTM-LALTFF 496
           + ++   +    L+ +  I  + +     +D  +L NP   +     G++ +    +   
Sbjct: 320 VVTVIFFSYNFDLKHRYNIEVVGDIEASVFD--KLRNPLSKNKRPFYGDLFSAGFMVAML 377

Query: 497 GILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGA 556
           G         +L  +  +  +  ++EL+A G  N+     G++ ++  Y  S +   +GA
Sbjct: 378 GFFESTTASKSLGTAYDL-AVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGA 436

Query: 557 DSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYD--------SY 608
            +  +G  +   T  T+                    ++G  LL+E   D         Y
Sbjct: 437 QTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGY 496

Query: 609 NRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAK-------------T 655
           N     E I+ +I +LT   +    GI VG   +    +  ST+++              
Sbjct: 497 N-----ELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKLAGTNKFV 551

Query: 656 ISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNG 715
            + E++GK + S   R   Q   LE++ E   ++++   L F     ++ ++ N LE  G
Sbjct: 552 NADEYEGKNSTSE-RRVNPQ---LEEI-EGCLIVRIPEPLTFTNTDDLKTRL-NRLELYG 605

Query: 716 SEY----------KKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSIS 765
           S            +++ KY+I D     +  ID SA +    I    + + + + +  + 
Sbjct: 606 STKTHPAAPRSRDQEMTKYVIFDLH--GMTTIDSSAIQILQEIISSYKRRHVHVFLVRVP 663

Query: 766 ECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELL 801
              K+   F   G+L+ VE   D++ +L     ++L
Sbjct: 664 SARKVRNRFVNSGILEMVE--SDIHRSLLPSAQQML 697

>NDAI0A02730 Chr1 complement(615038..616000) [963 bp, 320 aa] {ON}
           Anc_7.206
          Length = 320

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVVRTETECVLWM 972
           DEGD F+VVESG   + Y++  G+   +  + + +G ++   +   ++ V+  T+C LW 
Sbjct: 118 DEGDYFYVVESG--NVEYIV-DGNTVNSSGAGSSFGELALMYNAPRAATVKALTDCHLWA 174

Query: 973 IDAPGLQKL 981
           +D    +K+
Sbjct: 175 LDRLTFRKI 183

>ZYRO0D16104g Chr4 (1345440..1346798) [1359 bp, 452 aa] {ON} similar
           to uniprot|P07278 YIL033C Saccharomyces cerevisiae BCY1
           Regulatory subunit of the cyclic AMP- dependent protein
           kinase (PKA)
          Length = 452

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVVRTETECVLWM 972
           DEGD F+VVE G   + + +    +  + A  + +G ++   +   +S V  +TECVLW 
Sbjct: 245 DEGDFFYVVEKGT--VDFFVNHHKVNTSNAG-SSFGELALMYNSPRASTVIAQTECVLWA 301

Query: 973 IDAPGLQKL 981
           +D    +K+
Sbjct: 302 LDRLTFRKI 310

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 106/499 (21%), Positives = 195/499 (39%), Gaps = 52/499 (10%)

Query: 321 TIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTK 380
           TI    + T ++GA+ L  G  RLG L +     +L G I  V   ++I  +    ++TK
Sbjct: 176 TINISVVVTFLSGAILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTK 235

Query: 381 F------EYSLAFLRNLFM---DPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSA 431
                   Y   F +  F+    P+ L K      L   IIL+  R     L+  +    
Sbjct: 236 LLATVPEHYHTPFEKVQFLFKYGPENLHKPTAILSLCSFIILMTLRFLKKKLMKRYKSVI 295

Query: 432 F---ALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIP 488
           F    L   I +LI S++ +  +D   I  L +     +D  +L NP       +  E+ 
Sbjct: 296 FFPEILLIVISSLIISVNFNLKKDFD-ISMLGDFSTSGFD--KLNNPLGKDNRSLCHELL 352

Query: 489 TM-LALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTN 547
           ++ L     G         +L     +  I  ++EL+A G  N+     G++ ++  Y  
Sbjct: 353 SVGLMCAILGFFESTTASKSLGTIYDL-TISSNRELVALGSMNLVGSLFGALPSFGGYGR 411

Query: 548 SVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYD- 606
           S +   +GA +  +G  + + T  T+                    ++G  LL+E   D 
Sbjct: 412 SKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDI 471

Query: 607 -------SYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTI--- 656
                   YN L  F  I V  II ++       GI VG + +  S +  S +++     
Sbjct: 472 RFHIRCHGYNELIIFTLIFVTTIIHSVEA-----GISVGCIYSIGSIIKHSAQSRIQILT 526

Query: 657 ----SSEF---DGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGN 709
               +++F   DG         D  +S+ LE++ +   ++K+   L F     ++E++  
Sbjct: 527 RVIGTNQFVPVDGYYPGLKT-IDLRESSALEELDDSTLIVKIPEPLTFTNTEDLKERLNR 585

Query: 710 L-------LEPNGS--EYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLI 760
           L       + P       ++ IKY+I +     + ++D SAA+    I +  + + + + 
Sbjct: 586 LERFRSVRIHPGRRPLHNRENIKYVIFELG--GMTSMDSSAAQILKEIIKTYKKRSVNVY 643

Query: 761 VSSISECDKIYTIFSKIGL 779
              +S   +I T     G+
Sbjct: 644 FCKVSSNLQIRTRLHDAGI 662

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 117/290 (40%), Gaps = 26/290 (8%)

Query: 517 IDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAG 576
           I  ++EL+A G  N+FS   GS+  +  Y  S +   +GA +  +G  + +   +T+   
Sbjct: 390 ISSNRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFL 449

Query: 577 PWXXXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEY---ITVVIIILTMGIFDFVL 633
                            ++G  LL+E   D       F Y   +   + +LT   +   +
Sbjct: 450 LPMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEV 509

Query: 634 GIIVGVLVACFSFLVESTRAK-TISSEFDGKVAKSACHRDYLQSNFLEKVAEQ------- 685
           GI +G   +  S +  S +++  I +   G  ++     DYL+    E   E        
Sbjct: 510 GICIGCGYSVISIIKHSAKSRIQILARVQG-TSRFVNSDDYLKQTNREHANENLELEELE 568

Query: 686 -IYVLKLQNNLFFGTIISIEEKIGNLLEPNGSE----------YKKIIKYLILDFKHINI 734
              ++K+   L F     ++E++ N LE  GS            +   +Y+I+D     +
Sbjct: 569 GCLIVKIPEPLTFTNTEDLKERL-NRLEKFGSTRVHPGARGRRSRSSTRYVIIDLH--GM 625

Query: 735 DNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVE 784
            ++D SAA+    I      + +++ ++ ++   ++     K G++  VE
Sbjct: 626 THMDSSAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score = 35.8 bits (81), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 110/246 (44%), Gaps = 35/246 (14%)

Query: 315 DDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGI-- 372
           D  IT  I+  AL T++ GA+ + +G LRLG LV F  +  + G + G A  +I   +  
Sbjct: 210 DTNITGPIIATAL-TLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVPS 268

Query: 373 ------EVSTRVTKFEY---SLAFLRNLFMDPDI---------LAKWLIPAL---LAVSI 411
                 +V+TR T ++    SL  L++  M+            L KW+  +L   L    
Sbjct: 269 LMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDRY 328

Query: 412 ILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLE 471
           +  +    +      FYL A      I+ +  ++S    R K    P++  G +    L+
Sbjct: 329 LQFKPSRASRWNAAFFYLQALR-NAVIIVVFTAISWGISRHKLEKPPISLLG-KVPSGLK 386

Query: 472 LYNPQRIHWELVLGEIPTMLALTFFGIL-HVPINVPALAISCG-ID--KIDVDKELIAHG 527
              P  +   LV   +P + A T   +L H+     A+A S G I+  K+  D+ELIA G
Sbjct: 387 NVGPLELPEGLVEKLLPELPAATIILLLEHI-----AIAKSFGRINNYKVVPDQELIAIG 441

Query: 528 YSNIFS 533
            +N+F+
Sbjct: 442 VTNLFA 447

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 72/352 (20%), Positives = 137/352 (38%), Gaps = 40/352 (11%)

Query: 329 TIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRV------TKFE 382
           T+I+G + L  G  RLG L +     +L G IG V + +II  +    ++      T   
Sbjct: 213 TLISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDILADTPEH 272

Query: 383 YSLAFLRNLFMDPDILAKWLIPA-------------LLAVSIILLQRRIHNSML-LP--L 426
           Y+  FL+ +F+       + +P              + A   +L+ R  H  ++ +P  L
Sbjct: 273 YNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHR--HRWLIFIPEIL 330

Query: 427 FYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGE 486
             L+   +  + +    +  +D L D    F   E+   +++ L   N   IH    +G 
Sbjct: 331 IVLTTVLILSYKLDFADTYDIDILGD----FKSNEN-SIFHNPLSNKNRGLIHVVFNIGI 385

Query: 487 IPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYT 546
           I  +     FG         AL  S     +  ++EL+A G SNI     G++ ++  Y 
Sbjct: 386 ITAI-----FGFFESTTASKALGASSE-RSVSSNRELVALGLSNIVISTLGALPSFGGYG 439

Query: 547 NSVLFIRAGADSRYAGFLLAIATFMT----MTAGPWXXXXXXXXXXXXXXFLLGYELLKE 602
            S +   +G  +  +G  + + T +     M    +              F L  E+ KE
Sbjct: 440 RSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKE 499

Query: 603 VLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAK 654
           V +    R  N E   +V+  +T   +     + +G + +  + +  S +++
Sbjct: 500 VSFHWRCRGYN-ELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSAKSR 550

>KLLA0E04181g Chr5 (378888..380288) [1401 bp, 466 aa] {ON} similar
           to uniprot|P07278 YIL033C Saccharomyces cerevisiae BCY1
           Regulatory subunit of the cyclic AMP- dependent protein
           kinase (PKA)
          Length = 466

 Score = 35.0 bits (79), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 23/72 (31%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGS------LSYSS----VV 962
           DEGD F++VE G ++  Y+  Q              N SGPGS      L Y+S     V
Sbjct: 264 DEGDYFYIVEDGTVEF-YVNNQKV------------NTSGPGSSFGELALMYNSPRAATV 310

Query: 963 RTETECVLWMID 974
              T+C+LW +D
Sbjct: 311 IASTDCILWALD 322

>KLTH0A03432g Chr1 (296563..297951) [1389 bp, 462 aa] {ON} similar
           to uniprot|P07278 YIL033C Saccharomyces cerevisiae BCY1
           Regulatory subunit of the cyclic AMP- dependent protein
           kinase (PKA)
          Length = 462

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 23/72 (31%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGS------LSYSS----VV 962
           DEGD F++VE G +              + ++    N SGPGS      L Y+S     V
Sbjct: 260 DEGDYFYIVEKGTVDFY-----------VGNEKV--NTSGPGSSFGELALMYNSPRAATV 306

Query: 963 RTETECVLWMID 974
              T+CVLW +D
Sbjct: 307 VANTDCVLWALD 318

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 55/276 (19%), Positives = 116/276 (42%), Gaps = 28/276 (10%)

Query: 517 IDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAG 576
           I  ++ELIA G  N+       +  +  Y  S +   +GA +  +GF + + T  T+   
Sbjct: 374 ISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFL 433

Query: 577 PWXXXXXXXXXXXXXXFLLGYELLKEVLYD--SYNRLSNFEYITVVIIILTMGIF-DFVL 633
                            ++G  LL+E  +D   + R   +  +TV  + L   +F     
Sbjct: 434 LPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLFYSLEA 493

Query: 634 GIIVGVLVACFSFLVESTRAKTISSEFDGKV--AKSACHRDYLQSN----FLEKVAEQI- 686
           GI +G   +  + +  S +++    +  G+V   ++  + D  Q+N    F+    E+I 
Sbjct: 494 GIYIGCACSIINVIKHSAKSRI---QILGRVPGTETFINADDYQANAAGYFINPQIEEIE 550

Query: 687 --YVLKLQNNLFFGTIISIEEKIGNLLEPNG----------SEYKKIIKYLILDFKHINI 734
              ++K+   L F     ++ ++ + LE +G          S  K++ + +I D K   +
Sbjct: 551 GFLIVKIAEPLTFTNADDLKMRL-HRLEKHGSAVTHPAAPRSRRKEMTENVIFDMK--GM 607

Query: 735 DNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKI 770
            +ID SAA+    I      + + + ++++   +K+
Sbjct: 608 THIDSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKV 643

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 110/559 (19%), Positives = 207/559 (37%), Gaps = 41/559 (7%)

Query: 301 MALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCI 360
           ++L +  ++    S D+   T+    + + ++G   L  G  RLG L +     +L G I
Sbjct: 147 ISLVVGQAVETLTSHDLSLETVDIATMISFMSGLTLLFGGIFRLGFLGNILSKALLRGFI 206

Query: 361 GGVAYFLIITGIEVSTRVTKF------EYSLAFLRNLFMDPDILAKWLIPAL---LAVSI 411
             + + +I+  +    ++ K        Y   F + LF+     + + +P     LAV  
Sbjct: 207 SSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRYGPSNYHLPTSFLSLAVFT 266

Query: 412 ILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYD-YL 470
            L+  RI    ++       F +   +  +I S+ L  + D    + ++  G    D + 
Sbjct: 267 TLMTIRIFKKKMMRRIKWIVF-IPEILSVVIFSIVLSYMCDLKKKYDISVIGDFNTDGFD 325

Query: 471 ELYNP-QRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYS 529
           +  NP  + +  L+       L     G L       +L    G      ++EL+A G  
Sbjct: 326 DFRNPLSKCNRGLIPALRDVSLVSALLGFLESITASKSLG-GYGNTVASSNRELVALGLM 384

Query: 530 NIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWXXXXXXXXXXX 589
           N      G I  +  Y  S +   +GA +  AG  +   T  T+                
Sbjct: 385 NTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLS 444

Query: 590 XXXFLLGYELLKEVLYD--SYNRLSNF-EYITVVIIILTMGIFDFVLGIIVGVLVACFSF 646
                +G  LL+E  +D   + R   + E I  V+  L    +    GI+ G   +  S 
Sbjct: 445 VITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISI 504

Query: 647 LVESTRAK-TISSEFDGKVAKSACHRDYLQSNFLEKVA--------EQIYVLKLQNNLFF 697
           +  S +++  I +  +G         +YLQ +              E   V+K+   L F
Sbjct: 505 VKHSAQSRIQILARVEG-TDHFINANEYLQLDLDSDNCSAPDIEHFEGCLVVKIPEPLTF 563

Query: 698 GTIISIEEKIGNLLEPNG---------SEYKKIIKYLILDFKHINIDNIDYSAAEGFNRI 748
                ++E++ + LE  G         SE    I+Y+I D   +    +D SA +    I
Sbjct: 564 TNTEDLKERL-DRLERFGSTKAHPGMKSEGGSSIEYIIFDLHGMTF--MDSSATQILKDI 620

Query: 749 KRVMEIKRIKLIVSSISECDKIYTIFSKIG---LLQDVELFQDLNSALEWCENELLCEYR 805
                 + + + ++ +    ++     + G   L+Q  E+ Q  N +L+  +        
Sbjct: 621 VVEYRKRDVVVFLARVPPNLEVRERLKESGINDLVQKQEVKQHSNHSLQSAQTPYFPNIA 680

Query: 806 SLLSRAHRVKVRRRSKDIV 824
             LS    +K R RS+ I+
Sbjct: 681 EALSMVDNLKARTRSQQIL 699

>Kwal_47.18081 s47 (675629..677005) [1377 bp, 458 aa] {ON} YIL033C
           (BCY1) - regulatory subunit of cAMP-dependent protein
           kinase [contig 198] FULL
          Length = 458

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (45%), Gaps = 23/72 (31%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGS------LSYSS----VV 962
           DEGD F++VE G +   Y+  Q              N SGPGS      L Y+S     V
Sbjct: 256 DEGDYFYIVEKGTVDF-YVGTQKV------------NTSGPGSSFGELALMYNSPRAATV 302

Query: 963 RTETECVLWMID 974
              T+CVLW +D
Sbjct: 303 VATTDCVLWALD 314

>TDEL0H02410 Chr8 complement(403240..404583) [1344 bp, 447 aa] {ON}
           Anc_7.206 YIL033C
          Length = 447

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 23/79 (29%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGS------LSYSS----VV 962
           DEGD F++VE G   + Y++    +           N SGPGS      L YSS     V
Sbjct: 241 DEGDYFYIVEEG--SVEYLVDGTKV-----------NSSGPGSSFGELALMYSSPRAATV 287

Query: 963 RTETECVLWMIDAPGLQKL 981
              T+C+LW +D    +K+
Sbjct: 288 IALTDCILWALDRITFRKI 306

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 107/536 (19%), Positives = 206/536 (38%), Gaps = 61/536 (11%)

Query: 302 ALSIKNSLSAEK--SDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGC 359
           A+S+    + EK  + D   +T+    + T I+G V   LG +RLG L +     +L G 
Sbjct: 148 AISLVVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGSVRLGFLGNILSKALLRGF 207

Query: 360 IGGVAYFLIITGIEVS---------------TRVTKFEYSLAFLRNLFMDPDILAKWLIP 404
           I  V   +II  + +                T V K  +   +    +  P  +   LI 
Sbjct: 208 ISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFLFRYASEYYHKPTAILS-LIC 266

Query: 405 ALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGG 464
            L+ +S  + ++++ N     +F      +    V ++ SL  D     G I  + E   
Sbjct: 267 FLVLISTRIAKKKLMNRYRFLIFVPEILLVVS--VTILLSLKYDFKHSYG-ISTIGEFNA 323

Query: 465 RWYDYL--ELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGID---KIDV 519
             +  +   L N  R  +  +  E   +  L FF            + S G D       
Sbjct: 324 DGFGSIGNPLSNENRALYSSLWNEGLAVAMLGFF-------ESTTASKSLGSDYNLTYSS 376

Query: 520 DKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWX 579
           ++ELIA G+ NI     G++ ++  Y  S + + +G  +  +G ++ + T +T       
Sbjct: 377 NRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPM 436

Query: 580 XXXXXXXXXXXXXFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGV 639
                         ++G  LL+EV  D    +    Y  + +  LT  I      + +GV
Sbjct: 437 IHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTF-IATLSQSVELGV 495

Query: 640 LVACFSFLVESTRAKTIS-----SEFDGK--------VAKSACHRDYLQSNFLEKVAEQI 686
            V C   L+   +   +S     ++ +G           K+   RD+   N   +  E  
Sbjct: 496 TVGCIYSLILIVKHSALSRIQILAKLEGSDEFVNVDDYIKNYNGRDF--ENITLEQFEHC 553

Query: 687 YVLKLQNNLFFGTIISIEEKIGNL-------LEPNGSEY--KKIIKYLILDFKHINIDNI 737
           Y++K+   L F     +  ++  L       + P  +    +  ++Y+I D +   + ++
Sbjct: 554 YIVKIPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLE--GMTSM 611

Query: 738 DYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSAL 793
           D  +A+    I R    + +++ ++ +S   +I       G+L  VE  Q +N+A+
Sbjct: 612 DSGSAQILLEIIRSYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVETVQ-VNNAV 666

>SAKL0F07788g Chr6 (596801..598201) [1401 bp, 466 aa] {ON} similar
           to uniprot|P07278 YIL033C Saccharomyces cerevisiae BCY1
           Regulatory subunit of the cyclic AMP- dependent protein
           kinase (PKA)
          Length = 466

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 23/79 (29%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGS------LSYSS----VV 962
           DEGD F++VE+G ++           E +       N SGPGS      L Y+S     V
Sbjct: 263 DEGDYFYIVENGTVEFYVN------HEKV-------NTSGPGSSFGELALMYNSPRAATV 309

Query: 963 RTETECVLWMIDAPGLQKL 981
              T+C+LW +D    +K+
Sbjct: 310 VAATDCILWALDRLTFRKI 328

>Kpol_1002.56 s1002 (154463..157249) [2787 bp, 928 aa] {ON}
           (154463..157249) [2787 nt, 929 aa]
          Length = 928

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 606 DSYNRLSNFEYITVVII---ILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISS 658
           D+YN +SNFE+   V++   +L   I D  LGI +G+        +   R+ TIS+
Sbjct: 440 DNYNNISNFEWYNAVLVDLAVLCQDIADETLGIRIGLQFRDIMVRIPDLRSATIST 495

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 53/261 (20%), Positives = 102/261 (39%), Gaps = 27/261 (10%)

Query: 512 CGIDKIDV--DKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIAT 569
           C    +D   ++EL++ G  N+ S    ++  +  Y  S + I  GA ++++G  +++  
Sbjct: 262 CSNSNVDASSNRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLA 321

Query: 570 FMTMTAGPWXXXXXXXXXXXXXXFLLGYELLKEVLYD--SYNRLSNF-EYITVVIIILTM 626
            + M                     + + LL+E   D   Y  +  + E    +II++T 
Sbjct: 322 IICMNFLMNAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTT 381

Query: 627 GIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQI 686
            ++    G+ +G+ +     L  STR++      D          D   S+   +  E++
Sbjct: 382 LVWSPQFGVTMGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEIEKV 441

Query: 687 YVLKLQNNLFFGTIISIE------EKIGNL-------------LEPNGSEYKKIIKYLIL 727
            V+K+   L F  +  +       EK G+L             L P  S  +  +KYL++
Sbjct: 442 MVVKIPEPLIFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSG-QVSLKYLVI 500

Query: 728 DFKHINIDNIDYSAAEGFNRI 748
           D     +  ID SA +    I
Sbjct: 501 DL--FGMTYIDISALQALREI 519

>Kpol_1036.36 s1036 complement(90884..92053) [1170 bp, 389 aa] {ON}
           complement(90884..92053) [1170 nt, 390 aa]
          Length = 389

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 20/39 (51%)

Query: 437 FIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNP 475
           F V  +P+ + D  +   W+ PL  + G W DY  + NP
Sbjct: 105 FEVIHVPTKASDKFKVGDWVIPLKSNQGTWTDYKAITNP 143

>ADL099C Chr4 complement(506849..508225) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL033C
           (BCY1)
          Length = 458

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 11/66 (16%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSS----VVRTETEC 968
           DEGD F++VE G   + + L    +       +C+G +    +L Y+S         T+C
Sbjct: 255 DEGDYFYIVEKGT--VDFFLDDRKVN-TYGPGSCFGEL----ALMYNSPRAVTAVAATDC 307

Query: 969 VLWMID 974
           VLW +D
Sbjct: 308 VLWALD 313

>CAGL0I05236g Chr9 complement(496714..497928) [1215 bp, 404 aa] {ON}
           similar to uniprot|P07278 Saccharomyces cerevisiae
           YIL033c SRA1 cAMP dependent protein kinase
          Length = 404

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVVRTETECVLWM 972
           DEGD F+VVE+G   + + +    +  + A  + +G ++   +   ++ V  +T+C LW 
Sbjct: 202 DEGDYFYVVETGT--VEFFVNNEKVNTSGAG-SSFGELALMYNSPRAATVVAQTDCTLWA 258

Query: 973 IDAPGLQKL 981
           +D    +K+
Sbjct: 259 LDRLTFRKI 267

>TBLA0D04800 Chr4 (1179762..1180982) [1221 bp, 406 aa] {ON}
           Anc_7.206 YIL033C
          Length = 406

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 913 DEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVVRTETECVLWM 972
           DEGD F++VE+G +   Y+   G+   +    + +G ++   +   ++ V   T C+LW 
Sbjct: 206 DEGDYFYIVENGTVDF-YV--NGTKVNSSGPGSSFGELALMYNSPRAATVVATTPCILWA 262

Query: 973 IDAPGLQKL 981
           +D    +K+
Sbjct: 263 LDRMTFRKI 271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,481,271
Number of extensions: 4174289
Number of successful extensions: 11523
Number of sequences better than 10.0: 59
Number of HSP's gapped: 11642
Number of HSP's successfully gapped: 68
Length of query: 1015
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 895
Effective length of database: 39,721,479
Effective search space: 35550723705
Effective search space used: 35550723705
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)