Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR303W3.483ON57157129360.0
SAKL0F02970g3.483ON57357324950.0
Kpol_480.193.483ON57457124790.0
Ecym_12443.483ON57357224740.0
KLLA0B10868g3.483ON57457124690.0
NCAS0F035103.483ON57557224660.0
CAGL0I10648g3.483ON57457424580.0
YPR145W (ASN1)3.483ON57257124580.0
TDEL0D055203.483ON57357324530.0
Skud_7.4353.483ON57257224500.0
YGR124W (ASN2)3.483ON57257224490.0
Smik_6.2203.483ON57257224470.0
Suva_16.4743.483ON57257124460.0
Smik_16.3963.483ON57257124400.0
KLTH0F14630g3.483ON57357124290.0
Suva_7.4103.483ON57257224250.0
Skud_16.4393.483ON57257124250.0
Kwal_55.211873.483ON57357224240.0
NDAI0B058103.483ON57757724150.0
KNAG0A079203.483ON57857524140.0
KAFR0G036703.483ON57257124080.0
TPHA0D042003.483ON57457323920.0
ZYRO0B04136g3.483ON57257323870.0
TBLA0C044303.483ON58057823710.0
ZYRO0A00528g8.875ON5121031482e-09
NCAS0C001908.875ON5171051385e-08
Kpol_455.78.875ON5181041376e-08
YML096W8.875ON525951332e-07
Suva_13.528.875ON519991322e-07
TDEL0B004408.875ON516941304e-07
Smik_13.398.875ON521951304e-07
TPHA0C049508.875ON525991295e-07
Skud_13.468.875ON5191181287e-07
KNAG0J002008.875ON5151021271e-06
ADL350C8.875ON508941261e-06
NDAI0K001808.875ON522941252e-06
TBLA0C063008.875ON518941252e-06
KAFR0L021108.875ON514951242e-06
Kwal_27.97058.875ON515991233e-06
Ecym_81558.875ON5131191233e-06
KLLA0D10285g8.875ON515931181e-05
SAKL0D00352g8.875ON515971171e-05
KLTH0E16412g8.875ON515951072e-04
CAGL0H06963g8.875ON517781055e-04
Skud_7.311singletonON8189830.017
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR303W
         (571 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...  1135   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   965   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...   959   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   957   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   955   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   954   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...   951   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   951   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   949   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   948   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   947   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   947   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...   946   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...   944   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   940   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   938   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   938   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   938   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   934   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   934   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   932   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   926   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   924   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   917   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    62   2e-09
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    58   5e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    57   6e-08
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    56   2e-07
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    55   2e-07
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    55   4e-07
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    55   4e-07
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    54   5e-07
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    54   7e-07
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    54   1e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    53   1e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    53   2e-06
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    53   2e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    52   2e-06
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    52   3e-06
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    52   3e-06
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    50   1e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    50   1e-05
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    46   2e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    45   5e-04
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    37   0.017

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score = 1135 bits (2936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/571 (95%), Positives = 547/571 (95%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQA 300
             IASI            GDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQA
Sbjct: 241 SLIASIAARETERANREAGDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQA 300

Query: 301 ARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGVK 360
           ARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGVK
Sbjct: 301 ARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGVK 360

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP
Sbjct: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQF 480
           FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQF
Sbjct: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQF 480

Query: 481 SDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAAA 540
           SDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAAA
Sbjct: 481 SDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAAA 540

Query: 541 TVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
           TVMRWVPKADWGCAEDPSGRYAKIHDQHISS
Sbjct: 541 TVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/573 (79%), Positives = 497/573 (86%), Gaps = 2/573 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFACY+ + ++ FKP AL+LSKR+RHRGPDWSGNV+KN TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG+Y LCVNGEIYNHI LREE + Y F +LSDCEPIIPLY KYD++TP++LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG+SSSSP T +FASELKCLVD+CDEITAFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRY+ PDW+DE RIP  P+DYK +R +LE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IA+I              V  D   KHLAG+DD+G LH  GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFH E+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDR+FL +CMNIDPAEKMI   +GRIEKYILRKAFDT+DEP V PYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKDAAE AISDEQFA P P WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
           A+TVMRW+PKADWGCAEDPSGRYAKIH+QHI +
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/571 (79%), Positives = 495/571 (86%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA Y+ ++ E+FKP AL+LSKR+RHRGPDWSGNV+KN TILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP G+YVLCVNGEIYNHI LRE C DY++ +LSDCEPIIPLYLK+D++ P++LDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG++S SP+T +FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYF PDWIDE RIP++PV YKA+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI                 D   KHL G+DD+G LHT GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFLQLCMNIDPAEKMI   +GRIEKYILRKAFDTSDEP   PYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKD AER ISDE F+ P   WG DIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A TVMRW+PKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/572 (78%), Positives = 500/572 (87%), Gaps = 2/572 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFACYR+D IESFKP AL+LSKR+RHRGPDWSGNV+KNDTI VHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DGNYVLCVNGEIYNHIHLR+ C+DY F++LSDCEPIIPL+ KY VETP +LDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD + DRIVAARDPIGVTTLYMGK S SPRTRYFASELKCLV+ECDEI +FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSDTD++TRYFKP W+ ++  P++PVDYK +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IA+I              V  D   ++L G+DD   LH  GWS+LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVAKFIGSIHHEHTFT+QEGLDALDDVIHHLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           +KMVLSGEGSDEIFGGYLYFAQAPS  +FH E+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDR+FL+LCMNIDP EKMI P++G+IEKYILRKAFDTSDEP V+PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWID LKDAAE AISDEQFA P P WGDDIP+TKEA+WYR+KFDALFPQPTA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHIS 570
           A+TVMRWVPKA+WGC+EDPSGR+AKIH++HIS
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHIS 572

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/571 (78%), Positives = 498/571 (87%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA +R  D++++KP AL+LSKR+RHRGPDWSGN++KN TILVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG+Y L VNGEIYNHI LREEC+ Y F +LSDCEPIIPLY KYD++ P+HLDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG+SS+SP++ +F+SELKCL D+CDEI AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKLTRYF PDW+DE+RIP+ PVD+KAVR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVY--ADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IA+I              V   +D   LAG+D++G LH  GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFH E+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDR+FLQLCMNIDP +KMI P +G+IEKYILRKAFDT+DEP + PYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKDAAE  ISDEQFA P   WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A+TVMRW+PKADWGCAEDPSGRYAKIH+QH+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/572 (77%), Positives = 495/572 (86%), Gaps = 3/572 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA +R +D++++KP AL+L+KR+RHRGPDWSGNV+KN TIL HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP GNY LCVNGEIYNHI +REEC+DY+F +LSDCEPIIPLYLKYD++ P+HLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRIVAARDPIG+TTLYMG+ S +P+T YFASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYF PDW+DE RIPS PVD KA+R TLEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG---KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPD 297
             IASI                 +G   KHL G+DD G LHTGGWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 298 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQ 357
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 358 GVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEA 417
           GVKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 418 RVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQK 477
           RVPFLD+EFLQLCMNIDP +KMI    G+IEKYILRKAFDT+D+P   PYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 478 EQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPT 537
           EQFSDGVGYSWIDGLKD AER ISD  F NP P WG+D+PTTKEA+WYRLKFDAL+PQ T
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 538 AAATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           AA TVMRW+PKADWGCAEDPSGRYAKIH++H+
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/574 (77%), Positives = 495/574 (86%), Gaps = 3/574 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA Y+  D+ +FKP AL+LSKR+RHRGPDWSGNV+KN TI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG+Y LCVNGEIYNHI LRE+  DY+F +LSDCEPIIP YL++D++ P++LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRIVAARDP+G+TTLYMG+ SSSP+T +FASELKCL D+CDEITAFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD++TRYF PDWIDE+RIP+ PV++K +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG---KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPD 297
             IASI                 D    K LAG+D++G LHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 298 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQ 357
           LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 358 GVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEA 417
           GVKMVLSGEGSDEIFGGYLYFAQAPS  EFH E+VKRV NLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 418 RVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQK 477
           RVPFLD+EFLQLCMNIDP +KMI    GRIEKYILRKAFDTSDEP V PYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 478 EQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPT 537
           EQFSDGVGYSWIDGLKD AER ISD  F+NP   WG+DIPTTKEA+WYRLKFDALFPQ T
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 538 AAATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
           AA+TVMRW+PKADWGCAEDPSGRYAKIH+QH+++
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHVTA 574

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/571 (78%), Positives = 491/571 (85%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA +R +D+  +KP AL+LSKR+RHRGPDWSGN IKN TI VHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG Y+LCVNGEIYNHI LREEC+DYEF +LSDCEPIIP+YLK+D++ P++LDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DRIVAARDPIG+TTLYMG+SS+SP+T YFASELKCL D+CD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS P+DY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADGK--HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI                 D K  HLAG+DD G LHT GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFLQLCMNIDP EKMI P++GRIEKYILRKAFDT+ EP   PYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKD AE  ISDE FA+P   WG DIPTTKEAFWYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/573 (78%), Positives = 497/573 (86%), Gaps = 2/573 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ +D++++K  AL+LSKR+RHRGPDWSGNV++N+T+LVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP GNY LCVNGEIYNHI LREE SDY+F++LSDCEPIIPLY KYD++TP++LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRI+AARDP+G+TTLYMG++S SP+T +FASELKCL D+CD I AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DETRIPS PVDYKA+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI                 D   KHLAG+DD G LH+ GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAP+  EFHTE VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFLQLCMNIDP +KMI  ++GR+EKYILRKAFDT+DEP V PYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKD AER ISD+ FA P  AWGDD+PTTKEAFWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
           A TVMRWVPKADWGCAEDPSGR+A+IHDQH+ +
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/572 (77%), Positives = 494/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ +DI SFKP AL+LSKR+RHRGPDWSGN + N TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG Y+L VNGEIYNHI LRE+CS Y+F + SDCEPIIPLYL++D++ P+HLDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           A+CLYD ++DR+VAARDPIGV TLYMG+SS SP+T YFASELKCL D CD I +FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYF P+W+DE RIPS PVDY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXX-GDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQ 299
             IA+I             GD   + K LAG+DD+G LHT GWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADADGDASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 300 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGV 359
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 360 KMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARV 419
           KMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 420 PFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQ 479
           PFLDR+FLQLCMNIDP +KMI P++GRIEKYILRKAFDT+DEP V PYLPEEILWRQKEQ
Sbjct: 421 PFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKEQ 480

Query: 480 FSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAA 539
           FSDGVGYSWIDGL+D AER ISD  FANP   WG+DIPTTKEA+WYRLKFDA FPQ TAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 540 ATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
            TVMRWVPKADWGCAEDPSGRYAKIH++H+S+
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAKIHEKHVSA 572

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/572 (78%), Positives = 493/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ +DI +FKP AL+LSK++RHRGPDWSGN + N TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG Y+L VNGEIYNHI LRE CSDY+F + SDCEPIIPLYL++D++ P++LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           A+CLYD ++DRIVAARDPIGV TLYMG+SS SP T YFASELKCL D CD I +FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYF PDW+DE RIPS PVDY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXG-DVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQ 299
             IA+I              D   D K LAG+DD+G LHT GWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 300 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGV 359
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 360 KMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARV 419
           KMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 420 PFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQ 479
           PFLD++FLQLCMNIDP EKMI P++GRIEKYILRKAFDT+DEP V PYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 480 FSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAA 539
           FSDGVGYSWIDGL+D AERAISD  FANP   WGDDIPTTKEA+WYRLKFDA FPQ TAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 540 ATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
            TVMRW+PKADWGCAEDPSGRYAKIH++H+S+
Sbjct: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/572 (78%), Positives = 493/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ DDI SFKP AL+LSKR+RHRGPDWSGN + N TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG Y+L VNGEIYNHI LREECSDY+F + SDCEPIIPLYL++D++ P++LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           A+C+YD ++DRIVAARDPIGV TLYMG+SS SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS PVDY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYA-DGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQ 299
             IA+I             +  + D K LAG+DD+G LHT GWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 300 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGV 359
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 360 KMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARV 419
           KMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 420 PFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQ 479
           PFLD++FLQLCMNIDP +KMI P++G+IEKYILRKAFDT++EP V PYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480

Query: 480 FSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAA 539
           FSDGVGYSWIDGL+D AER ISD  FANP   WGDDIPTTKEA+WYRLKFDA FPQ TAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 540 ATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
            TVMRWVPKADWGCAEDPSGRYAKIH++H+ +
Sbjct: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/571 (77%), Positives = 491/571 (85%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ +D+  +KP AL+LSKR+RHRGPDWSGN +KN TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SPD +Y+LCVNGEIYNHI LREEC DY+F +LSDCEPIIP+YLK+D++ P++LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DRI+AARDPIG+TTLYMG+SS+SP+T YFASELKCL D+CD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS P+DY A+R +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADGK--HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IA+I                 D K  HLAG+DD G LHT GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFLQLCMNIDP+EKMI P++GRIEKYILRKAFDT+DEP   PYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWID LKD AE  ISDE FANP   WG+DIPTTKEA+WYRLKFD LFPQ T 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A TVMRWVPKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/571 (77%), Positives = 491/571 (85%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ +D+ ++KP AL+LSKR+RHRGPDWSGN IKN TI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SPD +Y+LCVNGEIYNHI LREEC +Y+F +LSDCEPIIP+YLK+D++ P++LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DRIVAARDPIG+TTLYMG+SS+SP+T YFASELKCL D+CD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS P+DY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADGK--HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI                 D K  HLAG+DD G LHT GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLD+EFLQLCMNIDP EKMI P++GRIEKYILRKAFDT+ EP   PYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKD AE  ISDE FA+P   WG DIP+TKEAFWYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/571 (78%), Positives = 482/571 (84%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIF C+R   +E FKP ALRL KR+RHRGPDWSGN+IKN T++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           P  S D NY+L VNGE+YNHI LREE S Y F +LSDCEPIIPLY KY ++ P++LDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DRIVAARDPIG+TTLYMG+ S SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRYF PDWIDE RIPS+P+D   +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI              V  D   KHLAG+DD G L + GWS LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFLQLCMN+DP EKMI   +GRIEKYILRKAFDTSDEPG  PYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKDAAE AISDEQF  P   WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A+TVMRW+PKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/572 (76%), Positives = 494/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ +DIE FKP AL+LSKR+RHRGPDWSGN I N TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG+Y+L VNGEIYNHI LRE+CSDY+F + SDCEPIIPLYL++D++ P++LDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           A+CLYD ++DR++AARDPIGV TLYMG+ S SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYF PDW+DE R+P+ PVDY+A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGD-VYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQ 299
             IA+I             +   A+   LAG+DD+G LHT GWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 300 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGV 359
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 360 KMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARV 419
           KMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKST+AWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420

Query: 420 PFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQ 479
           PFLD++FLQLCMNIDP +KMI  ++GRIEKYILRKAFDT+DEP V PYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 480 FSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAA 539
           FSDGVGYSWID L+D AER ISD  FANP  +WGDDIPTTKEA+WYRLKFDA FPQ TAA
Sbjct: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 540 ATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
            TVMRWVPKADWGCAEDPSGRYA+IH++H+++
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/571 (77%), Positives = 486/571 (85%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA Y+ +D+  +K  AL+LSKR+RHRGPDWSGN  KN TI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SPD +Y+LCVNGEIYNHI LREEC DY+F +LSDCEPIIP+YLK+D+E P++LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DRIVAARDPIG+TTLYMG+SS+SP+T YFASELKCL D+CD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS P+DY A+R +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADGK--HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI                 D K  HLAG+DD G LHT GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFLQLCMNIDP EKMI  ++GRIEKYILRKAFDT+ EP   PYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWID LKD AE  ISDE FA+P   WG DIPTTKEAFWYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A TVMRWVPKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/572 (76%), Positives = 488/572 (85%), Gaps = 2/572 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIF C+R +D++ FKP AL+L+KR+RHRGPDWSGNVI+N T+L HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           P+ S + +Y+L VNGEIYNHI LREE SDY F +LSDCEPIIPLY KY ++ P++LDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DR++AARDPIG+TTLYMG+ S SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD++TRY+ P+W+DE RIPS+P+D   +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IA+I              V  D   KHLAG+DD G LH+ GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFL LCMN+DP EKMI   +GRIEKYILRKAFDTSDEPG  PYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKD AE  ISDEQF  P   WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHIS 570
           A+TVMRW+PKADWGCAEDPSGRYAKIHDQHIS
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/577 (76%), Positives = 487/577 (84%), Gaps = 6/577 (1%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA ++ +D+ +FKP AL+LSKR+RHRGPDWSGNVIKN TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP GNY LCVNGEIYNHI +RE+  DY F +LSDCEPIIPLYLK+D++TP+HLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG++S +P+T +FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD++TRYF PDW+DE RIP   +D  A+R +LE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXX------GDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPN 294
             IASI                   +      HL G+DD G LH GGWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 295 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKI 354
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 355 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWG 414
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRVNNLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 415 LEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILW 474
           LEARVPFLDR+FLQLCMNIDP EKMI   +GRIEKYILRKAFDTSD+P   PYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 475 RQKEQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFP 534
           RQKEQFSDGVGYSWIDGLKD AER ISD  F NP   WG DIPTTKEA+WYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 535 QPTAAATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
           Q TAA TVMRW+PKADWGCAEDPSGRYAKIH++H+++
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/575 (76%), Positives = 490/575 (85%), Gaps = 6/575 (1%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA +R +D+++FKP AL+LSKR+RHRGPDWSGN+IKN TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP G+Y+L VNGEIYNHI LREEC +Y++ SLSDCEPIIP+YLKYD++ P+HLDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD ++DRIVAARDPIG+TTLYMG+SS  P+T +FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRY+ P+W+DET+IPS PVD K +R TLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXG------DVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPN 294
             IA+I                      A+G HLAG+DD G L +  WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 295 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKI 354
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 355 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWG 414
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 415 LEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILW 474
           LEARVPFLD+EFL LCMNIDP +K+I  ++GRIEKYILRKAFDT DEP V PYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 475 RQKEQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFP 534
           RQKEQFSDGVGYSWIDGLKD AE  ISDE FA P   WG D+PTTKEAFWYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 535 QPTAAATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           QPTAA TVMRW+PKADWGCAEDPSGR+AKIH+QH+
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/571 (77%), Positives = 489/571 (85%), Gaps = 2/571 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA +R +D+ SFK  AL+LSKR+RHRGPDWSGNV+KN TI+VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP GNY LCVNGEIYNHI LRE+  DY+F +LSDCEPIIPLYL+ D++ P+ LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DRI+AARDPIGVTTLYMG+SS SP+T +FASELKCLVD+CD I AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYF P+WIDE +IP+ PVDY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXX-GDVYAD-GKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI                YA+ G HLAG+DD G L T GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFL LCMNIDP +K+I  ++GRIEKYILRKAFDT D+P   PYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWID LKD AE+ ISDE FANP   WG DIPTTKEA+WYRLKFDALFPQPTA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/573 (75%), Positives = 483/573 (84%), Gaps = 2/573 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIF  Y+ ++ E+FKP AL+LSKR+RHRGPDWSGNV+KN TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI S DG+++LCVNGEIYNHI +RE+  DY+F +LSDCEPIIPLY+KY  E P+HLDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AW LYD ++DRI+AARDPIG+TTLYMG+SS SP+T YFASELKCL D+CD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD++TRY+ PDWIDE RI +QP+D   +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI                       L G+DD G L + GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
            AA+KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDREFL LCMNIDP+EKMI  ++GRIEKYILRKAFDT+DEP   PYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKD AER ISDE F NP   WG DIPTTKEA+WYRLKFDALFPQPTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
           A+TVMRW+PKADWGCAEDPSGRYAKIH+QHI +
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGA 573

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/573 (76%), Positives = 484/573 (84%), Gaps = 3/573 (0%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA +R  D++ ++P AL+LSKR+RHRGPDWSGNV+KN TILVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP GNY LCVNGEIYNHI LREECSDY F SLSDCEPIIPLYLKY ++ P+ LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           AWCLYD + DRIVAARDPIG+TTLYMGKSS SP+TR+FASELKCL+D+CDEI AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS +D++TRYF P W+DE+ +PS P+DYK +R +LEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXXXXXGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298
             IASI              V  D   KHLAG+D +G LHTGGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418
           VKMVLSGEGSDEIFGGYLYFAQAPS  EF  E   RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478
           VPFLDR+FL LCM +DP EKMI P++GRIEKYILRKAFDT+DEP V PYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538
           QFSDGVGYSWIDGLKDAAE AISDE  A P P WGDD PTTKEA+WYRLKFD  FP+ +A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPK-SA 539

Query: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571
           A TVMRW+PKADWGC  DPSGR+AKIH+QHI +
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/578 (75%), Positives = 483/578 (83%), Gaps = 9/578 (1%)

Query: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60
           MCGIFA Y+  ++ +FKP AL+L+KR+RHRGPDWSGNV+KN T+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120
           PI SP GNY+L VNGEIYNHI LREE +DY++ +L DCEPIIP+YLKYDV+ P HLDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180
           A+ LYD Q+DR++AARDP+G+TTLYMG++S +P+T YFASELKCLVD+CD I AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+ RYFKP+WIDE+ IP+ PVD K VR TLE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIXXXXXXXXX--------XXXGDVYADG-KHLAGMDDRGLLHTGGWSRLHSFAIG 291
             IASI                     D  AD  K L G+DD G L T  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 292 LPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLS 351
           LP APDL+AARKVA FIGSIHHEH FT+QEGLDALDDVI+HLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 352 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTM 411
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPS AEFH E+VKRV NLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 412 AWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEE 471
           AWGLEARVPFLDR+FL LCMNIDP +KMI P++G+IEKY+LRKAFDTSDEP V PYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 472 ILWRQKEQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDA 531
           ILWRQKEQFSDGVGYSWID LKD AER ISDE FANP   WG DIPTTKEA+WYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 532 LFPQPTAAATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569
           LFPQ TAA TVMRW+PKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 352 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTM 411
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++NN++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 412 AWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRK 454
           A G+E R PFLDR  ++  M          P   +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQ-------SIPINWKINKLILRK 471

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 69  YVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMFAWCLYDVQ 128
           Y+L  NGE+YN   L  + S       +D   +         E    L+G FA+ +YD+ 
Sbjct: 88  YILQFNGELYNEEILDNDTSFVASLLENDKMSVF--------EVISFLEGEFAYTIYDMH 139

Query: 129 RDRIVAARDPIGVTTL 144
             ++   RD IG  +L
Sbjct: 140 EHKLYFGRDDIGKRSL 155

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 9/105 (8%)

Query: 350 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKS 409
           +  K + +G+ ++ SG G+DE++GGY  FA   SP +   E  +++NN++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 410 TMAWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRK 454
               G+E R PFLD E ++          M  P   ++ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFST-------MEIPINYKVNKMILRK 475

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 69  YVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMFAWCLYDVQ 128
           YVL  NGE+YNH  +    + Y    L +  P IP  +K        L+G FA+ +YD+Q
Sbjct: 90  YVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPAIIK-------KLNGEFAYSIYDIQ 141

Query: 129 RDRIVAARDPIGVTTL 144
                  RD +G  +L
Sbjct: 142 NGTFYFGRDTVGKRSL 157

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 54/104 (51%), Gaps = 5/104 (4%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY  FA   S  E   E  +++NN+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFAN-KSIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRK--AFDTSDEP 462
           FLD E +Q  ++  P    +   KG + K  L K    D + EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKV--NKGILRKLALEKLQLRDIAQEP 491

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 74/179 (41%), Gaps = 36/179 (20%)

Query: 66  DGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMFAWCLY 125
           D  YVL  NGE+YN   +    + Y  + L  C+  +       V   + LDG FA+ +Y
Sbjct: 89  DERYVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIY 140

Query: 126 DVQRDRIVAARDPIGVTTL------YMGKSSSSPRTRYFASELKCLVDECDEITAFPPGH 179
           D++   I   RD IG  +L        G+   S  T    + + CL            G 
Sbjct: 141 DLKEGNIYFGRDTIGKRSLCYSIDENSGELFISSVTGTRGTFVDCL-----------GGV 189

Query: 180 VYDSDTDKLT---------RYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVP 229
           +Y  DT   T         +Y   D  DE    SQ ++   +  TL ++V+KR+++  P
Sbjct: 190 IYTYDTKTHTLDDTKVIRDKYVVTDMTDELENESQYME--LLYGTLYESVKKRVLSIHP 246

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 51/95 (53%), Gaps = 8/95 (8%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY  FA  P P E   E  +++NN++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKA 455
           FLD   ++L      AE    P   ++ K ILRK 
Sbjct: 452 FLDEYVIKLST----AE---IPINFKVNKLILRKV 479

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 60  QPINSPDGNYVLCVNGEIYN-HIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDG 118
           Q IN  D  Y L  NGE+YN  I   +  S Y  + L + +  + +     ++  + L+G
Sbjct: 81  QSINV-DDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEG 134

Query: 119 MFAWCLYDVQRDRIVAARDPIGVTTL 144
            +A+ +YDV   ++   RDPIG  +L
Sbjct: 135 EYAYTIYDVNSSKLYFGRDPIGRRSL 160

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (52%), Gaps = 9/99 (9%)

Query: 357 QGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLE 416
           QGV ++ SG G+DE++GGY  FA  P P E   E  +++NN++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 417 ARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKA 455
            R PFLD   ++    +D       P   +I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA-VD------IPINFKINKLILRNV 479

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 64  SPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDV-ETPQHLDGMFAW 122
           S D  Y L  NGE+YN     +E SD +  S      +  L    DV +  + L+G +A+
Sbjct: 84  SVDDRYYLQFNGELYN-----KEISDDDNDSQYIASLLQNLTGDGDVIDVIRMLEGEYAY 138

Query: 123 CLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHVYD 182
            +YDV+  +    RDPIG  +L     S +P    + +     ++   +      G VY+
Sbjct: 139 TVYDVKASKFYFGRDPIGRRSL---SYSVTPNNELYVASATGAIEGFQDCIG---GIVYE 192

Query: 183 SDT 185
            DT
Sbjct: 193 YDT 195

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 8/94 (8%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY   A   SP+E   E  +++NN+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLAN-KSPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRK 454
           FLD + ++        E++  P   ++ K ILR+
Sbjct: 449 FLDHDVIKF-----STEEI--PINYKVNKMILRR 475

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 95/218 (43%), Gaps = 33/218 (15%)

Query: 27  VRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQPINSPD---GN-YVLCVNGEIYNHIH 82
           ++ RGPD+S   + ++    H       + S  +P  S     GN ++L  NGE+YN   
Sbjct: 47  IKSRGPDYSSLRVSSE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQ-- 100

Query: 83  LREECSDYEFTSLSDCEPIIPLYLK---YDV-ETPQHLDGMFAWCLYDVQRDRIVAARDP 138
                   E T+  +    I   L+   +DV +  + L G FA+ LYD+Q+ +    RD 
Sbjct: 101 --------EITAHDNDTQFIVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDN 152

Query: 139 IGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHVYDSDTDKL-------TRY 191
           +G  +L    S+ +    Y +S    +    D I      +VYD+++  L       ++Y
Sbjct: 153 VGKRSLSYHLSAITGEL-YISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQY 209

Query: 192 FKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVP 229
           F    +DE  +       + +   L  AVRKR+++  P
Sbjct: 210 FITKKLDE-ELTCLDSTVEQLYGMLSLAVRKRVLSIHP 246

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++LSG G+DE++GGY  FA   +P E   E  K++NN++  +  R +K     G+E R P
Sbjct: 393 VLLSGLGADELYGGYHKFANK-APHELVEELTKQINNIYERNLNRDDKVIAHNGVEVRYP 451

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKA 455
           FLD   ++          +  P   ++ K ILRK 
Sbjct: 452 FLDEYVIKFST-------VEIPINYKVNKLILRKV 479

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 79/175 (45%), Gaps = 23/175 (13%)

Query: 60  QPINSPDGNYVLCVNGEIYN-HIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDG 118
           Q IN  D  Y L  NGE+YN  +      S Y  + L D E    +     ++  + L+G
Sbjct: 81  QSINV-DDRYYLQFNGELYNKEVSHWGNDSLYIASLLKDLEDDGSV-----IDVIKSLEG 134

Query: 119 MFAWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFAS---ELKCLVDECDEITAF 175
            +A+ +YDV+  +    RDPIG  +L    S ++    Y AS    ++C  D C   T +
Sbjct: 135 EYAYTVYDVKSAKFYFGRDPIGRRSL--SYSVTANNELYVASVTGAVECFHD-CIGGTVY 191

Query: 176 PPGHVYDSDTDKL--TRYFKPDWIDETRIPSQPVDY----KAVRTTLEKAVRKRL 224
                YD+ T  L   +  +P +    ++  + V      K + + L ++V+KR+
Sbjct: 192 E----YDTQTKSLHDNQRLRPPYEVTPKLDMEFVSLSIVSKNLYSVLRESVKKRI 242

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 355 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWG 414
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++NN+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 415 LEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILR 453
           +E R PFLD    +  +N    E    P   +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKE---IPINYKINKKILR 477

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 17/124 (13%)

Query: 27  VRHRGPDWSG-NVIKNDTILVHERLAIVGLDSGAQPINSPDGNYVLCVNGEIYNHIHLRE 85
           +  RGP++    V K++ I  +  +  +      Q I   D  Y+L  NGE+YN+     
Sbjct: 47  IARRGPNYQMFRVFKSEQISWYSSILSLRKPFTKQSIEVND-RYILQFNGELYNN----- 100

Query: 86  ECSDYEFTSLSDCEPII-----PLYLKYDVETPQHLDGMFAWCLYDVQRDRIVAARDPIG 140
                E   +SD    +      L  K  +   + L+G FA+ ++D ++  +   RD IG
Sbjct: 101 -----EIHGISDTTYFVNCLKTALDEKDIINILRTLEGEFAYTIFDSKKKLVYFGRDTIG 155

Query: 141 VTTL 144
             +L
Sbjct: 156 KRSL 159

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 61/118 (51%), Gaps = 12/118 (10%)

Query: 352 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTM 411
           +  + QGV ++LSG G+DE++GGY  FA   +  E   E  +++NN++  +  R +K   
Sbjct: 385 KSYQRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIA 442

Query: 412 AWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKA---FDTSDEPGVDP 466
             G+E R PFLD    +  +N+   E    P   ++ K ILRK    F   DE   +P
Sbjct: 443 HNGVEVRYPFLD----EYVINLSTLE---IPINYKVNKLILRKVASLFLKLDEIAEEP 493

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 71/166 (42%), Gaps = 28/166 (16%)

Query: 1   MCGIFACY------RKDDIESF-------KPTAL-------RLSKRVRHRGPDWSG-NVI 39
           MCGI   Y       +D++  F       K T +       R+   +  RGP++S   VI
Sbjct: 1   MCGILLHYCPHKQLSEDELTEFPEGTDFGKTTCVNESSIFNRIIPYIAARGPNYSSLRVI 60

Query: 40  KNDTILVHERLAIVGLDSGAQPINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCE 99
           K         +  +      Q IN  D  Y L  NGE+YN     +E SD++  SL    
Sbjct: 61  KAHQTRWFSSVLSLRRPFTKQSINV-DDRYHLQFNGELYN-----KEISDWDNDSLYIAS 114

Query: 100 PIIPLYLKYDV-ETPQHLDGMFAWCLYDVQRDRIVAARDPIGVTTL 144
            +  L    +V +  + L+G +A+ +YDV+       RDPIG  +L
Sbjct: 115 LLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGKRSL 160

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (51%), Gaps = 9/102 (8%)

Query: 353 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTM 411
           KI  Q   +VL SG G+DE++GGY  FA    P +   E  +++NN+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANKSFP-DLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 412 AWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILR 453
           + G+E R PFLD   ++        E +  P   +I K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFS-----TEDL--PINYKINKLILR 473

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 12/81 (14%)

Query: 66  DGNYVLCVNGEIYNHIHLREECSDYEFTS--LSDCEPIIPLYLKYDVETPQHLDGMFAWC 123
           DG YVL  NGE+YN      E +D ++ +  L+  E  IP       +    LDG FA+ 
Sbjct: 86  DGRYVLQFNGELYND---EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYT 135

Query: 124 LYDVQRDRIVAARDPIGVTTL 144
           +YD +  +    RD IG  +L
Sbjct: 136 IYDTEDQKYYFGRDAIGKRSL 156

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ +G G+DE++GGY  FA   S  E   E  +++NN+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFAN-KSTEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRK 454
           FLD + ++  + +        P   + +K ILRK
Sbjct: 441 FLDEKVIKASVAL--------PISYKNDKMILRK 466

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 8/94 (8%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY  FA   S  E   E  K++NN++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRK 454
           FLD + ++        E++  P   +I K ILRK
Sbjct: 455 FLDIDVIKF-----STEEL--PINYKINKLILRK 481

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 65/163 (39%), Gaps = 33/163 (20%)

Query: 1   MCGIFACY---RKD-------------DIESFK------PTALRLSKRVRHRGPDWSG-N 37
           MCGI   Y   RKD             D E  K      P    +   +  RGP++S   
Sbjct: 1   MCGILLHYLGDRKDITLADDELIEFEEDFEGIKSCSNIDPIFNSMISDIAARGPNYSSFK 60

Query: 38  VIKNDTILVHERLAIVGLDSGAQPINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSD 97
           V K  +I     +  +      Q +   D  YV+  NGE+YN   ++   + Y    L +
Sbjct: 61  VSKQYSITWFSSVLSLREPFTKQCVEIKD-RYVVQFNGELYND-EIQYNDTQYTIQLLKE 118

Query: 98  CEPIIPLYLKYDVETPQHLDGMFAWCLYDVQRDRIVAARDPIG 140
            + II +  K        LDG FA+ +YD+Q       RDPIG
Sbjct: 119 GKEIIDVIRK--------LDGEFAYTIYDIQNRMFYFGRDPIG 153

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY  F    +P E   E  +++NN+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRK 454
           FLD   ++   +         P   +I K ILRK
Sbjct: 451 FLDEHVIKYSTH-------DIPINYKINKLILRK 477

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 35/228 (15%)

Query: 19  TALRLSKRVRHRGPDWSG-NVIKNDTILVHERLAIVGLDSGAQPINSPDGNYVLCVNGEI 77
           T   L K +  RGP+++    +K+  I +   +  +      Q +   D  YVL  NGE+
Sbjct: 40  TFSNLMKLISARGPNFASLRTLKDHRISLFSSVLSLREPFCKQSVLVED-RYVLQFNGEL 98

Query: 78  YNH--IHLREECSDYEFTSLSDCEPIIPLYLKYD------VETPQHLDGMFAWCLYDVQR 129
           YN   IH             +D + I+ L L  +      +   ++LDG FA+ +YD++ 
Sbjct: 99  YNDEIIH-------------NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAFSIYDLKN 145

Query: 130 DRIVAARDPIGVTTL--YMGK------SSSSPRTRYFASELKCLVDECDEITAFPPGHVY 181
            R+   RDPIG  +L  Y+        SS S   + F +    ++ E D      P  ++
Sbjct: 146 KRLYFGRDPIGKRSLCYYLTDANELYVSSVSGSIKGFKNCDAGVIYEYDATNKNSPLTIF 205

Query: 182 DSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVP 229
           ++  +  T   K D        S     + +   L  AVRKR+++  P
Sbjct: 206 NNIFEDFTINDKSDL----EFKSLQKHIEELYKVLYNAVRKRVLSIHP 249

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY  F    S  E   E   ++NN+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKA 455
           FLD   +Q      P          ++ K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINY-------KVNKLILRKV 474

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 11/78 (14%)

Query: 69  YVLCVNGEIYNHIHLREECSDYEFTS--LSDCEPIIPLYLKYDVETPQHLDGMFAWCLYD 126
           YVL  NGE+YN   ++++ +D +F +  LS    +I         T   LDG FA+ +YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSSTDVI--------HTLTQLDGEFAYTIYD 138

Query: 127 VQRDRIVAARDPIGVTTL 144
           ++  +I   RD IG  +L
Sbjct: 139 LRETKIYFGRDSIGKRSL 156

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 10/99 (10%)

Query: 355 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWG 414
           K +G+ ++ SG G+DE++GGY  F+   +P E   E   ++NN+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 415 LEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILR 453
           +E R PFLD   ++    +        P   ++ K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQL--------PINYKVNKMILR 472

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 56/119 (47%), Gaps = 17/119 (14%)

Query: 352 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKST 410
           + I  Q   +VL SG G+DE++GGY  F    SP     E  K++NN++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNN-KSPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 411 MAWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILR-------KAFDTSDEP 462
              G+E R PFLD E + L  ++        P   +  K ILR       +  D  +EP
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL--------PINYKTNKNILRLLATNKLQLMDIGEEP 485

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 9/93 (9%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY  F+   S  E   E  K++  +H  +  R +K     G+E R P
Sbjct: 390 VMFSGLGADELYGGYHKFSN-KSNEELVIELQKQIAQIHDRNLNRDDKVISNHGIEVRYP 448

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILR 453
           FLD   +Q  +++        P   ++ K+ILR
Sbjct: 449 FLDERVVQFSVDL--------PLNYKVNKHILR 473

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 8/77 (10%)

Query: 69  YVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVE-TPQHLDGMFAWCLYDV 127
           Y+L  NGE+YN   + E C        SD E I  L  K+ VE   +   G FA+ + D+
Sbjct: 90  YLLQYNGELYNDDTV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDL 142

Query: 128 QRDRIVAARDPIGVTTL 144
           Q  ++   RD IG  +L
Sbjct: 143 QERKVYFGRDSIGKRSL 159

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 10/97 (10%)

Query: 357 QGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLE 416
           +GV ++ SG G+DE++GGY   A   S  E       ++NN+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 417 ARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILR 453
            R PFLD + +Q    +        P   ++ K ILR
Sbjct: 445 VRYPFLDEKVVQFSTEL--------PINYKVNKKILR 473

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 19/124 (15%)

Query: 69  YVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQ---HLDGMFAWCLY 125
           +VL  NGE+YN                +D   I  L  +Y  + P+    ++G FA+ ++
Sbjct: 91  FVLQYNGELYNS-----------SIQHNDTLFIASLIERYQDDIPKAIREMEGEFAYTIF 139

Query: 126 DVQRDRIVAARDPIGVTTL-YMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHVYDSD 184
           D Q +++   RD IG  +L Y   S +S       S      ++C+  T +    +YDS 
Sbjct: 140 DKQCEKLYFGRDTIGKRSLSYKFDSETSKLFISSVSGTSEGFEDCEGGTIY----IYDSK 195

Query: 185 TDKL 188
           T  L
Sbjct: 196 TGNL 199

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 9/95 (9%)

Query: 361 MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP 420
           ++ SG G+DE++GGY  F++  +  E   E   ++NN++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 421 FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKA 455
           FLD + +     +        P   ++ K ILRK 
Sbjct: 448 FLDDQVVAFSTQL--------PINYKVNKMILRKV 474

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 352 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTM 411
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++NN++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 412 AWGLEARVPFLDREFLQL 429
           + G+E R PFL  E ++ 
Sbjct: 442 SNGVEVRYPFLAEEVVEF 459

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 83/187 (44%), Gaps = 45/187 (24%)

Query: 1   MCGIFACY-----RKDD--IESFKPTALRLS---------KRVRHRGPDW-SGNVIKN-D 42
           MCGI  CY      ++D  +E ++    RL          K VR RGP++ S   IK+ +
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 43  TILVHERLAIVGLDSGAQPINSPD---GN-YVLCVNGEIYNHIHLREECSDYEFTS--LS 96
           +I +   L++       QP        GN YVL  NGE+YN   + E  +D +F S  L 
Sbjct: 61  SIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPLYLKYDVETPQH-LDGMFAWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRT 155
            C        + D+    H LDG FA+ + D++ + I   RD I       GK S S   
Sbjct: 114 KCIS------EDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTI-------GKRSLSYSL 160

Query: 156 RYFASEL 162
            Y  SEL
Sbjct: 161 NYNISEL 167

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 36.6 bits (83), Expect = 0.017,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 14/89 (15%)

Query: 102 IPLYLKYDVETPQHLDGMFAWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASE 161
           +P YL+ D++ P+HL+ MFA+     ++              ++ G S    RT +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LVDECDEITAFPPGHVYDSD 184
             L C    L   CD   +F PG V+DS+
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,056,939
Number of extensions: 2630863
Number of successful extensions: 5317
Number of sequences better than 10.0: 45
Number of HSP's gapped: 5346
Number of HSP's successfully gapped: 61
Length of query: 571
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 456
Effective length of database: 40,294,809
Effective search space: 18374432904
Effective search space used: 18374432904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)