Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR296C5.712ON1169116951570.0
SAKL0E15136g5.712ON103778216570.0
KLTH0E00814g5.712ON97476715700.0
Kwal_55.196455.712ON97073315370.0
Ecym_40095.712ON151744215660.0
KLLA0A00396g5.712ON101244813371e-166
NDAI0F002005.712ON110546612871e-157
TDEL0B020805.712ON102545012671e-155
NCAS0G001705.712ON103044812611e-154
CAGL0H06721g5.712ON108145512411e-151
Kpol_2001.785.712ON40341211411e-145
YIL156W (UBP7)5.712ON107148311831e-142
Suva_9.305.712ON106247911811e-142
TPHA0D046605.712ON104544211531e-138
Smik_11.3625.712ON72145010401e-126
YKR098C (UBP11)5.712ON71746710321e-125
Skud_11.3385.712ON71244610241e-123
Suva_11.3355.712ON72447510211e-123
KNAG0L022005.712ON11615739751e-112
KAFR0D021605.712ON8464449401e-110
ZYRO0B16544g5.712ON10445648901e-101
CAGL0G02563gsingletonON6314558262e-96
TBLA0E017605.712ON12122667792e-85
Smik_9.135.712ON10602527512e-82
Skud_9.125.712ON10642527319e-80
KAFR0H001505.712ON6562495384e-57
Kpol_304.65.712ON5622043402e-32
KAFR0C025908.188ON9784472517e-21
NCAS0B042808.188ON9224472491e-20
CAGL0I06765g8.188ON8874702419e-20
TDEL0B042208.188ON8252622373e-19
Ecym_61848.188ON8514452258e-18
YER144C (UBP5)8.188ON8052622194e-17
TBLA0F036108.188ON11442432195e-17
AFR007W8.188ON8484132151e-16
ZYRO0G06798g8.188ON8772392142e-16
NDAI0C059008.188ON8263122132e-16
TPHA0C027708.188ON9702392114e-16
Kpol_1032.288.188ON8822402088e-16
KNAG0D019308.188ON9863252061e-15
CAGL0G05247g8.188ON9472482052e-15
NDAI0A036808.188ON11163092009e-15
Smik_4.3078.188ON9292511972e-14
KLLA0E10275g8.188ON7965471952e-14
Suva_2.2288.188ON9272711953e-14
Smik_5.3098.188ON8052631953e-14
Skud_5.2818.188ON8232591943e-14
Suva_5.2728.188ON7882741934e-14
YDR069C (DOA4)8.188ON9262441901e-13
Skud_4.3238.188ON9262511829e-13
KLTH0H07678g8.188ON8612851783e-12
SAKL0H18986g8.188ON8932521748e-12
NCAS0A039108.188ON7952541693e-11
Kwal_14.20088.188ON4243161638e-11
KNAG0G015908.188ON6712401496e-09
SAKL0C04246g1.137ON12971461363e-07
TDEL0C056401.137ON11782211336e-07
Kpol_2001.541.137ON12231991302e-06
ZYRO0C17908g1.137ON12042021282e-06
Kwal_33.136281.137ON11602371273e-06
YJL197W (UBP12)1.137ON12542621256e-06
TBLA0J006001.137ON14621321247e-06
ZYRO0B03300g7.390ON8131291238e-06
TBLA0D010708.742ON4832581211e-05
Suva_6.2761.137ON1256681221e-05
Skud_10.221.137ON12552061212e-05
AFR627C1.137ON12871931202e-05
KNAG0C021801.137ON1231821193e-05
KNAG0C035807.390ON7761231193e-05
NCAS0I031401.137ON1201491184e-05
CAGL0L01639g1.137ON11471301184e-05
KNAG0B023707.390ON7531221174e-05
NCAS0D023905.18ON12111051175e-05
Smik_10.371.137ON12472191166e-05
Ecym_81401.137ON12642171167e-05
SAKL0H04994g8.742ON4541461147e-05
Skud_2.387.390ON7481211157e-05
KLTH0F03674g1.137ON11981301167e-05
Smik_2.497.390ON7451231158e-05
AEL242W8.540ON613981149e-05
Suva_2.507.390ON7501231149e-05
ZYRO0A05962g8.742ON4651121112e-04
TPHA0P006807.390ON7271271112e-04
KLLA0C03476g1.137ON12522061112e-04
KAFR0A042108.742ON4401331103e-04
NCAS0A143707.390ON7291221103e-04
KNAG0A019708.540ON4711621093e-04
NDAI0A016707.390ON8461221103e-04
KAFR0F015601.137ON11711311103e-04
YBL067C (UBP13)7.390ON7471231094e-04
CAGL0K10494g1.369ON4951041084e-04
TPHA0L022905.18ON11931071085e-04
KLLA0C06974g8.742ON4461371066e-04
NCAS0E026107.390ON7171291077e-04
TPHA0A025401.137ON1286801078e-04
NCAS0B005808.742ON4661411058e-04
CAGL0I05522g7.390ON7241281060.001
TPHA0E008707.390ON715931040.002
KLLA0D08459g2.69ON7501031030.002
NDAI0E041807.390ON8271451020.003
NDAI0B004801.137ON1253761020.003
TBLA0C012001.369ON503341000.004
NCAS0D006001.369ON493591000.004
TDEL0C015707.390ON765311010.004
KLTH0D12760g8.742ON4531351000.004
Kwal_26.91518.742ON454135990.005
YER098W (UBP9)7.390ON75494990.006
NDAI0I025305.18ON1197105990.006
Ecym_46857.390ON778101990.006
Kpol_534.231.369ON49684980.008
KNAG0E012905.18ON1196106980.008
Kpol_1045.417.390ON71231980.008
CAGL0M11198g8.742ON461136970.009
CAGL0A04477g7.390ON77031970.009
YPL072W (UBP16)8.540ON499101960.011
Smik_13.4318.742ON471152960.011
KLLA0E20351g7.390ON69731960.012
SAKL0F12430g7.390ON75499960.014
Ecym_62488.742ON466138950.015
YMR223W (UBP8)8.742ON471152950.016
NDAI0E008108.742ON493124950.017
ZYRO0G01188g1.369ON50048940.018
TBLA0H036008.540ON482391940.021
Skud_13.3928.742ON473154930.024
Suva_13.4078.742ON471152930.025
Ecym_11668.540ON69694930.026
KAFR0L017307.390ON701123930.027
TBLA0C070205.18ON1247105930.030
Smik_5.2447.390ON74994930.030
KLLA0F18700g3.270ON77058930.031
KNAG0C019401.369ON49957920.032
Skud_5.2237.390ON74827930.032
ZYRO0D07062g5.18ON1193123930.032
TDEL0G004105.18ON1186105930.035
NDAI0H035501.369ON502101920.035
Suva_6.831.369ON50082920.036
CAGL0M13783g5.18ON1196104920.040
TPHA0J026205.443ON122532920.041
KLTH0B09944g5.18ON1189105920.041
KNAG0G029308.742ON459144910.042
Kpol_513.255.18ON1190105920.047
Suva_13.4955.18ON1230111920.049
SAKL0H10076g8.540ON76781910.050
Kpol_1064.488.742ON466120900.053
Kpol_1024.448.540ON496244900.054
SAKL0D10120g1.369ON49256900.060
Ecym_27171.369ON48381900.063
Suva_5.2177.390ON75427890.078
AEL029W1.369ON44682890.079
Kwal_34.162681.369ON44943890.082
Smik_7.3141.369ON499107890.085
YFR010W (UBP6)1.369ON49931890.087
Skud_6.941.369ON49931890.088
AGR370W7.390ON74027890.091
TDEL0B036708.742ON463116880.096
TDEL0D024001.369ON49459880.099
Kpol_1018.937.390ON75532880.10
YMR304W (UBP15)5.18ON1230112890.11
KAFR0K018107.390ON71427880.11
SAKL0G02728g5.443ON123731880.12
KNAG0J008003.270ON76533880.12
Suva_8.1765.443ON127049880.13
ZYRO0G01606g5.443ON130530880.14
KLLA0E23387g8.540ON78281870.15
AGR139C8.202ON78974870.16
AGL357W5.18ON1166105870.17
Skud_15.2865.443ON127849870.17
TPHA0A025101.369ON50532860.17
KLTH0E12540g8.540ON75268860.19
Smik_13.5215.18ON1231112860.20
KNAG0A054502.307ON764271860.20
TDEL0G023702.307ON747200850.23
NCAS0H021005.443ON126939860.25
NCAS0C021108.540ON494242850.25
Skud_13.4785.18ON1231112850.25
Kwal_56.230843.270ON76255850.27
ACL164C5.443ON138949850.30
TBLA0D006207.390ON117131850.32
KLLA0A10791g1.369ON48430840.33
YOR124C (UBP2)5.443ON127252840.36
TDEL0D025805.443ON127230840.39
KAFR0C045201.369ON49930830.40
Smik_15.3015.443ON127249840.42
CAGL0K10252g5.443ON126746840.42
Ecym_56715.18ON1176105830.44
SAKL0H00418g5.18ON1190105830.50
Ecym_45145.443ON124627830.51
TBLA0A064705.443ON132030830.52
NDAI0C015505.443ON129530830.52
KAFR0D050705.443ON122734820.56
NCAS0A038408.202ON917141820.58
KNAG0B041905.443ON126230820.59
TBLA0B019308.202ON1019141820.60
Kpol_1056.458.97ON451108810.63
TPHA0E017105.443ON128327820.65
ZYRO0D03982g8.540ON821242820.67
ZYRO0F01276g3.270ON77621810.68
Kpol_219.1singletonON24951800.69
KLLA0E08801g2.307ON77126810.71
KLTH0H13354g1.369ON49531810.71
Skud_16.2098.540ON50384810.75
KLLA0E02377g5.443ON122031810.78
Kwal_55.213935.443ON123330810.78
CAGL0I06600g8.202ON816150810.80
KAFR0I026005.18ON1213106810.87
Klac_YGOB_Anc_5.18b5.18ON1166107810.88
KAFR0E009308.540ON498230800.90
Kpol_1062.235.443ON126627800.99
KLTH0F15862g5.443ON124126801.0
TDEL0B030608.540ON734234801.1
TPHA0G005608.742ON463137791.1
CAGL0H10186g3.270ON77821791.2
Kwal_27.120308.540ON74968791.4
Smik_16.1638.540ON50195791.4
TDEL0D035503.270ON78021781.6
NCAS0I016203.270ON79570781.6
CAGL0H05335g8.540ON48386771.9
Skud_4.1332.307ON78738782.0
Suva_4.1252.307ON79338782.0
AFR551W8.742ON469110772.1
Kpol_1016.15.443ON125126772.4
YDL122W (UBP1)2.307ON80937772.6
Smik_4.1152.307ON790201762.7
Kwal_26.95985.18ON1191105753.7
TDEL0C012608.97ON45980735.5
Kwal_27.108427.390ON71127735.9
TBLA0E025703.270ON78521746.0
NDAI0A074103.270ON81021736.6
SAKL0D03322g3.270ON76521728.8
SAKL0B01078g8.28ON130295729.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR296C
         (1169 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...  1991   0.0  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   642   0.0  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   609   0.0  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   596   0.0  
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   607   0.0  
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   519   e-166
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     500   e-157
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   492   e-155
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     490   e-154
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   482   e-151
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   444   e-145
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   460   e-142
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   459   e-142
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   448   e-138
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   405   e-126
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   402   e-125
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   399   e-123
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   397   e-123
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   380   e-112
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   366   e-110
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   347   e-101
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   322   2e-96
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   304   2e-85
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   293   2e-82
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   286   9e-80
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   211   4e-57
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   135   2e-32
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   101   7e-21
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    100   1e-20
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    97   9e-20
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...    96   3e-19
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    91   8e-18
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    89   4e-17
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    89   5e-17
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    87   1e-16
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    87   2e-16
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    87   2e-16
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    86   4e-16
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    85   8e-16
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    84   1e-15
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    84   2e-15
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              82   9e-15
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    80   2e-14
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    80   2e-14
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    80   3e-14
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    80   3e-14
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    79   3e-14
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    79   4e-14
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    78   1e-13
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    75   9e-13
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    73   3e-12
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    72   8e-12
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     70   3e-11
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    67   8e-11
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    62   6e-09
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    57   3e-07
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    56   6e-07
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    55   2e-06
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    54   2e-06
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    54   3e-06
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    53   6e-06
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    52   7e-06
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    52   8e-06
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    51   1e-05
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    52   1e-05
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    51   2e-05
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    51   2e-05
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    50   3e-05
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    50   3e-05
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    50   4e-05
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    50   4e-05
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    50   4e-05
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    50   5e-05
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    49   6e-05
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    49   7e-05
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    49   7e-05
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    49   7e-05
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    49   7e-05
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    49   8e-05
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    49   9e-05
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    49   9e-05
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    47   2e-04
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    47   2e-04
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    47   2e-04
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    47   3e-04
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    47   3e-04
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    47   3e-04
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    47   3e-04
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    47   3e-04
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    47   4e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    46   4e-04
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    46   5e-04
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    45   6e-04
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    46   7e-04
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    46   8e-04
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       45   8e-04
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    45   0.001
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    45   0.002
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    44   0.002
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    44   0.003
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    44   0.003
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    43   0.004
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    43   0.004
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    44   0.004
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    43   0.004
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    43   0.005
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    43   0.006
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    43   0.006
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    43   0.006
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    42   0.008
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    42   0.008
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    42   0.008
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    42   0.009
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    42   0.009
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    42   0.011
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    42   0.011
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    42   0.012
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    42   0.014
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    41   0.015
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    41   0.016
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    41   0.017
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    41   0.018
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    41   0.021
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    40   0.024
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    40   0.025
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    40   0.026
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    40   0.027
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    40   0.030
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    40   0.030
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    40   0.031
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    40   0.032
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    40   0.032
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    40   0.032
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    40   0.035
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.035
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    40   0.036
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    40   0.040
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    40   0.041
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    40   0.041
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    40   0.042
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    40   0.047
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    40   0.049
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    40   0.050
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    39   0.053
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    39   0.054
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    39   0.060
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    39   0.063
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    39   0.078
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    39   0.079
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    39   0.082
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    39   0.085
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    39   0.087
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    39   0.088
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    39   0.091
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    39   0.096
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    39   0.099
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    39   0.10 
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    39   0.11 
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    39   0.11 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    39   0.12 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    39   0.12 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    39   0.13 
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    39   0.14 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    38   0.15 
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    38   0.16 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    38   0.17 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    38   0.17 
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    38   0.17 
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    38   0.19 
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    38   0.20 
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    38   0.20 
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    37   0.23 
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    38   0.25 
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    37   0.25 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    37   0.25 
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    37   0.27 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    37   0.30 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.32 
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    37   0.33 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    37   0.36 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    37   0.39 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    37   0.40 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    37   0.42 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    37   0.42 
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    37   0.44 
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    37   0.50 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    37   0.51 
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    37   0.52 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.52 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    36   0.56 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    36   0.58 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    36   0.59 
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    36   0.60 
Kpol_1056.45 s1056 complement(114032..115387) [1356 bp, 451 aa] ...    36   0.63 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    36   0.65 
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    36   0.67 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    36   0.68 
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    35   0.69 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    36   0.71 
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    36   0.71 
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    36   0.75 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    36   0.78 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    36   0.78 
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    36   0.80 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    36   0.87 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    36   0.88 
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    35   0.90 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    35   0.99 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    35   1.0  
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    35   1.1  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    35   1.1  
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    35   1.2  
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    35   1.4  
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    35   1.4  
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    35   1.6  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    35   1.6  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    34   1.9  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    35   2.0  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    35   2.0  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    34   2.1  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    34   2.4  
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    34   2.6  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    34   2.7  
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    33   3.7  
TDEL0C01260 Chr3 complement(214580..215959) [1380 bp, 459 aa] {O...    33   5.5  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    33   5.9  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    33   6.0  
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    33   6.6  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    32   8.8  
SAKL0B01078g Chr2 (97198..101106) [3909 bp, 1302 aa] {ON} simila...    32   9.9  

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 1991 bits (5157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 987/1169 (84%), Positives = 987/1169 (84%)

Query: 1    MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
            MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT
Sbjct: 1    MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60

Query: 61   REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120
            REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA
Sbjct: 61   REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120

Query: 121  VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180
            VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV
Sbjct: 121  VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180

Query: 181  AVQADTLWSAPKLEENDXXXXXXXXXXXXXXXXXXXXXXGGDFVENALDGNSTKNGGRNT 240
            AVQADTLWSAPKLEEND                      GGDFVENALDGNSTKNGGRNT
Sbjct: 181  AVQADTLWSAPKLEENDLLRTVVSVSRSPSVSLSRPSSRGGDFVENALDGNSTKNGGRNT 240

Query: 241  SKREXXXXXXXXXXXXXXXXXAKQXXXXXXXXXXXXXXXXXXXXXXXXXQTRIGGPTSDM 300
            SKRE                 AKQ                         QTRIGGPTSDM
Sbjct: 241  SKREGRRNSRRSDRSGRRNDGAKQRNGRSPNRSRSRGRSRSRVRNRSRSQTRIGGPTSDM 300

Query: 301  ADAKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 360
            ADAKE                                                       
Sbjct: 301  ADAKERGRTRSRSWSRSGSRSPSYSIRSTGGSRSPSRSPSRSASRSPIRGRSRSRSGSRT 360

Query: 361  XELGSATASVHSWSYLQTTGQQSRWSVLPNDLPNAGQNKYNQESAVSFEQQELDRPHNSR 420
             ELGSATASVHSWSYLQTTGQQSRWSVLPNDLPNAGQNKYNQESAVSFEQQELDRPHNSR
Sbjct: 361  PELGSATASVHSWSYLQTTGQQSRWSVLPNDLPNAGQNKYNQESAVSFEQQELDRPHNSR 420

Query: 421  VEPYNPFANGNAAGLESCNPLTRLYETSSIKCSDLMIILESDIQDRVLFIDLRPPKRYEL 480
            VEPYNPFANGNAAGLESCNPLTRLYETSSIKCSDLMIILESDIQDRVLFIDLRPPKRYEL
Sbjct: 421  VEPYNPFANGNAAGLESCNPLTRLYETSSIKCSDLMIILESDIQDRVLFIDLRPPKRYEL 480

Query: 481  NHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMN 540
            NHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMN
Sbjct: 481  NHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMN 540

Query: 541  MDFKFELTFFELVYMGKPRLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRANFLGRD 600
            MDFKFELTFFELVYMGKPRLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRANFLGRD
Sbjct: 541  MDFKFELTFFELVYMGKPRLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRANFLGRD 600

Query: 601  TSVSDHNPFRXXXXXXXXXXXXXXXXXXXXXXXXYISSPRPVPFIPLQQPSLSLLHTSAN 660
            TSVSDHNPFR                        YISSPRPVPFIPLQQPSLSLLHTSAN
Sbjct: 601  TSVSDHNPFRATPPVPTARPPVPPLPTAPPPVAPYISSPRPVPFIPLQQPSLSLLHTSAN 660

Query: 661  IVKPGKAELRNELSRITGQIDHTQYNQPEKYRYLPDSRESPYPIEYEDPKHTERSRGWLS 720
            IVKPGKAELRNELSRITGQIDHTQYNQPEKYRYLPDSRESPYPIEYEDPKHTERSRGWLS
Sbjct: 661  IVKPGKAELRNELSRITGQIDHTQYNQPEKYRYLPDSRESPYPIEYEDPKHTERSRGWLS 720

Query: 721  AGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780
            AGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS
Sbjct: 721  AGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780

Query: 781  RYLKSSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXX 840
            RYLKSSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQ    
Sbjct: 781  RYLKSSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLL 840

Query: 841  XXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQG 900
                      SYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQG
Sbjct: 841  FLLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQG 900

Query: 901  QIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQ 960
            QIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQ
Sbjct: 901  QIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQ 960

Query: 961  NPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXX 1020
            NPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRL           
Sbjct: 961  NPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIGSKSRSRS 1020

Query: 1021 XXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYP 1080
                         THEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYP
Sbjct: 1021 SSPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYP 1080

Query: 1081 LILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
            LILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK
Sbjct: 1081 LILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140

Query: 1141 LDPNHGNYDRGITSVSSSDVYLLFYERIS 1169
            LDPNHGNYDRGITSVSSSDVYLLFYERIS
Sbjct: 1141 LDPNHGNYDRGITSVSSSDVYLLFYERIS 1169

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/782 (45%), Positives = 464/782 (59%), Gaps = 40/782 (5%)

Query: 403  ESAVSFEQQELDRPHNSRVEPYNPF----ANGNAAGLESCNPLTRLYETSSIKCSDLMII 458
            ES  +   Q +DR +  R + Y+       + +    +    L+RL +   I C +LM I
Sbjct: 278  ESVANIYVQNVDRYNTHRKDSYHSVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDI 337

Query: 459  LESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDN- 517
            L+SD ++ VL +DLR  KR+  NHIVA +LINIDP  LWD +R  PI+S  E E+++ + 
Sbjct: 338  LQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSY 397

Query: 518  PLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLL---TKCLQGGYDQWRL 574
              F +R +F Y+V YTD  T +N+DF + L FF+L+Y      L    K L G Y+QW+ 
Sbjct: 398  QTFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKT 457

Query: 575  YLKTNTKSIHAKISDFMWRANFLGRDTSVSDHNPFRXXXXXXXXXXXXXXXXXXXXXXXX 634
            ++    K       D+++R       +      P                          
Sbjct: 458  FIGQYAKHHDIVTGDYLFRPYASSAKSQKDKVKPISAPPVPATRPPPPPLPAQAPPAL-- 515

Query: 635  YISSPRPVPFIPLQQPSLSLLHTSANIVKPGKAELRNELSRITG------QIDHTQYNQP 688
               S  P P +P Q P    +        P K+ +    S  TG      Q+  T  +  
Sbjct: 516  --PSQAP-PTLPSQAPPTQSIPAVHLPPLPPKSAINLHYSVATGMQPPMPQV--TTVSHA 570

Query: 689  EKYRYLPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGL 748
             ++RYL                H++RS+    +  S  + SVPTIE++ N Y++LSITGL
Sbjct: 571  HRHRYL---------------SHSKRSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGL 615

Query: 749  RNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMD--NMSRSFYMLFKKMYMNG 806
            RN+ +TCYINSMLQCLF+T +FR++FLS KY  Y+    +    +SRSF+MLFKKMYMNG
Sbjct: 616  RNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNG 675

Query: 807  GCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLH 866
            GCSVVPSGFLK C+ ++PD +IP+ QQDTQ              S    V NDYPQLLLH
Sbjct: 676  GCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQLHDELSDPEQVANDYPQLLLH 735

Query: 867  ESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSL 926
            +   L+V+ KEY  WF+ +  KNGLSPIDSIFQGQ+E+ L CQRC  SSY+YSTFYVLSL
Sbjct: 736  DDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSL 795

Query: 927  ALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRK 986
            A+P PG+  FGK KK+ LEDCIN FT DEVL+G+N WDCP+CG + SG       K+K+K
Sbjct: 796  AIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTSMSGSGP-GEGKAKKK 854

Query: 987  NKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATI 1046
             KF +  ++ N+ N                                   EK  +KKL TI
Sbjct: 855  RKFLLPHDHVNN-NRTSRFFKFRSKSRSRSSSPFNSSNGHNSGSSMPGSEKWKSKKLTTI 913

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGT 1106
            K+ NFIT+P IL+IHLSRF YDLTKKN+TV+TYPLILNIVLKNNEVAKYRLY  +NHFG 
Sbjct: 914  KTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGN 973

Query: 1107 LISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYE 1166
            LISGHYTSLVNKDL+HEIR G+QKWYYFDDE+VK D NHG++D GI SVSSSDVY+LFYE
Sbjct: 974  LISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYE 1033

Query: 1167 RI 1168
            RI
Sbjct: 1034 RI 1035

 Score =  193 bits (491), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/207 (48%), Positives = 135/207 (65%), Gaps = 23/207 (11%)

Query: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
           M   Y PEYS+EL  FVQ+ Y Q ++  YP+L+ EKL+DLLE A  LFESY  ++++G  
Sbjct: 1   MECSYTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQ 60

Query: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120
            + L A++IG+FY+YLIIPQSI+FHTRN SY +Y DLRK+Y+ E +MTNV+ MVT+KVDA
Sbjct: 61  EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA 120

Query: 121 VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180
           +L +    D    DTK+ RKRAYSVP + +A    SL     DG  +         +PEV
Sbjct: 121 ILCKSRDFD----DTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQ---------LPEV 167

Query: 181 AVQADTL----------WSAPKLEEND 197
           + ++DTL          WSAPKLE +D
Sbjct: 168 SKESDTLTNYADDYTTIWSAPKLEPDD 194

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/767 (43%), Positives = 447/767 (58%), Gaps = 60/767 (7%)

Query: 408  FEQQELDRPHNSRVEPYNPFANGNAAGLESCNPLTRLYETSSIKCSDLMIILESDIQDRV 467
            F  Q+++R    R + Y+     N         L RL + S + C  LM IL S  +D +
Sbjct: 258  FNDQKINRYATHRKDSYHSVHMSNDDYDAFTFNLARLQKQSVVTCDQLMRILCSQDRDNL 317

Query: 468  LFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFS 527
            L IDLR  KR++ NHI+A +L+N+DP LLW+  + +PI S  + ER LDN L   R QF 
Sbjct: 318  LLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFE 377

Query: 528  YLVCYTDNHTSMNMDFKFELTFFELVYMGKPRL--LTKCLQGGYDQWRLYLKTNTKSIHA 585
            Y+V YTD  T M +DF ++L FF+L+Y     L    K L GGY+QW+ +L  ++++   
Sbjct: 378  YIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFLSKSSQAYCD 437

Query: 586  KISDFMWRANFLGRDTSVSDHN--PFRXXXXXXXXXXXXXXXXXXXXXXXXYISSPRPVP 643
            K + F++ +   GR+  V+ H+                             Y  +P P P
Sbjct: 438  KDA-FLYSSTNNGRNAPVTSHSLPEHYPVAPPSIPPPPPPIAKTEEMTKTPYNRAPFPTP 496

Query: 644  FIPLQQPSLSLLHTSANIVKPGKAELRNELSRITGQIDHTQYNQPEKYRYLPDSRESPYP 703
             +  Q+       +S N  +      ++ +  ++G  +++      K+  +P   +SP  
Sbjct: 497  LVQAQRAD-HFPASSQNHTRDKNEIQKHSVPALSGNGNYS------KHTAIPTIEQSP-- 547

Query: 704  IEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQC 763
                                              NEY+ALSITGLRN+  TCY+NSMLQC
Sbjct: 548  ----------------------------------NEYVALSITGLRNIGCTCYVNSMLQC 573

Query: 764  LFSTTEFRNLFLSNKYSRYL--KSSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSY 821
            LF+T  FR+LFLS KY  Y   K +N + +S+ F +LFKKMYMNGGCSVVP+GFLK C+ 
Sbjct: 574  LFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNA 633

Query: 822  LKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTW 881
            L+PD RIPH QQDTQ              S    V NDYP LLLH+   L V+ KEY TW
Sbjct: 634  LRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTW 693

Query: 882  FDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKK 941
            F+++  +NG+SPID+IFQGQ+E+ L CQRC  SS++YS FYVLSLA+P+  S  F + KK
Sbjct: 694  FEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTS-TFSQRKK 752

Query: 942  LRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANS 1001
            +RLEDCIN FT DE LT +N WDCPKCG ++SG      E+ K+K +F +  +    A+ 
Sbjct: 753  VRLEDCINLFTSDEQLTNENAWDCPKCGTSASG---TGPEEEKKKKRFLLNPD--TRASG 807

Query: 1002 NRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIH 1061
            NR    +L                          EK  +KKL TIK+LNFI+LP +L IH
Sbjct: 808  NRSRFFKLRSKSRSRSVSPFRKQSSQQQNL----EKLKSKKLTTIKTLNFISLPTVLTIH 863

Query: 1062 LSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQ 1121
            LSRF YDLTKKNN V+TYPLIL+IVLKN ++ KYRLY+  NHFG LISGHYTSLVNKDL 
Sbjct: 864  LSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLD 923

Query: 1122 HEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            H++ +GKQKWYYFDDE VK D NHG+ D GITS+SSSDVY+LFYE+I
Sbjct: 924  HDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970

 Score =  150 bits (380), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 120/198 (60%), Gaps = 14/198 (7%)

Query: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
           M+  Y PEYS+EL  FV++ Y Q +   +P+LR EKL+DLLE A  LFESY+  +   Q 
Sbjct: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60

Query: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120
            + L A+V G FY+YLIIP SI+F +R+ SY++Y DL+K+Y+ E NMTNV+ MVTE +++
Sbjct: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120

Query: 121 VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180
           +         E    ++ RKRAYSVP     +S  ++Q L+    +         A  E 
Sbjct: 121 M------SKDEVETARIMRKRAYSVP---YGKSPVTIQALS----KANSATVEPDAPTET 167

Query: 181 AVQ-ADTLWSAPKLEEND 197
             +   T+W+AP+LE ND
Sbjct: 168 EFENGTTMWTAPELEPND 185

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/733 (45%), Positives = 423/733 (57%), Gaps = 60/733 (8%)

Query: 442  TRLYETSSIKCSDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTER 501
             RL + S I C  L+ IL+S+  +R+L +DLR  KR+E NHIVA +L+N+DP+ LWD  +
Sbjct: 292  ARLQKQSIITCDKLLRILDSEEAERLLLVDLRFIKRFETNHIVAPNLVNLDPMNLWDFAK 351

Query: 502  SAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRL- 560
               I      E    N       QF ++V YTD  T M +DF ++L FF+++Y    R+ 
Sbjct: 352  GRAIEGDAPLEVLNKNHALKDLSQFKHIVYYTDMKTFMRLDFDYQLVFFQMLYTSNWRIS 411

Query: 561  -LTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRANFLGRDTSVSD--HNPFRXXXXXXX 617
               K L GGY+QW+ +L    +S       F++R    G++T  S   H           
Sbjct: 412  CTPKVLLGGYEQWKKFLAKVPQSRVPIKEAFLFRLKPGGKETVASAIIHQKASTPLPPSI 471

Query: 618  XXXXXXXXXXXXXXXXXYISSPRPVPFIPLQQPSLSLLHTSANIVKPGKAELRNELSRIT 677
                             Y  +P P+P              +  +V             I 
Sbjct: 472  PPPPPPVEKVSKADSGSYTRAPFPLP--------------AKEMV-------------IQ 504

Query: 678  GQIDHTQYNQPEKYRYLPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNP 737
              +D     Q      +P   ES Y  E             L      A  ++PTIE++ 
Sbjct: 505  SSLDSISRTQ------IPSHLESHYTHE-----------KVLQNKMHHAEGTIPTIEQSS 547

Query: 738  NEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL--KSSNMDNMSRSF 795
            NEY+ALSITGLRNM NTCYINSMLQCLF+T +FR+LFLS KY  Y   + SN   +S+ F
Sbjct: 548  NEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSNPHQLSKYF 607

Query: 796  YMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA 855
             +LFKKMYMNGGCSVVP+GFLK C+ L+PDL+IPH QQDTQ              S    
Sbjct: 608  NILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDELSESNH 667

Query: 856  VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSS 915
            V NDYP LLLH+   L V+ KEY  WF+ N  +NG+SPID+IFQGQ+E+ L CQRC  SS
Sbjct: 668  VANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENGLLCQRCGHSS 727

Query: 916  YSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGD 975
            Y+YS FYVLSLA+P   S +FG+ KK+RLEDCIN FT DE LT +N WDCPKCG   SG+
Sbjct: 728  YNYSMFYVLSLAIPASMS-SFGQKKKMRLEDCINLFTSDEKLTNENAWDCPKCGSAVSGN 786

Query: 976  RQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTH 1035
                 +  K+K KF   S+N+N  + +R                                
Sbjct: 787  ---GPDGDKKKRKFLSTSDNSNGRSRSR------FFKLRSKSRSRSVSPFHKPSSQSPAS 837

Query: 1036 EKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKY 1095
            EK  +KKL+TIK+LNF++LP +L IHLSRF+YDLT KNN V+TYPL L+IVLKNNEV  Y
Sbjct: 838  EKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNY 897

Query: 1096 RLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSV 1155
            RLY+  NHFG LISGHYTSLVNKDL H++  G+QKWYYFDDE+ K D NHGN D GITSV
Sbjct: 898  RLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSV 957

Query: 1156 SSSDVYLLFYERI 1168
            SSSDVY+LFYE+I
Sbjct: 958  SSSDVYVLFYEKI 970

 Score =  171 bits (432), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/198 (47%), Positives = 125/198 (63%), Gaps = 14/198 (7%)

Query: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
           M+  Y PEYS+EL  FV+E Y Q +   YPRLR EKL+DLLE A  LFESY+  +   Q 
Sbjct: 1   MNHLYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQN 60

Query: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120
            E L A+V+G FY+YLIIP SI+FH+R+ SY++Y DLRK+Y+ E NMTNV+ MVT  +++
Sbjct: 61  SELLTAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIES 120

Query: 121 VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180
           V         E    K+ RKRAYSVP K +   SD +Q LT+  +          A PE 
Sbjct: 121 V------SRDELESAKIMRKRAYSVPHKKL---SDKMQALTLSPETASS----TNAGPET 167

Query: 181 AVQAD-TLWSAPKLEEND 197
             + D T+W+AP+LE ND
Sbjct: 168 DNENDSTMWTAPELEPND 185

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/442 (67%), Positives = 337/442 (76%), Gaps = 12/442 (2%)

Query: 727  HFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSS 786
            HFS+PTIE + NEY+ALSITGLRNMSNTCYINSMLQCLFST+ FRNLFLSNKY+ YLKS 
Sbjct: 1086 HFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSP 1145

Query: 787  NMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXX 846
             MD MSRSFYMLF+KMYMNGGCSVVPSGFLKMC+ LKPDLRIP+GQQDTQ          
Sbjct: 1146 EMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKL 1205

Query: 847  XXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906
                S + +V NDY  LLLH++  L V+D +Y  WFDQN ++NGLSPID +FQGQ+E+QL
Sbjct: 1206 HDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265

Query: 907  SCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCP 966
            SCQRC +SSY+YSTFYVLSLALPNP +KAFGK KKLRLEDCINFFTCDEVL+ QN WDCP
Sbjct: 1266 SCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCP 1325

Query: 967  KCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXX 1026
            +C   S  D      K KR  K     E+ N  NS+R  L +                  
Sbjct: 1326 RCC--SPSDYMSYDHKGKR--KISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKL 1381

Query: 1027 XXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV 1086
                     +K  N K AT+KSLNFIT+PRIL+IHLSRF+YDLTKKNN VV+YPLILNIV
Sbjct: 1382 S--------DKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV 1433

Query: 1087 LKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHG 1146
            LKN+EVAK+RLYS +NHFGTLISGHYTSLVNK+L HEI  GKQKWYYFDDEIVK D NHG
Sbjct: 1434 LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHG 1493

Query: 1147 NYDRGITSVSSSDVYLLFYERI 1168
            +YD GI SVSSS+VY+LFYERI
Sbjct: 1494 DYDNGIASVSSSNVYVLFYERI 1515

 Score =  187 bits (475), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/207 (46%), Positives = 133/207 (64%), Gaps = 10/207 (4%)

Query: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
           M  PY+PEYS EL+ FV+E Y + +++ Y +LR EKL+DLLE  A L ESY++L+  GQ 
Sbjct: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60

Query: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120
             G+ AYV+GAFYLYLIIPQSIEFHTRNLSYS+Y DL++HYE +PNM NV+ +V  KV +
Sbjct: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120

Query: 121 VL-LRQTPEDGERGDTKLY-RKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP 178
           V+ L  + E  E+   +   RKRAYS+     ++ +D+L  L+++     G     G   
Sbjct: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180

Query: 179 EVAVQ--------ADTLWSAPKLEEND 197
           + A           DT+WSAP LE +D
Sbjct: 181 QGAFGQQQQDDEWEDTVWSAPNLEPDD 207

 Score =  174 bits (441), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 127/201 (63%), Gaps = 2/201 (0%)

Query: 394 NAGQNKYNQE-SAVSFEQQELDRPHNSRVEPYNPFANGNAAGLESCNPLTRLYETSSIKC 452
           ++  NK N E  ++      LDR +    +   P  N      E+ + +  LYE+SSIKC
Sbjct: 265 DSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPICNDGVVPCENSS-IMWLYESSSIKC 323

Query: 453 SDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFE 512
            DL+  L S  +  +L IDLR PKRYE +HI+A ++INIDP LLWD E+ AP++SV E E
Sbjct: 324 LDLLSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELE 383

Query: 513 RRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLTKCLQGGYDQW 572
             +DN LF +R QF+ +VCYTDN+T M +DF F    F L+Y+G+P+L+ K L GGY+QW
Sbjct: 384 LVIDNHLFRSRRQFATIVCYTDNYTYMQIDFDFVFLLFRLLYLGRPQLVLKTLSGGYEQW 443

Query: 573 RLYLKTNTKSIHAKISDFMWR 593
           + +LK   ++    +SDF+W+
Sbjct: 444 KSFLKELKRTESIILSDFLWK 464

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  519 bits (1337), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 322/448 (71%), Gaps = 15/448 (3%)

Query: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL--KS 785
            FS+PTIE++PNE+++LSITGLRNM NTCYINSMLQCLF  ++FR+LFL  KY RYL  K 
Sbjct: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629

Query: 786  SNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXX 845
            SN   +S+ F +LF+KMY+NGGCSVVP+GFLK C  L+PD  IP  QQDTQ         
Sbjct: 630  SNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDT 688

Query: 846  XXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQ 905
                 S    V NDYP LLLH+   L V++KEY  WFD+  + NGLSPID IFQGQ+E+ 
Sbjct: 689  LHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENS 748

Query: 906  LSCQRCDFSSYSYSTFYVLSLALPN-PGSKAFGKAKK-LRLEDCINFFTCDEVLTGQNPW 963
            L CQRC F+SY+YSTFYVLSLA+P  P  K F ++KK +RLEDCIN +T DE+LTG+N W
Sbjct: 749  LKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAW 808

Query: 964  DCPKCGVNS-SGDRQMNSEKS--KRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXX 1020
            DCPKCG +S S D  MNS+++  K+K K F+     N  + +R    +L           
Sbjct: 809  DCPKCGTHSNSSDGSMNSDETVDKKKKKNFLS---VNGDHKSRSKFFKL--SSSRSGKRS 863

Query: 1021 XXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYP 1080
                          H K  +KK+ TIK+LNFIT+P IL+IHLSRF YDLTKKN T++ YP
Sbjct: 864  LSPFKSNSVKPEKLHIK--SKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYP 921

Query: 1081 LILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
            LIL++VLKNNE+A+YRLY  INHFG L+SGHYTSLVNK L HEIR+G+QKWYYFDDE+VK
Sbjct: 922  LILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVK 981

Query: 1141 LDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             + NHG++DRGITS+SS DVY+LFYERI
Sbjct: 982  KEFNHGDFDRGITSISSGDVYVLFYERI 1009

 Score =  126 bits (317), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 118/197 (59%), Gaps = 10/197 (5%)

Query: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
           MS  Y PEYS EL +FVQE Y Q V+  Y +L+ EKL++LLE+A +LFESY++ +   + 
Sbjct: 1   MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKY 60

Query: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120
            + L  YVIG+FY++LIIP S++F  RN SYS+Y+DL+K Y+ E NM+NV+ MV  KVD+
Sbjct: 61  EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120

Query: 121 VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180
           V L Q  E   +      RKRA+SV E  +     +LQ    D K             + 
Sbjct: 121 V-LNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQK---------SVDDDY 170

Query: 181 AVQADTLWSAPKLEEND 197
              A T W AP+L+ ND
Sbjct: 171 KSFASTEWKAPQLDPND 187

 Score =  109 bits (273), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 121/236 (51%), Gaps = 15/236 (6%)

Query: 368 ASVHSWSYLQTTG---QQSRWSVLPNDLPNAGQNKYNQ-ESAVSFEQQE-LDRPHNSRVE 422
            S+H    L  TG   +  R   LP +        Y Q +S++  E  +  DR    R +
Sbjct: 232 GSIHKPDLLDRTGIIRKVPRHQSLPTE---QHHKLYAQNDSSLMLENMDSFDRSRTHRKD 288

Query: 423 PYNPFANGNAAGLESCN----PLTRLYETSSIKCSDLMIIL-ESDIQDRVLFIDLRPPKR 477
            Y+    G+   LE  N     L R  + ++I C  L  +L +++ ++ +L IDLR PKR
Sbjct: 289 SYHSVYLGDE--LEDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKR 346

Query: 478 YELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHT 537
           +E NH+VA +L+NIDP LL+DTE+   + S    ++ + NP+     Q+  +V YTD  +
Sbjct: 347 FESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKS 406

Query: 538 SMNMDFKFELTFFELVYMGKPRLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
            M++ F +EL  FEL++      + K L GGY+QW+ +L    +      S F++R
Sbjct: 407 FMHLTFNYELILFELLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFR 462

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  500 bits (1287), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 258/466 (55%), Positives = 318/466 (68%), Gaps = 16/466 (3%)

Query: 711  HTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEF 770
            H ER    L+       FS+PTIEK+PN Y++LSITGLRN+ NTCYINSMLQCLF+T  F
Sbjct: 646  HQERESLMLTRSRK---FSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLF 702

Query: 771  RNLFLSNKYSRYLKSSNMDN---MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLR 827
            R+LF+S+K+  ++  S   N   +S SF +LFKKMY+NGGCSVVP+ FLK C+ L+PDLR
Sbjct: 703  RDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLR 762

Query: 828  IPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFE 887
            IP  QQDTQ              S    VVN+YP LLL++ + LKV +KEY  WFD+N  
Sbjct: 763  IPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVI 822

Query: 888  KNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDC 947
             NGLSPID IF GQ+E+ L CQRC  SSY+YSTFYVLSLA+P P S  F ++K+++LE+C
Sbjct: 823  GNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEEC 882

Query: 948  INFFTCDEVLTGQNPWDCPKCGVNSSG-----DRQMNSEKSKRKNKFFMGSENANSANSN 1002
            IN FT DEVL+G+N WDCPKCG ++S      ++ +N   SK+KN   M S N +    +
Sbjct: 883  INMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKN---MSSHNEHHRYKS 939

Query: 1003 RDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHL 1062
            +     L                         +E   +KKL TIK+LNFI LP IL+IHL
Sbjct: 940  K--FFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHL 997

Query: 1063 SRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQH 1122
            SRF YDLTKKNNTV+TYPLILNIVLKNNEVAKYRLY  +NH G LISGHYTSLVNK+  H
Sbjct: 998  SRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNH 1057

Query: 1123 EIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            ++   KQ+WYYFDDE VK + NHG+ D+GI  VSS DVY+LFYERI
Sbjct: 1058 DLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103

 Score =  114 bits (285), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 109/206 (52%), Gaps = 19/206 (9%)

Query: 407 SFEQQELDRPHNSRVEPYNPF---ANGNAAGLES---CNP----LTRLYETSSIKCSDLM 456
           + EQ   DR  N R + Y+      +G+A G+      NP    L RL +   I   +L 
Sbjct: 324 TIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQELF 383

Query: 457 IILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRL 515
            IL + I+  ++L IDLR PKR+  NHIVA +LI IDP+LLW+++ + PI  +   E  L
Sbjct: 384 SILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLL 443

Query: 516 DNP----LFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLTKC----LQG 567
             P    L   R QF Y+V YTDN T MN +F +  TFF L+   K     K     L G
Sbjct: 444 YEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLG 503

Query: 568 GYDQWRLYLKTNTKSIHAKISDFMWR 593
           GYD+W+  L + ++  +  + D++++
Sbjct: 504 GYDKWKKVLYSYSEQYNFNMGDYLYK 529

 Score = 95.9 bits (237), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 117/221 (52%), Gaps = 27/221 (12%)

Query: 4   PYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFE-SYQDLVREGQTRE 62
           P+ PEYS+EL   VQ  Y   ++  YP+L+ EKL+DLLE    L E  +         ++
Sbjct: 8   PFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKD 67

Query: 63  GLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVL 122
            L A+++G +YL+LIIPQSI+F ++N SY +YT+L+K YE E +MTNV+ MV ++++ VL
Sbjct: 68  VLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVL 127

Query: 123 LRQTPEDGERGDTKLY-RKRAYSVPEKGVARS------SDSLQHLTVDGKRRGG------ 169
                 +G   + ++  R+RAYS+    ++        S+S+    ++ K          
Sbjct: 128 DMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPP 187

Query: 170 -HHAIGGAI--------PEVAV----QADTLWSAPKLEEND 197
            HH +   +         E+      +A  LW+AP LE  D
Sbjct: 188 NHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKD 228

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  492 bits (1267), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 245/450 (54%), Positives = 315/450 (70%), Gaps = 14/450 (3%)

Query: 723  SSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRY 782
            S + H+S+PTIEK+ N Y++LSITGLRN+ NTCYINSMLQCLF+TT+FR+LF+S K+  +
Sbjct: 585  SLQRHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEF 644

Query: 783  LKS--SNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXX 840
                 SN   +S+SF +LF+KMY+NGGCSVVP+ FLK+  +L+PDLRIP  QQDTQ    
Sbjct: 645  FNQNYSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLM 704

Query: 841  XXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQG 900
                      S  AAV N+YP LLL++   + VN KEY  WF+++   NGL+PID IFQG
Sbjct: 705  VTLDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQG 764

Query: 901  QIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQ 960
            QIE+ L CQRC  SS+SYSTFYVLSLA+P P +  F +AK+++LEDCIN FT DE+L+G+
Sbjct: 765  QIENILECQRCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTNDEILSGE 824

Query: 961  NPWDCPKCG--VNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXX 1018
            N WDCPKCG  V   G   +   K K+K++  +G E  + +   R H             
Sbjct: 825  NAWDCPKCGSAVTDMGPNHLKKSKKKKKSE--LGEERRSKSGFFRIH--------SKSKR 874

Query: 1019 XXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVT 1078
                             E   +K+L+T K+LNFI LP +LIIHLSRF YDLTKKN+T+VT
Sbjct: 875  SKSPFRMLGSTKFPLAMEDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVT 934

Query: 1079 YPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
            YPL+LNI+LKNNE A+YRLY+ +NH G LISGHYTSLVNK+  H++ +G+QKWYYFDDE+
Sbjct: 935  YPLVLNIILKNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEV 994

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            VK +  HGN D+GI  VSSSDVY+LFYER+
Sbjct: 995  VKEETKHGNIDQGILKVSSSDVYVLFYERL 1024

 Score =  124 bits (310), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 115/203 (56%), Gaps = 9/203 (4%)

Query: 3   VPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTRE 62
           V + PEYS+EL   VQ  YE  ++  + + + EKL+DLLE    LFESY   + E   ++
Sbjct: 6   VSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQD 65

Query: 63  GLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVL 122
            L A++IG +YLYLI+PQSIEF TRN SYS++ DL K Y+ + NMTNV+ MV ++VD++L
Sbjct: 66  ALTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSIL 125

Query: 123 LRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIG----GAIP 178
            R   E  E    K  R RAYSVP++       +L     +    G H A      G   
Sbjct: 126 DRNAREFKEFEHQKA-RTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGRED 184

Query: 179 EVAVQADT----LWSAPKLEEND 197
              +Q D     +W+AP LE ND
Sbjct: 185 MNNLQNDEDSSPVWTAPPLEPND 207

 Score = 92.4 bits (228), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 83/157 (52%), Gaps = 4/157 (2%)

Query: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           L RL + S I   +L  IL S  + +++L ID R  KR ++NHI+A   + IDP  LWD 
Sbjct: 321 LERLQKQSIITAPELFTILSSSEESEKLLLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDP 380

Query: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKP- 558
           + + PI++    +  +  P F  RG + Y+V YTD  T M +D+ +  T F L+      
Sbjct: 381 KTNTPISNAATLDEIIKKPAFLERGSYDYIVYYTDMKTYMTIDYDYMFTLFYLLTASPTV 440

Query: 559 --RLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
             R L   L GGY++W+  +K  +      + ++++R
Sbjct: 441 NLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYIYR 477

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  490 bits (1261), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 242/448 (54%), Positives = 313/448 (69%), Gaps = 18/448 (4%)

Query: 729  SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNM 788
            S+PTIE++PN Y++LSITGLRN+ NTCYINSMLQCLF+T  FR+LFL++KYS +L  S  
Sbjct: 591  SIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKF 650

Query: 789  DN---MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXX 845
             N   +S SF +LFKKMY+NGGCSVVP+ FLK C+ L+PDL+IP  QQDTQ         
Sbjct: 651  PNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDR 710

Query: 846  XXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQ 905
                 S    VVN+YP L+L++++ L+V  +EY  WF+++   NGLSPID IFQGQIE+ 
Sbjct: 711  LHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQIENG 770

Query: 906  LSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDC 965
            L CQRC  SS++YSTFYVLSLA+P P    F ++K+++LEDCIN FT DE+L+G+N WDC
Sbjct: 771  LQCQRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFTNDEMLSGENAWDC 830

Query: 966  PKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSAN----SNRDHLPRLXXXXXXXXXXXX 1021
            P CG N+    ++N+++S +K +   G E+ + +       R H                
Sbjct: 831  PNCGSNAQDRVRVNTDQSVKKKR--QGEEHRHKSRFFGLPTRPH--------RSLSPFRK 880

Query: 1022 XXXXXXXXXXXXTHEKRY-NKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYP 1080
                         HE+++  KKL TIK+LNFI LP +L+IHLSRF YDLTKKN TV+TYP
Sbjct: 881  SGSSSTNSTSKIKHEQQWKTKKLITIKTLNFIMLPPVLVIHLSRFFYDLTKKNKTVITYP 940

Query: 1081 LILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
            LILNIVLKNNEVAKY+LY  +NH G LISGHYTSLVNK+  H +   +Q+WYYFDDE+VK
Sbjct: 941  LILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVK 1000

Query: 1141 LDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             + NHG+ D GI+ VSS DVY+LFYER+
Sbjct: 1001 AEGNHGDIDNGISKVSSKDVYVLFYERL 1028

 Score =  120 bits (302), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 118/204 (57%), Gaps = 13/204 (6%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           + PEYS+EL   +Q  Y++ ++  YP+L+ EKL+DLLE    LFE +     EG  ++ L
Sbjct: 10  FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124
            ++++G +YL+LI+PQSI+F +RN SY +Y+DL+K YE + +MTNV+ MV ++++ +L +
Sbjct: 70  TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGG-----------HHAI 173
               +    + ++ R+RAYSVP+      ++ L  L+V  +                H+ 
Sbjct: 130 TAEREINETNNRIVRQRAYSVPDSNDL--TEQLHSLSVSDRNLKSPPRKILMNNSFEHSD 187

Query: 174 GGAIPEVAVQADTLWSAPKLEEND 197
              I E    +  LW+AP LE  D
Sbjct: 188 SDVINEENDMSSPLWTAPPLEPTD 211

 Score =  114 bits (284), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 110/220 (50%), Gaps = 18/220 (8%)

Query: 388 LPNDLPNAGQNKYNQESAVSFEQQELDRPHNSRVEPYNPFANGNAAGLESCNP------- 440
           L ND+P   +   N+    SF +   DR    R + Y+     +    +  N        
Sbjct: 272 LDNDIPLVREPSNNR----SFRETNADRSQTHRKDSYHSVYMIDEESTDKLNQFYDSTDY 327

Query: 441 ---LTRLYETSSIKCSDLMIILESDIQD-RVLFIDLRPPKRYELNHIVARHLINIDPLLL 496
              L RL + S I   +L+ IL    +  ++L IDLR  KR  LNHIVA ++++IDP LL
Sbjct: 328 IQDLQRLQKQSIITAQELLSILSCPPERIKLLLIDLRWSKRTALNHIVAPNVVSIDPHLL 387

Query: 497 WDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMG 556
           WD+  S PI ++   E+ LDN LF  R +F Y+V YTD  T M+ DF +  T F L+   
Sbjct: 388 WDSATSTPIYNMETLEKLLDNELFNRRHEFEYVVYYTDMKTYMHSDFDYNFTLFYLLTTE 447

Query: 557 KPRLLTKC---LQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
              +L      L GGYD+W+++L    K     I D+++R
Sbjct: 448 TTNILRSTPTYLLGGYDKWKVFLHHYAKEYDINIPDYLYR 487

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  482 bits (1241), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 240/455 (52%), Positives = 303/455 (66%), Gaps = 18/455 (3%)

Query: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN 787
            FS+PTIEKN N Y+A S+TGLRN+ NTCYIN MLQ LF+T E +NLF+S KY  Y    N
Sbjct: 630  FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPN 689

Query: 788  MDN----MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXX 843
             DN    +S +F  LF KMYMNGGC+VVPSGFLK+C++L+PDLRIP  QQDTQ       
Sbjct: 690  -DNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFIL 748

Query: 844  XXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIE 903
                   S    V+NDYP LLL++   + V+ ++Y  WFD+    NGLSP+D +FQGQ+E
Sbjct: 749  NRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQME 808

Query: 904  HQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPW 963
            + L CQRC + S +YSTFYVLSLALP P + AF K+ +++LEDCIN FT DEVLTG+N W
Sbjct: 809  NALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAW 868

Query: 964  DCPKCGVNSSGDRQM----------NSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXX 1013
            DCPKCG  +   R            NS    +K+KFF G     + + ++    +L    
Sbjct: 869  DCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFF-GLPTGKAISRSKSPFRKLGLLE 927

Query: 1014 XXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKN 1073
                                   K  +KKL TIK++NFI+LP++LIIHLSRF YDLTKKN
Sbjct: 928  KHEGKQEKLDKMERDEIEEW--HKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKN 985

Query: 1074 NTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYY 1133
            + VV+YPL+LNIVLKN E+ +Y+LYS +NH G LISGHYTSLVNKD  H +   +QKWYY
Sbjct: 986  DAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYY 1045

Query: 1134 FDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            FDDE+VK +  HGN D+GIT VSS +VY+LFYER+
Sbjct: 1046 FDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

 Score =  103 bits (256), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 88/156 (56%), Gaps = 3/156 (1%)

Query: 441 LTRLYETSSIKCSDLMIILES-DIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           L RL + S I   +L  IL + + + ++L IDLR  KR   NHIVA +++NIDP  LWD 
Sbjct: 378 LERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDN 437

Query: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPR 559
           E ++PI      E+RL+NPLF  R ++ Y+V Y+D  T MN ++ +    F L+      
Sbjct: 438 EANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKH 497

Query: 560 L--LTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
           L  +   L GGY++W+  + T       ++ D+++R
Sbjct: 498 LSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYR 533

 Score = 88.6 bits (218), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 80/117 (68%), Gaps = 1/117 (0%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           + PE+S +L   +Q+ Y  +++  +P+L+ ++L+DLLE+A  + E Y   V +  T + +
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCV-DVDTSKAV 62

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAV 121
             ++ G FY+YL++P+S++F TR+ SYSLYT+LR  YE + NMTNV+ MV E+V  +
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  444 bits (1141), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 225/412 (54%), Positives = 279/412 (67%), Gaps = 14/412 (3%)

Query: 760  MLQCLFSTTEFRNLFLSNKYSRYLKSSNMD---NMSRSFYMLFKKMYMNGGCSVVPSGFL 816
            M+QCLF T   R+LF+S+KY +YL S  +D   N+SRSF +LFKKMY+NGGCSVVP+ FL
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYL-SKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 817  KMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDK 876
            K C+ L+PDLRIP  QQDTQ              S    V  DYP L+L+++  L+VN+K
Sbjct: 60   KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 877  EYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAF 936
            EY+ WFD+    NGLSPID IFQGQIE+ L+CQRC F SY+YSTFYVLSLA+P P S  F
Sbjct: 120  EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTF 179

Query: 937  GKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENA 996
             ++K+++LEDCIN FT DEVL+G+N WDC  CG +S  + +   +K+        G E  
Sbjct: 180  SRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGN-----GEEKK 234

Query: 997  NSANSNRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPR 1056
             S  S    LP +                         HEK  +KKL TIKS+NFI+LP 
Sbjct: 235  RSRKSRLFLLPNINGRSSRSISPFRKSASPRP-----PHEKLKHKKLVTIKSMNFISLPP 289

Query: 1057 ILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLV 1116
             L+IHLSRF YDL+KKN T+VTYPLILNIVL NNE AKYRLY  +NH G LISGHYT+LV
Sbjct: 290  TLVIHLSRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLV 349

Query: 1117 NKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            NK+  HE+++ KQKWYYFDDE+VK + NHGN D G+  VSSS VY+LFYER+
Sbjct: 350  NKEKNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERV 401

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score =  460 bits (1183), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 240/483 (49%), Positives = 316/483 (65%), Gaps = 46/483 (9%)

Query: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK--- 784
            +++PTIE++PN Y++LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+KY  YL+   
Sbjct: 591  YNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIR 650

Query: 785  ---SSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXX 841
               S     +S S  MLF KMY+NGGCSVVP+GFLK+ + L+PDL+IP  QQDTQ     
Sbjct: 651  SNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 710

Query: 842  XXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQ 901
                     S    V NDYP LLL+ +  LKV++ EY  WFD+N   NG+SPID IFQGQ
Sbjct: 711  LLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 770

Query: 902  IEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSK--AFGKA--KKLRLEDCINFFTCDEVL 957
            +E+ L C+RC +++++YSTFYVLSLA+P    K    G++  K+++LEDCIN FT DEVL
Sbjct: 771  MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 830

Query: 958  TGQNPWDCPKCGVNSSGDRQMNSEK---------------------SKRKNKFFMG---S 993
            +G+N WDCP+CG  +S    +++ +                     +KR++  F G   +
Sbjct: 831  SGENAWDCPRCGPTASVSTSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGIT 890

Query: 994  ENANSANSN-------RDHLP-RLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLAT 1045
            E  NS N+N       R   P R+                        +  K  NKKL T
Sbjct: 891  EGHNSNNNNTTIFERERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYK--NKKLTT 948

Query: 1046 IKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFG 1105
            +K++NF+TLP+IL+IHLSRF YDLTKKNNTVVTYPLILNI+LKNN+  KY+L+  +NH G
Sbjct: 949  VKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTG 1008

Query: 1106 TLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFY 1165
            TLISGHYTSLVNKDL+H +  G+ KWYYFDDE+VK D  HG+ D+ +  +SSSDVY+LFY
Sbjct: 1009 TLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGS-DKNL-KISSSDVYVLFY 1066

Query: 1166 ERI 1168
            ER+
Sbjct: 1067 ERV 1069

 Score =  138 bits (348), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 123/194 (63%), Gaps = 4/194 (2%)

Query: 4   PYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREG 63
           P+ PEYS+EL   VQ+ Y + ++  YP+L+ EKL+DLLE    LFE Y D +   +  + 
Sbjct: 16  PFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDA 75

Query: 64  LMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLL 123
           L A++IG +Y++LIIPQS++F TRN SYS+YTDL+K YE E NMTNVV MV +++  V+L
Sbjct: 76  LTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEI-GVVL 134

Query: 124 RQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQ 183
            ++ + G   + ++ +KRA+SVP   +   S  +  L++D      H   G    + A Q
Sbjct: 135 DESVKHGAGIEHRITKKRAFSVPADDL---SGQVASLSLDTAAPQDHGLKGTFTEDDAEQ 191

Query: 184 ADTLWSAPKLEEND 197
           +  +W+AP LE ND
Sbjct: 192 SSPVWTAPNLEPND 205

 Score = 99.0 bits (245), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 89/158 (56%), Gaps = 5/158 (3%)

Query: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           L  L + S I   +L  IL + ++ ++VL IDLR P+R  +NHIVA +L+N+DP LLWD 
Sbjct: 305 LDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDK 364

Query: 500 ERSAPITSVNEFERRL-DNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKP 558
           + + PI   +  E  L +N  F  R +F Y+V YTD  T M ++F +   FF L+   + 
Sbjct: 365 QTNTPIYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFYLMLTSQK 424

Query: 559 ---RLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
                +   L GGY++W+  L +  +  H  I D+++R
Sbjct: 425 TPLTTVPTTLLGGYEKWKKTLHSYAQEYHISIEDYLYR 462

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  459 bits (1181), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 237/479 (49%), Positives = 308/479 (64%), Gaps = 40/479 (8%)

Query: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN 787
            + +PTIE++ N Y++LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+KY  YL+ S 
Sbjct: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643

Query: 788  MDNM-----SRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXX 842
             + +     S S  MLF KMY+NGGCSVVP+GFLK+ + L+PDL+IP  QQDTQ      
Sbjct: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703

Query: 843  XXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQI 902
                    S    V NDYP LLL+++  LKV++KEY  WFD+N   NG+SPID IFQGQ+
Sbjct: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763

Query: 903  EHQLSCQRCDFSSYSYSTFYVLSLALPNPGSK--AFGKA--KKLRLEDCINFFTCDEVLT 958
            E+ L C+RC +++++YSTFYVLSLA+P    K    G+   K+++LEDCIN FT DEVL+
Sbjct: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823

Query: 959  GQNPWDCPKCG-----------------VNSSGDRQMNSE------KSKRKNKFFMGSEN 995
            G+N WDCP+CG                  N    R+  S       +SKR++  F G  +
Sbjct: 824  GENAWDCPRCGPTASTSLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSS 883

Query: 996  ANSANSNRDHLPR------LXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSL 1049
              S ++N  H  R                                     NKKL T+K++
Sbjct: 884  NESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFANSSNDGNNFNDFKNKKLTTVKTI 943

Query: 1050 NFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLIS 1109
            NF+TLP+IL+IHLSRF YDLTKKNNTV+TYPLILNI+LKNN+  KYRL+  +NH GTLIS
Sbjct: 944  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1003

Query: 1110 GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            GHYTSLVNKDL+H +  G+ KWYYFDDE+VK D  HG+ D+ +  +SSSD Y+LFYER+
Sbjct: 1004 GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060

 Score =  134 bits (338), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 123/193 (63%), Gaps = 4/193 (2%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           + PEYS+EL   V++ Y + ++  YP+L+ EKL+DLLE    LFE Y D +R  +  + L
Sbjct: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDAL 67

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124
            A+VIG +Y++LIIPQS++F TRN SYS+Y+DL+K YE E NMTNVV MV +++  V+L 
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEI-GVVLD 126

Query: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184
            + +     + ++ +KRA+SVP   +   SD L  L++D     GH     +  E A Q+
Sbjct: 127 DSVKHVVGIEHRITKKRAFSVPGIDL---SDQLASLSLDAAGPRGHLHKTSSTEEDADQS 183

Query: 185 DTLWSAPKLEEND 197
             +W+AP LE ND
Sbjct: 184 SPVWTAPNLEPND 196

 Score =  104 bits (260), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 117/236 (49%), Gaps = 22/236 (9%)

Query: 379 TGQQSRWSVLPNDLPNAGQNKYNQESAVS---FEQQELDRPHNSRVEPYNPFANGNAAGL 435
           T    R SVL  D+P    N  +  SA S   F +   DR    R + Y+     ++   
Sbjct: 219 TSTPVRQSVLLEDVPYT-HNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTF 277

Query: 436 ESCN-------------PLTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELN 481
           +S N              L  L + S I   +L  IL +  + +++L IDLR P+R  LN
Sbjct: 278 KSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALN 337

Query: 482 HIVARHLINIDPLLLWDTERSAPITSVNEFERRLD-NPLFTTRGQFSYLVCYTDNHTSMN 540
           +IVA +L+ IDP LLWD + + P+   +  E+ L+ N  F  R +F Y+VCY+D  T M 
Sbjct: 338 NIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMT 397

Query: 541 MDFKFELTFFELVYMG-KPRLLT--KCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
           M+F +   FF L+    K RL T    L GGY++W+  L T  +  H  I D+++R
Sbjct: 398 MNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYR 453

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  448 bits (1153), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/442 (50%), Positives = 300/442 (67%), Gaps = 9/442 (2%)

Query: 730  VPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL--KSSN 787
            VPTIE+NPN Y++LSITGLRN+ NTCYI+SMLQCLF+TT  R+LF++ KY  Y+  K ++
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 788  MDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXX 847
              N+SRSF +LF+KMY+NGGCSVVP+ FLK C+ L+PDL+IP  QQDTQ           
Sbjct: 669  KINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLH 728

Query: 848  XXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLS 907
               S    V+NDY  LLL+++  + V   +Y  WF+ +    G+SPID IFQGQIE+ ++
Sbjct: 729  DELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSIN 788

Query: 908  CQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPK 967
            CQRC +SS++YS+FYVLSLA+P     +F +  +++LEDCIN FT DEVL+G+N WDC +
Sbjct: 789  CQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDCSR 848

Query: 968  CGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXXX 1027
            CG  S    + +     +++     SE  + +  NR    RL                  
Sbjct: 849  CGSQSDNFVKTSHNDHHKEH----TSETTDDSKQNRK--SRLFLLPKKYNPTSRSLSPFG 902

Query: 1028 XXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVL 1087
                  + EK  +KK+ TIKSLNFI +P+IL+IHLSRF YD++KKN TVV YPLILNIVL
Sbjct: 903  RHSSHKSSEKWKSKKMETIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVL 962

Query: 1088 KNNEVAKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHG 1146
            KN EV KYRLY+ +NH G  + SGHYT+LVNK+  H++ + +Q+WYYFDDE+VK + NHG
Sbjct: 963  KNEEVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHG 1022

Query: 1147 NYDRGITSVSSSDVYLLFYERI 1168
            N D G+  VSSS VY+LFYE+I
Sbjct: 1023 NIDEGVNKVSSSHVYVLFYEKI 1044

 Score =  120 bits (302), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (58%), Gaps = 2/165 (1%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           + PEYS+EL   V + Y  +++  +P+LR  KL+++LE  A L ESY DL+ E +  E L
Sbjct: 7   FTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECL 66

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124
            AY++G FYLYLIIP S +F  RN S+ +Y +L+  Y+ + NMTNV+ +V  +VD++L  
Sbjct: 67  SAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDE 126

Query: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGG 169
              E  E  +  + R RAYS P   V   S     L+++     G
Sbjct: 127 SILE-LEGIEKVIKRDRAYSSPAPKVNNIS-KFSKLSINDNHHNG 169

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 94/167 (56%), Gaps = 6/167 (3%)

Query: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           + RL + + I CS+L  IL S  +  ++L +DLR PK    NHI+A H+I IDP LLW+ 
Sbjct: 338 MDRLQKQNVITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNE 397

Query: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPR 559
           E   PI S  E  +R++NPL +   +F Y+V Y+D  T M  D+ F  TFF L+   K  
Sbjct: 398 ETQTPIYSFEELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSL 457

Query: 560 LLTKC---LQGGYDQWRLYLKTNTKSIHAKISDFMWR--ANFLGRDT 601
            L +    L GG+++W+  LKT  K     I+ F+ +  A  L ++T
Sbjct: 458 NLKQVPTNLLGGFEKWKKVLKTYNKEYGIDITPFIKKLHATELNKNT 504

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  405 bits (1040), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/450 (47%), Positives = 285/450 (63%), Gaps = 24/450 (5%)

Query: 724  SEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL 783
            S A   +PTIE + +    LSITGL+N  NTCYINS++QCLF TT FR+LFL+ KY  +L
Sbjct: 281  SSALNKLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL 340

Query: 784  KSSNMD---NMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXX 840
            ++        +SRS Y+LFKKMY+NGG ++ P+GFLKMC  L+PDL IP  QQDTQ    
Sbjct: 341  QTDKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLL 400

Query: 841  XXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQG 900
                      S    V   YP L+ ++++  +VN  +Y  W++ +   +GLSPID IF+G
Sbjct: 401  IILARLHEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRG 459

Query: 901  QIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAF-GKAKKLRLEDCINFFTCDEVLTG 959
            Q+E+ L CQRC  SS+SYSTFYVLSLA+P     +F  K+KK++LEDCIN FT DE L+G
Sbjct: 460  QMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSG 519

Query: 960  QNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXX 1019
             N WDCP CG      +   S   K+K+ FF     + S + +                 
Sbjct: 520  DNSWDCPNCGTTDLKTKINESTSQKKKSTFFSFHSRSRSKSPHH---------------- 563

Query: 1020 XXXXXXXXXXXXXXTHEKRYN-KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVT 1078
                           H K++N +KL T+KS +FI LP IL+IHLSRF YDLT+KNNTV+T
Sbjct: 564  -HHHHHHHSHDNTEKHSKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVIT 622

Query: 1079 YPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
            YPLILN++LKNN+V +Y+LY T+NH G L++GHYTS VNK+  HEI   +Q W  FDD+ 
Sbjct: 623  YPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDY 682

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            +K   +H +++ G T VSSS+VY+LFYER+
Sbjct: 683  IK-QHHHDDFEAGKTEVSSSEVYVLFYERM 711

 Score =  100 bits (249), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 1/131 (0%)

Query: 16  FVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGLMAYVIGAFYLY 75
            V+  YE  +++ Y +LR + L  LL+ AA+LFE Y       Q  E L A++IG +YLY
Sbjct: 11  LVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGGYYLY 70

Query: 76  LIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPEDGERGDT 135
           L+IPQS++F TRN  YS Y  L+  Y+ E  M+ V+++V E+ + ++ R    D  R   
Sbjct: 71  LVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYL-SDSNRISR 129

Query: 136 KLYRKRAYSVP 146
            + RKRAYS+P
Sbjct: 130 TITRKRAYSLP 140

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  402 bits (1032), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/467 (45%), Positives = 293/467 (62%), Gaps = 24/467 (5%)

Query: 707  EDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFS 766
            E PK  E     + + + +A +++P IE + +    LSITGL+N  NTCYINS++QCLF 
Sbjct: 260  EKPKEEEGKIEAIESSAPKA-YNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFG 318

Query: 767  TTEFRNLFLSNKYSRYLKSSNMD---NMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLK 823
            TT FR+LFL+ KY  +L ++       +SRS Y+LFKKMY+NGG +++P+ FLKMC  L+
Sbjct: 319  TTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLR 378

Query: 824  PDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFD 883
            PDL IP  QQDTQ              S    VV  YP L+ ++++ L+VN  +Y  W++
Sbjct: 379  PDLNIPDDQQDTQEFLLIVLARIHEELSN-ENVVKYYPDLVSYDANALQVNPSKYEKWYE 437

Query: 884  QNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAF-GKAKKL 942
            +N   +GLSPID I++GQ+E+ L CQRC  SSYSYSTFYVLSLA+P     +F  K++K+
Sbjct: 438  RNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKI 497

Query: 943  RLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSN 1002
            +LEDCIN FT DE L+G N WDCP C +  S  ++      K+K+  F     + S +  
Sbjct: 498  KLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFHSRSRSKSP- 556

Query: 1003 RDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHL 1062
                                             +KR +KKL TIKSL+FI LP IL+IHL
Sbjct: 557  ----------------HHHHHHHHSSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHL 600

Query: 1063 SRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQH 1122
            SRF YDLTKKN+TV+TYPLILNI+LKN +V +Y+LY T+NH G LI+GHYTS+VNK+  H
Sbjct: 601  SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH 660

Query: 1123 EIREGKQKWYYFDDEIVKLD-PNHGNYDRGITSVSSSDVYLLFYERI 1168
            EI   +Q W  FDD+ ++    +  N++ G T +SS +VY+LFYER+
Sbjct: 661  EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERM 707

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 102/192 (53%), Gaps = 13/192 (6%)

Query: 12  ELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGLMAYVIGA 71
           ++   V++ YE  +++ Y +LR + L  LL+ AA+LF  Y   +   Q  E L A++IG 
Sbjct: 7   QILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGC 66

Query: 72  FYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPEDGE 131
           +YLYLIIPQS++F TRN  YS Y  L+  Y+ E  M  V+++V ++   ++ R   E   
Sbjct: 67  YYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESNG 126

Query: 132 RGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP---------EVAV 182
              T + RKRAYS+P + +     S   L++  K  G  H I   +          ++  
Sbjct: 127 ICRT-IKRKRAYSLPLRPLPVHMAS---LSIHNKFDGSLHEIPNELTKPTNDNSKEDIVR 182

Query: 183 QADTLWSAPKLE 194
           +++ + S+ KLE
Sbjct: 183 ESNQIASSNKLE 194

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  399 bits (1024), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/446 (47%), Positives = 280/446 (62%), Gaps = 22/446 (4%)

Query: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN 787
            F  PTIE +      LSITGL+N  NTCYINS++QCLF +T FR+LFL+ KY  +LK+  
Sbjct: 274  FEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEE 333

Query: 788  MD---NMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXX 844
                  +SRS Y LFKKMY NGG ++VP+GFLKMC  L+PDL IP  QQDTQ        
Sbjct: 334  YPKEVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 393

Query: 845  XXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEH 904
                  S    V   Y  L+ ++++ L+VN  +Y  W+++    +GLSPID IF+GQ+E+
Sbjct: 394  RIHEELSN-ENVTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMEN 452

Query: 905  QLSCQRCDFSSYSYSTFYVLSLALPNPGSKAF-GKAKKLRLEDCINFFTCDEVLTGQNPW 963
             L CQRC  SS+SYSTFYVLSLA+P     +F  K+KK++LEDCIN FT DE LTG N W
Sbjct: 453  ILKCQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAW 512

Query: 964  DCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXX 1023
            DCP+C ++ S  +   +   K+++  F     + S + +                     
Sbjct: 513  DCPECRIDDSKLKTGENSSQKKRSPLFSFHSRSRSKSPHH----------------HHHY 556

Query: 1024 XXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLIL 1083
                         K  +K+L TIKSL+FI LP IL+IHLSRF YDLTKKNN V+TYPLIL
Sbjct: 557  HHHGSDNTTKNSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLIL 616

Query: 1084 NIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLD 1142
            NI+LKNN+V +Y+LY T+NH G LI+GHYTS+VNK+  HEI   KQ W  FDD+ I++  
Sbjct: 617  NIILKNNKVVRYKLYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHH 676

Query: 1143 PNHGNYDRGITSVSSSDVYLLFYERI 1168
             +   ++ G T +SSS+VY+LFYER+
Sbjct: 677  KDRDGFEAGKTKMSSSEVYVLFYERM 702

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 82/135 (60%), Gaps = 1/135 (0%)

Query: 12  ELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGLMAYVIGA 71
           ++   V++ YE  +++ Y +LR + L  L++  ++LF+ Y   +   +  E L A++IG 
Sbjct: 7   QILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIGG 66

Query: 72  FYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPEDGE 131
           +YLYLIIPQS++F TR+  YS Y  L+  Y+ E  M+ V+++V ++  ++ + Q   D  
Sbjct: 67  YYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSI-VDQYLSDSN 125

Query: 132 RGDTKLYRKRAYSVP 146
           R    + RKRAYS+P
Sbjct: 126 RITVTITRKRAYSLP 140

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  397 bits (1021), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/475 (46%), Positives = 293/475 (61%), Gaps = 22/475 (4%)

Query: 704  IEYEDP--------KHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTC 755
            +++E+P        K  E+      + S+   F +P IE + N    LSITGLRN  NTC
Sbjct: 246  LQFEEPSQDSSSILKSKEQEEEETVSASTSKTFKLPVIENSDNLLSELSITGLRNPCNTC 305

Query: 756  YINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMD---NMSRSFYMLFKKMYMNGGCSVVP 812
            YINSM+QCLFSTT FR+LFL+ KY  +L++        +S S Y+LFKKMY+NGG +++P
Sbjct: 306  YINSMVQCLFSTTLFRDLFLTKKYKLFLENEKYPKGLQLSHSIYVLFKKMYLNGGRAIIP 365

Query: 813  SGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLK 872
            +GFLK+C  L+PDL IP  QQDTQ              S    V   Y  L+L++++ L+
Sbjct: 366  NGFLKVCKKLRPDLNIPDDQQDTQEFLMIILARIHEELSN-NNVTKYYSDLILNDATALQ 424

Query: 873  VNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPG 932
            VN  +Y  W ++    +GLSPID IFQGQ+E+ L CQRC  SSYSYSTFYVLSLA+P   
Sbjct: 425  VNPSKYQKWCEETVLSDGLSPIDHIFQGQMENILKCQRCGNSSYSYSTFYVLSLAIPKAS 484

Query: 933  SKAF-GKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFM 991
              +F  K+KK++LEDCINFFT DE L+  N WDCPKC       ++  +   K+++  F 
Sbjct: 485  LYSFTSKSKKIKLEDCINFFTSDEELSDDNAWDCPKCRTAEYKLKKDENLSQKKRSILF- 543

Query: 992  GSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNF 1051
                 N  +  R   PR                            K   KKL TIKSL+F
Sbjct: 544  -----NLHSRPRSKSPRHRHHHHHHRHKNDDAKKNDDATKNSKKWKS--KKLTTIKSLDF 596

Query: 1052 ITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGH 1111
            I LP IL+IHLSRF YDLTKKNNTV+TYPLILNI+LKNN+V +Y+LY+T+NH G LI+GH
Sbjct: 597  IVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHSGNLINGH 656

Query: 1112 YTSLVNKDLQHEIREGKQKWYYFDDEIVKL-DPNHGNYDRGITSVSSSDVYLLFY 1165
            YTS+VNK+  HEI   +Q W  FDD+++K    +  +++ G T +SS++VY+LFY
Sbjct: 657  YTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVLFY 711

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 105/192 (54%), Gaps = 16/192 (8%)

Query: 11  SELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGLMAYVIG 70
           +++ + V+E Y+  ++ +Y +LR +KL  LLE AA LF+ Y   ++  Q +  L A+++G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 71  AFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPEDG 130
            FYLYL+IP S++F TRN  YS Y  L+  Y+ E  M+ V+++V ++   +++ Q   D 
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDE-STIIVDQCLSDS 124

Query: 131 ERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA-----D 185
           +R    + RKRAYS+P          L+ L V       H+ +   + E+ ++      D
Sbjct: 125 KRISRSMKRKRAYSLP----------LRPLPVHMASLSIHNQLDVPLREMPIEISKPIND 174

Query: 186 TLWSAPKLEEND 197
           TL      EEN+
Sbjct: 175 TLVKGLAKEENE 186

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  380 bits (975), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 224/573 (39%), Positives = 319/573 (55%), Gaps = 52/573 (9%)

Query: 441 LTRLYETSSIKCSDLMIILESDIQDR-VLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           L RL + S I   +L  IL ++ Q + +L IDLR   RY  + I+A + ++IDP +LW++
Sbjct: 389 LERLQKQSIITAPELFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNS 448

Query: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELV--YMGK 557
              AP+  + E E +L+NPLF  R +F Y+V ++D  T M ++F +  TFF L+    GK
Sbjct: 449 NSGAPMYEITELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGK 508

Query: 558 P-RLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRANFLGRDTSVSDHN----PFRXX 612
           P + +   L GGY++W+  +    K  +  ++D++ R    G D + + H+    P+R  
Sbjct: 509 PLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVRIT-EGEDDTPARHDCQELPYRQQ 567

Query: 613 XXXXX------------XXXXXXXXXXXXXXXXXYISSPRPVPFIPLQQPSLSLLHTSAN 660
                                                SP  VP IP   P + L     +
Sbjct: 568 NFAGINGPGAVEPWKPHEVPATIRKRPPPPPPASVPQSPDVVPVIP---PRIML----DS 620

Query: 661 IVKPGKAELRNELSRITGQIDHTQYNQPEKYRYLPDSRESPYPIEYEDPKHTERSRGWLS 720
            V   +A  ++ L+ +TGQI   + ++    +  P  R    P          RS    +
Sbjct: 621 KVSQHRAPFQSNLNFVTGQI--LEADEDTALQVAPTKRIQQEPF---------RS----A 665

Query: 721 AGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780
                  +S+PTIE+NPN Y++LSITGLRN+ NTCYINSM+QCLF+T  FRNLF+S KY 
Sbjct: 666 TNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYK 725

Query: 781 RYLK--------SSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQ 832
            +LK        + +   +SR+FY+LFKKMY+NGGCSVVP  FLK CS L+PD +IP  Q
Sbjct: 726 EFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQ 785

Query: 833 QDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLS 892
           QDT               S   AVVN+YP L+L++   L V +KEY  WFD++   NGLS
Sbjct: 786 QDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLS 845

Query: 893 PIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFT 952
           PID IFQGQ+E+ L CQRC  SS++YSTFYVLSLA+P   S  F ++K++ LE+C+N +T
Sbjct: 846 PIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYT 905

Query: 953 CDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKR 985
            DEVL+G+N WDCP C    + D +   EK+KR
Sbjct: 906 SDEVLSGENAWDCPNC-CKITKDYKGMVEKTKR 937

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 103/129 (79%)

Query: 1040 NKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYS 1099
            +KKL TIK+LNFI +PR LIIHLSRF YDLTKKN+T+VTYPLILNIVLK+NEV KY+LY 
Sbjct: 1033 SKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYG 1092

Query: 1100 TINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSD 1159
             +NH G LISGHYTS+V+K L H +      WYYFDDE+VK +  HG+   G+  +SSSD
Sbjct: 1093 VVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152

Query: 1160 VYLLFYERI 1168
            VY+LFYERI
Sbjct: 1153 VYVLFYERI 1161

 Score =  127 bits (320), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/231 (34%), Positives = 121/231 (52%), Gaps = 39/231 (16%)

Query: 2   SVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTR 61
           ++P+ PE S EL   V + Y   +    P+LR ++L+DLLE    L+E Y   + + Q  
Sbjct: 11  ALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNM 70

Query: 62  EGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAV 121
           + L +++ G FY+YL++PQSI+FHTRN ++++Y+D+R  YE + NMTNV+ MV E+V  V
Sbjct: 71  DALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVV 130

Query: 122 LLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDG--KRRGGH--------- 170
           L  Q   D    + ++ R RAYSVP++  AR   +L  LT+    + RGG          
Sbjct: 131 LESQW--DSASLNERIPRNRAYSVPDE--ARVVQNLDKLTLQSPTETRGGRPRSQKKQLL 186

Query: 171 ----------HAIGGAIPEVAV--------------QADTLWSAPKLEEND 197
                     H+    I E  +              Q+  LW AP+LE ND
Sbjct: 187 QLPRPGNVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPND 237

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  366 bits (940), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/444 (45%), Positives = 275/444 (61%), Gaps = 30/444 (6%)

Query: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN 787
            + +P +  + N Y+ LSI+GLRN+ NTCYINSMLQCLF+TT FRNLFLSN+Y  Y+ +  
Sbjct: 428  YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487

Query: 788  MDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQX-XXXXXXXXX 846
              ++S SF++LF+KMY+NGGC+V+P  FLK C++L+PDLRIP  QQDTQ           
Sbjct: 488  DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547

Query: 847  XXXXSYLAAVVNDYPQLLLHESSVLKV-NDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQ 905
                S    +V+++P L+ +++  + V N  EY  WF ++ E  GLS I  IFQGQ+E+ 
Sbjct: 548  NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607

Query: 906  LSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDC 965
            L CQRC+++S +YS F  LSL++PN   K     K + LEDCI+ F  +E+LTG+N W+C
Sbjct: 608  LECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLFIENEMLTGENAWNC 664

Query: 966  PKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXX 1025
            PKC  +S+      +  SKRK++ F       S + NR H                    
Sbjct: 665  PKCSSSSN------NNTSKRKSRGFFKF----SKHKNRSH--------------NDLTFS 700

Query: 1026 XXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRF-VYDLTKKNNTVVTYPLILN 1084
                       K   KKL T KS +FI LP +LIIHLSRF +  L  KNNT + YP IL 
Sbjct: 701  EYNHNSSSDDVKFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILT 760

Query: 1085 IVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPN 1144
            I LKN E  +++LY  +NHFG L +GHYTSL+NK+  H++   +QKW+YFDDE VK   N
Sbjct: 761  ITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFN 820

Query: 1145 HGNYDRGITSVSSSDVYLLFYERI 1168
            + + D+ +  +SSSDVY+LFYE+I
Sbjct: 821  YFDLDKNVNRISSSDVYVLFYEKI 844

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 86/181 (47%), Gaps = 8/181 (4%)

Query: 418 NSRVEPYNPFANGNAAGLESCNPLTRLYETSSIKCSDLMIILESDIQDR--VLFIDLRPP 475
           N+    Y  F N      E    L  LYE   I   +L  IL S+  DR  +L IDLR  
Sbjct: 184 NANESKYTNFINDKTINDEDT-YLKHLYEECFITPHELFSIL-SNPSDRLKILIIDLRLS 241

Query: 476 KRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDN 535
           + + L  I + +LI  DP+ LW+     P+           NPLF     FSY++ Y+DN
Sbjct: 242 RYFNLQTIRSPNLIKFDPIELWNNRDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDN 298

Query: 536 HTSMNMD-FKFELTFFELVYMGKPRLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRA 594
            T+   + F++  +FF+L+     ++    L GG+++W   + + ++    + S++++  
Sbjct: 299 ETTTAFESFEYNFSFFKLLMSSSMKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTN 358

Query: 595 N 595
           N
Sbjct: 359 N 359

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 86/199 (43%), Gaps = 46/199 (23%)

Query: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
           +S+ ++   S EL   V   Y  +++ +Y +L   + +DLLE    LFE +     +G T
Sbjct: 4   ISLQHLVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF----LKGNT 59

Query: 61  REGLMAYVIGAFYLYLIIPQSIEF--HTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKV 118
            + L +++IG FY+ L+IP S      + N   ++Y DL+K+YE +PN+++++ ++    
Sbjct: 60  -DSLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIR--- 115

Query: 119 DAVLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP 178
                                           + S + LQ   VD       H       
Sbjct: 116 --------------------------------SESENILQSFDVDAPSSHSQHEEDNT-- 141

Query: 179 EVAVQADTLWSAPKLEEND 197
             A  + T+W AP LE ND
Sbjct: 142 --ADSSTTIWQAPFLEPND 158

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  347 bits (890), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 215/564 (38%), Positives = 303/564 (53%), Gaps = 57/564 (10%)

Query: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           + RL + S I   +L  IL +  + +R+L IDLR   RY+ N+I+A +++ IDP +LWD 
Sbjct: 320 MKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDV 379

Query: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKP- 558
               P+T ++  + RL N +F  RG F ++V YTD  T M MDF +   F+ LV   +  
Sbjct: 380 NTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEV 439

Query: 559 --RLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR---ANFLGRDTSVSDHNPFRXXX 613
             R L   L GGY++W+  LK        ++ D+++R   +N  G++ S +         
Sbjct: 440 SLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSSNKEGKEKSAN--------- 490

Query: 614 XXXXXXXXXXXXXXXXXXXXXYISSPRPVPFIPLQQPSL--SLLHTSANIVKPGKAELRN 671
                                      PVP+ P   P    +L         P   E+  
Sbjct: 491 ----------------------AKHIEPVPWKPPALPERMRNLPPPPPPATLPITKEMP- 527

Query: 672 ELSRITGQIDHTQYNQPEKYRYLPDSRESPYPIEYEDPKHT---ERSRGWLSAGSSEAHF 728
               +  +I   Q  Q +K    P SR    P E   PK+    E+     S    +  F
Sbjct: 528 --PPVPPKIQLEQ--QEDKNHTRPRSRTVSSPAEV--PKNVVAPEQLSQLDSYPMRQRQF 581

Query: 729 SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNM 788
           SVPTIE++ N+Y+ALSITGLRN+  TCYINSMLQCLF+T  FR+LF  + Y R+      
Sbjct: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELE 641

Query: 789 DN--MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXX 846
           D   +S+SF +L +KMYMNGGCSVVP+ FLK+C++L+PD  IP  QQD Q          
Sbjct: 642 DTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701

Query: 847 XXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906
               S    V+N +P+LLL+++   KV  +EY  WF+ +      SPID IFQGQ+E+ L
Sbjct: 702 HDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGL 761

Query: 907 SCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKK--LRLEDCINFFTCDEVLTGQNPWD 964
            C++C +SSYSYSTFY+LSLA+P P S     +K   + LEDCIN FT DEV++ +N WD
Sbjct: 762 HCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWD 821

Query: 965 CPKCGVNSSGDRQMNSEKSKRKNK 988
           CPKCGV    ++   SE ++R NK
Sbjct: 822 CPKCGVTVQKEK---SESNQRHNK 842

 Score =  185 bits (470), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 83/124 (66%), Positives = 103/124 (83%)

Query: 1045 TIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHF 1104
            +I++ NF+TLP +L+IHLSRF YDLTKKN TV+TYPLILNIVLKNNE  KYRLY+ +NH 
Sbjct: 920  SIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHN 979

Query: 1105 GTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLF 1164
            G LISGHYTSLVNK+  H++   +Q+WYYFDDE+VK + +HGN  +G+  VSS DVY+LF
Sbjct: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039

Query: 1165 YERI 1168
            YERI
Sbjct: 1040 YERI 1043

 Score =  125 bits (313), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 112/209 (53%), Gaps = 32/209 (15%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           + PEYSSEL   V++ YE  ++  Y  L+ E L DL++    L+ES+ D ++    ++ L
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124
            AY+IG ++LYLIIPQS +F  RN ++ ++  L+K YE + NMTNV+ MV ++VD+VL R
Sbjct: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127

Query: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184
                  R    + RKRA+S P+ G+      +  LT+ G         G  +P++  + 
Sbjct: 128 DF-----RKLKDVERKRAFSSPDNGL---DSEISRLTLAGN--------GSTLPKMHKKW 171

Query: 185 D----------------TLWSAPKLEEND 197
           D                 LW AP LE ND
Sbjct: 172 DFIRSDSNFHSHDTGNVPLWKAPNLEPND 200

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  322 bits (826), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/455 (37%), Positives = 253/455 (55%), Gaps = 30/455 (6%)

Query: 727  HFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSS 786
             +++P I     E   LS+ G+RNM NTCY+NSMLQCLF +T+FR+LFL++K+  +   +
Sbjct: 194  QYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKAET 253

Query: 787  NMDNMS--RSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXX 844
            N +++S      +LFKKMY NGGC+++P  F++ C  L+PD +IPH QQDTQ        
Sbjct: 254  NSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVLE 313

Query: 845  XXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEH 904
                  +  +A V D   +    ++     +K Y  W+++   +N LSPID +F+G +E 
Sbjct: 314  RLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDVES 373

Query: 905  QLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWD 964
            +L C+ C+ S+ ++S+FY+LSL +P   S  F K+K +RLEDCIN FT  E+LTG+N W 
Sbjct: 374  KLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLEDCINLFTRKEILTGENSWA 433

Query: 965  CPKCGVNSS----------GDRQMNSEKSKRKNKFFMGSENANSA-NSNRDHLPRLXXXX 1013
            CP C   +             +  N  K  +  +FF   E   +  NS  +   +L    
Sbjct: 434  CPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKTERNSGANKFSQLKYDN 493

Query: 1014 XXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKN 1073
                                    R  KK  TI S++F++LP IL+IHLSRF YD++KKN
Sbjct: 494  LENE-----------------QRHRQQKKSETILSVSFVSLPPILVIHLSRFCYDISKKN 536

Query: 1074 NTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYY 1133
             + ++YP+ L +   +N    YRLY TINH G+   GHYT+LVNK+  H      QKW  
Sbjct: 537  TSNISYPMSLTVETLDNSSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVE 596

Query: 1134 FDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            FDD++V    +       I S++++D Y+LFYERI
Sbjct: 597  FDDDLVFNRTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%)

Query: 13  LRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGLMAYVIGAF 72
           L++ V + +E  +++ Y  L   K+  LL +AA   +  + L +E       M Y  G F
Sbjct: 13  LKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDKTETLGQEKLLESSYMNYAAGCF 72

Query: 73  YLYLIIPQSIEFHTRNLSYSLYTDLRKHY 101
           Y+YL++P + +F   +  Y  Y  L+ +Y
Sbjct: 73  YIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  304 bits (779), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/266 (52%), Positives = 186/266 (69%), Gaps = 2/266 (0%)

Query: 722 GSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSR 781
           G+   HFS+P +EK+ N+Y++LSITGLRN+ NTCYINSMLQCLF+TTEFRN+FLS+KY +
Sbjct: 729 GAIHRHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEK 788

Query: 782 YLKSSNMDN--MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXX 839
           Y+      N  +S+SF MLFKKMYMNGGCSVVP+GFLK C+ L+PDLRIP  QQDTQ   
Sbjct: 789 YMDHDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFL 848

Query: 840 XXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQ 899
                      S    V  DYP L+ ++   ++V   +Y  W++++ + NGLSPID +FQ
Sbjct: 849 MLILDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQ 908

Query: 900 GQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTG 959
           GQ E  L CQRC  SS++YSTFY+LSLA+P   + AFGK K++ LEDCI  FT DE+L+ 
Sbjct: 909 GQTEDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIKRVNLEDCIKMFTNDEILSD 968

Query: 960 QNPWDCPKCGVNSSGDRQMNSEKSKR 985
           +N WDCP+CG  +     ++  + K+
Sbjct: 969 ENAWDCPRCGSAAPKQEPIHRHREKK 994

 Score =  195 bits (495), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%)

Query: 1037 KRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYR 1096
            + Y+ K+ TIKS+NF+  PRIL+IHLSRF YDLTKKNNTV+TYPL LNI LKN EVA+Y+
Sbjct: 1080 RHYSGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARYK 1139

Query: 1097 LYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVS 1156
            LY  +NH GTL+SGHYTSLVNKD  HE+   KQKW+YFDDEIVK + NHG+ + G+TS+S
Sbjct: 1140 LYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSIS 1199

Query: 1157 SSDVYLLFYERI 1168
            SS VY+LFY+RI
Sbjct: 1200 SSHVYVLFYQRI 1211

 Score =  121 bits (304), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 91/148 (61%), Gaps = 6/148 (4%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           Y PEYS EL   VQE Y  + +  YP+L+ EKL+DLL+ ++ LFE+Y   +R+    + L
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124
            A+++G+FY+Y IIPQS +F T+N  Y +Y +L+  YE E NMTNV+ MV  ++  +L  
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 125 QTPEDGERG-----DTKLYRK-RAYSVP 146
                 E       D+K  R+ RA+SVP
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSVP 157

 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 93/159 (58%), Gaps = 4/159 (2%)

Query: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           L  + +   I C +L  +L ++++ ++VL IDLR P+R+  NHIVA +++ ++P LLWD 
Sbjct: 485 LEHIQKQDVITCPELFSLLSNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDD 544

Query: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVY--MGK 557
             + P+ +  + E+ ++NPLF+ R  F Y+V Y+D  T MNM F +  T F L+     K
Sbjct: 545 TTNTPVYTAEKLEQIINNPLFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSK 604

Query: 558 P-RLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRAN 595
           P + L   L GGY++W   + +        ++D+++R +
Sbjct: 605 PVKSLPTSLLGGYEKWYKVINSYVNQYSITMNDYVYRKD 643

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  293 bits (751), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 182/252 (72%), Gaps = 10/252 (3%)

Query: 728 FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK--S 785
           +S+PTIE+NPN Y++LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+ Y  YL+  +
Sbjct: 580 YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639

Query: 786 SNMDN----MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXX 841
           SN  +    +S S  MLF KMY+NGGCSVVP+GFLK+ + L+PDL+IP  QQDTQ     
Sbjct: 640 SNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699

Query: 842 XXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQ 901
                    S    V NDYP LLL+ + VLKV++ EY  WFD+N   NG+SPID IFQGQ
Sbjct: 700 LLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 759

Query: 902 IEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSK--AFGKA--KKLRLEDCINFFTCDEVL 957
           +E+ L C+RC +++++YSTFYVLSLA+P    K    G++  K+++LEDCIN FT DEVL
Sbjct: 760 MENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819

Query: 958 TGQNPWDCPKCG 969
           +G+N WDCP+CG
Sbjct: 820 SGENAWDCPRCG 831

 Score =  194 bits (494), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 89/129 (68%), Positives = 111/129 (86%), Gaps = 2/129 (1%)

Query: 1040 NKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYS 1099
            NKK+ T+K++NF+TLP+IL+IHLSRF YDLTKKNNTV+TYPLILNI+LKNN+  KYRL+ 
Sbjct: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFG 991

Query: 1100 TINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSD 1159
             +NH GTLISGHYTSLVNKDL+H +  G+ KWYYFDDE+VK D  HG+ D+ +  +SSSD
Sbjct: 992  VVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSD 1049

Query: 1160 VYLLFYERI 1168
            VY+LFYER+
Sbjct: 1050 VYVLFYERV 1058

 Score =  128 bits (322), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 120/193 (62%), Gaps = 4/193 (2%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           + PEYS EL   VQ+ Y + ++  YP+L+ EKL+DLLE    LFE Y D +  G+  + L
Sbjct: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDAL 67

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124
            A+VIG +Y++LIIPQS++F TRN SYS+YTDL+K YE E NMTNVV MV +++  V+L 
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEI-GVVLD 126

Query: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184
           ++ +     + ++ +KRA+SVP   +   S  +  L++D      H+       +   Q+
Sbjct: 127 ESVKHVVGIEHRINKKRAFSVPANDL---SGQVASLSLDTAGPQQHNIKVPLTEDDMDQS 183

Query: 185 DTLWSAPKLEEND 197
             +W+AP LE ND
Sbjct: 184 SPVWTAPNLEPND 196

 Score = 98.2 bits (243), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 89/158 (56%), Gaps = 5/158 (3%)

Query: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499
           L  L + S I   +L  IL + ++ ++VL IDLR P+R  +NHIVA +L+ +DP LLWD 
Sbjct: 296 LDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDK 355

Query: 500 ERSAPITSVNEFERRL-DNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKP 558
           + + P+   +  E  L +N  F  R +F Y+V Y+D  T M ++F +   FF L+   + 
Sbjct: 356 KTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQK 415

Query: 559 RLLT---KCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
             LT     L GGY++W+  L +  +  H  + D+++R
Sbjct: 416 TPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLYR 453

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  286 bits (731), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 134/252 (53%), Positives = 178/252 (70%), Gaps = 10/252 (3%)

Query: 728 FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL---- 783
           +++PTIE++ N Y++LSITGLRN+ NTCYINSM+QCLF+   FR LF+S  Y  YL    
Sbjct: 583 YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642

Query: 784 --KSSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXX 841
             +S++   +S S  MLF KMY+NGGCSVVP+GFLK+ + L+PDL+IP  QQDTQ     
Sbjct: 643 GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702

Query: 842 XXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQ 901
                    S    V NDYP LLL+ +  LKV++ EY  WFD+N   NG+SPID IFQGQ
Sbjct: 703 LLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 762

Query: 902 IEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSK--AFGKA--KKLRLEDCINFFTCDEVL 957
           +E+ L C+RC +++++YSTFYVLSLA+P    K    G++  K+++LEDCIN FT DEVL
Sbjct: 763 MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVL 822

Query: 958 TGQNPWDCPKCG 969
           +G+N WDCP+CG
Sbjct: 823 SGENAWDCPRCG 834

 Score =  194 bits (493), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/129 (68%), Positives = 111/129 (86%), Gaps = 2/129 (1%)

Query: 1040 NKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYS 1099
            NKKL T+K++NF+TLP+IL+IHLSRF YDLTKKN+TV+TYPLILNI+LKNNE  KYRL+ 
Sbjct: 935  NKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFG 994

Query: 1100 TINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSD 1159
             +NH GTL+SGHYTSLVNKDL+H +  G+ KWYYFDDE+VK D  HG+ D+ +  +SSSD
Sbjct: 995  VVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSD 1052

Query: 1160 VYLLFYERI 1168
            VY+LFYER+
Sbjct: 1053 VYVLFYERV 1061

 Score =  133 bits (335), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 122/193 (63%), Gaps = 4/193 (2%)

Query: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64
           + PEYS+EL   VQ+ Y + ++  YP+L+ EKL+DLLE    L+E Y D +R  +  + L
Sbjct: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDAL 67

Query: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124
            A++IG +Y++LIIPQS++F TRN SYS+YTDL+K YE E NMTNVV MV +++  V+L 
Sbjct: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEI-GVVLD 126

Query: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184
           ++ +     + ++ +KRA+SVP   +   S  +  L+++     GH        E A Q+
Sbjct: 127 ESVKHAVGIEHRITKKRAFSVPANDL---SGQVASLSLENAGPHGHGFKASFTEEDAEQS 183

Query: 185 DTLWSAPKLEEND 197
             +W+AP LE ND
Sbjct: 184 SPVWTAPNLEPND 196

 Score =  105 bits (263), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 92/168 (54%), Gaps = 5/168 (2%)

Query: 431 NAAGLESCNPLTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLI 489
           N    E    L  L + S I   +L  IL + I+ +++L IDLR P+R E+NHIVA +L+
Sbjct: 286 NVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLV 345

Query: 490 NIDPLLLWDTERSAPITSVNEFERRL-DNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELT 548
            IDP LLWD + + P+   +  E  L +N +F  R +F Y+V YTD  T M M+F +   
Sbjct: 346 KIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFI 405

Query: 549 FFELVYMGKPRLLTK---CLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593
           FF L+   +   LT     L GGY++W+  L T  +     I D+++R
Sbjct: 406 FFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYR 453

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  211 bits (538), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 144/249 (57%), Gaps = 25/249 (10%)

Query: 729 SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNK-YSRYLKSSN 787
           +VP I+   N    LS+ GLRN  NTCYINSM+QCLF T   R+LF+S   Y  ++K   
Sbjct: 221 TVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA 280

Query: 788 MDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXX 847
              +S  F  L   MY NGG SV+P  FL+  S L+PDL IP  QQDTQ           
Sbjct: 281 ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQ----------- 329

Query: 848 XXXSYLAAVVNDYPQLLLHESSVLKVN--------DKEYTTWFDQNFEKNGLSPIDSIFQ 899
               +L  +++     L++   ++  N         KEY  W   N + NG SPID IFQ
Sbjct: 330 ---EFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQ 386

Query: 900 GQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTG 959
           GQIE+ L CQRC  +SY+YS FY+LSLA+P    +      +++LEDCINFFT DE+LTG
Sbjct: 387 GQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCINFFTSDEILTG 444

Query: 960 QNPWDCPKC 968
           +N W+CPKC
Sbjct: 445 ENAWNCPKC 453

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 7/133 (5%)

Query: 1043 LATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNN-EVAKYRLYSTI 1101
            L T+K LNFI LP IL+IHLSRF Y+ TKKNN V+TYPLILNI++KNN +V KY+LY  I
Sbjct: 523  LITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLI 582

Query: 1102 NHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV-KLDPNHG-----NYDRGITSV 1155
            NH G L  GHYTS+VNKDL H +   +Q+WY FDDE++ KL+ N+      +++      
Sbjct: 583  NHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEF 642

Query: 1156 SSSDVYLLFYERI 1168
             SS VY+LFYERI
Sbjct: 643  DSSKVYVLFYERI 655

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 88/155 (56%), Gaps = 11/155 (7%)

Query: 12  ELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAA---NLFESYQDLVREGQTREGLMAYV 68
           +L + V   ++  +++ Y +LR E+L DLL+      +LF+ Y     + + R+  +A+V
Sbjct: 29  DLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTS--HKSRKRQATLAFV 86

Query: 69  IGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPE 128
            G+FYL+LIIP  ++F T+N  ++ Y DL+  YE + +M N++  V EK  ++L     +
Sbjct: 87  NGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSIL----EQ 142

Query: 129 DGERGDTKLYRKRAYSVP--EKGVARSSDSLQHLT 161
           D    + ++ +KRAY+ P    G++R   S   L+
Sbjct: 143 DLSGINRRILKKRAYTEPSIRSGLSRDRSSTSVLS 177

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  135 bits (340), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 118/204 (57%), Gaps = 11/204 (5%)

Query: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60
            S  + PEYS+EL+  VQ+ Y+  ++ L P+LR  KL+DLLE  A L E++   +  G+ 
Sbjct: 7   FSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRY 66

Query: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120
            + L AY++G +YLYLIIPQS +F T+N SYS+Y D +  Y+ E NMTNV  MV  +VD+
Sbjct: 67  DDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDS 126

Query: 121 VLLR--QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP 178
           +L +  Q PE  +R    + R RA+SV +    +  ++++    + K       +  A P
Sbjct: 127 ILDKSYQEPEPTKRV---IPRGRAFSV-KDDTPKDYNTIEFPIRERKSSTTQRPLSMAKP 182

Query: 179 --EVAVQADT---LWSAPKLEEND 197
              + ++ D    LW+AP L  ND
Sbjct: 183 YDSLPMELDDSTPLWTAPSLNPND 206

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/180 (33%), Positives = 96/180 (53%), Gaps = 14/180 (7%)

Query: 413 LDRPHNSRVEPYNP--FANGNAAGLESCN--------PLTRLYETSSIKCSDLMIIL-ES 461
           +DR    R + Y+     N N+AG    N         L RL + + I C +L  IL + 
Sbjct: 268 VDRSETHRKDSYHSVYMDNDNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDP 327

Query: 462 DIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFT 521
             +D +L I L  P+R + N+IVA++ INIDP +LWD E + PI+   + E+ L++ LF 
Sbjct: 328 TTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFN 387

Query: 522 TRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLT---KCLQGGYDQWRLYLKT 578
            R  F+Y+V YTD  T M ++F +  T F L+   +  +L      L GG ++W+  ++T
Sbjct: 388 IRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRT 447

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
            Anc_8.188 YDR069C
          Length = 978

 Score =  101 bits (251), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 112/447 (25%), Positives = 176/447 (39%), Gaps = 99/447 (22%)

Query: 745  ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK-SSNMDN---MSRSFYMLFK 800
            I GL NM N+CY+N ++QC+  T +   +FL+N Y +++  SS + +   ++++F  L  
Sbjct: 604  IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 801  KMYMNGGCSVVPSGFLKMCSYLKP-DLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVND 859
             MYM+   S +     K    +KP   ++  G  ++                 L  +  D
Sbjct: 664  TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFRDSQQQDSQEFCQFLLDGLHED 723

Query: 860  YPQL--------------LLHESSVLKVNDK-EYTTWFDQNFEKNGLSPIDSIFQGQIEH 904
              Q                L E+  L++    E+  +   +F     S I  +FQGQ   
Sbjct: 724  LNQCGGNPPLKELSLEAERLRENLSLRIASSIEWERYLTTDF-----SVIVDLFQGQYAS 778

Query: 905  QLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFG-KAKKLRLEDCINFFTCDEVLTGQNPW 963
            +L C+ C  +S +Y +F VLS+ LP    K F  + +K+ L DC N FT  E L     W
Sbjct: 779  RLECKVCHHTSTTYQSFSVLSVPLP----KKFDPQTRKIDLIDCFNEFTKIENLEVDEQW 834

Query: 964  DCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXX 1023
             CP C       +++   +                       LPR               
Sbjct: 835  SCPTCKKKQPSTKKLTITR-----------------------LPR--------------- 856

Query: 1024 XXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLIL 1083
                       H KR++  L   K+ +FI  P    + L+ F  D    N      P + 
Sbjct: 857  -------NLIIHLKRFDNMLN--KNNSFIDYP--FNLDLTEFWADDFDGN----LPPGVS 901

Query: 1084 NIVLKNNEVAKY--RLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKL 1141
            N +    ++  +  RLY    HFG+L  GHYT+ V+K + +        WYYFDD   + 
Sbjct: 902  NELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGN-------GWYYFDDTTYRP 954

Query: 1142 DPNHGNYDRGITSVSSSDVYLLFYERI 1168
              N            SS  Y+LFY R+
Sbjct: 955  LKNDK-------EPISSSAYVLFYTRV 974

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 15/93 (16%)

Query: 448 SSIKCSDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT------ER 501
           S+I+ ++LM     +  D +L ID+R    +  +HI ++++I I+P+   D+      ER
Sbjct: 187 STIQLNELM----RNFNDSLLIIDIRSRSEFIKSHIKSKNIICIEPISFKDSYSDYELER 242

Query: 502 SAPITSVNEFERRLDNPLFTTRGQFSYLVCYTD 534
            + ITS N   R     LF  R  F ++V YT+
Sbjct: 243 KSIITSPNNEIR-----LFNNRQSFKFIVLYTE 270

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 117/447 (26%), Positives = 179/447 (40%), Gaps = 108/447 (24%)

Query: 745  ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFK 800
            I GL+N+ N+CY+N ++QCL  T E   +FL+N Y R++    K  +   +++ F  L  
Sbjct: 558  IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 801  KMYMNGGCSVVPSGFLKMCSYLKP-DLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVND 859
             M+ +    +         +Y++P   ++  G  +T                 L  +  D
Sbjct: 618  LMHNHANPKL-------KNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHED 670

Query: 860  YPQL-----LLHESSVLKVNDKEYT-------TWFDQNFEKNGLSPIDSIFQGQIEHQLS 907
              Q      L   SS  + N ++ +        W  + F     S I  +FQGQ   +L 
Sbjct: 671  LNQCGSNPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQ 728

Query: 908  CQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPK 967
            C+ C  +S +Y  F VLS+ +P        K  K+ + DC   FT  E+L     W CP 
Sbjct: 729  CEVCKHTSTTYQPFSVLSVPIPR-----VPKGVKVNILDCFKDFTKLELLDTDEQWLCPT 783

Query: 968  CGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXXX 1027
            C            +K +R  K    +            LPR                   
Sbjct: 784  C------------KKKQRSTKKLTIT-----------RLPR------------------- 801

Query: 1028 XXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRF-VYDLTKKNNTVVTYPLILNIV 1086
                   H KR++  L    +  FI  P   I+ L++F V D   K       P + + +
Sbjct: 802  ---NLIIHLKRFDNNLNKNNN--FIDYP--FILDLTQFWVDDFDGK-----LPPGVRDEL 849

Query: 1087 LKNNEVA--KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPN 1144
             K  ++   KY+LY   +HFG+L  GHYT+ V+K  +H        WYYFDD        
Sbjct: 850  PKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKH-------GWYYFDDT------- 895

Query: 1145 HGNYDRGITSVS---SSDVYLLFYERI 1168
              NY R I + +   +S  YLLFY RI
Sbjct: 896  --NY-RSIKNKNEPITSSAYLLFYHRI 919

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 20/113 (17%)

Query: 467 VLFIDLRPPKRYELNHIVARHLINIDPLLLWDT------ERSAPITSVNEFERRLDNPLF 520
           VL ID+RP   +  +HI    +I ++P+   D+       + + ITS NE    +D  LF
Sbjct: 183 VLLIDIRPRLEFSKSHIKHEEIICVEPISFKDSYSDEEVAKKSLITSPNE---EID--LF 237

Query: 521 TTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLTKCLQGGYDQWR 573
             R +F +++ YT++       +  ++ F E+       LLT       D W+
Sbjct: 238 NKRNEFEFIILYTNDKEKAY--YNQQMVFLEI-------LLTHSFAKPLDSWK 281

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar to
            uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
            ubiquitin-specific protease
          Length = 887

 Score = 97.4 bits (241), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 122/470 (25%), Positives = 176/470 (37%), Gaps = 137/470 (29%)

Query: 738  NEYIALSIT-GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL-KSSNMDN---MS 792
            N+ +  S T GL NM N+CYIN ++QC+F+TTE   +FL+  Y++++ K S + +   +S
Sbjct: 516  NQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKGVLS 575

Query: 793  RSFYMLFKKMY-------------------MNGGCSVVPSGF--------LKMCSYLKPD 825
             +F  L K MY                       C+ V S F        L+ C +L   
Sbjct: 576  HNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDASQQDCLEFCQFLLDG 635

Query: 826  LRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQN 885
            L     Q                    L+  V          SS+      E+  +   +
Sbjct: 636  LHEDLNQCGANPPLKELSPEAEKMRENLSLRV---------ASSI------EWERYLTTD 680

Query: 886  FEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLE 945
            F     S I  +FQGQ   QL C+ C+ +S +Y  F VLS  +P P  K+ G      L 
Sbjct: 681  F-----SIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLS--VPVPSGKSCG------LL 727

Query: 946  DCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDH 1005
            DC   FT  E L     W CP C       +++   +                       
Sbjct: 728  DCFIEFTKTENLEVDEQWFCPSCKKKQPSTKKLTITR----------------------- 764

Query: 1006 LPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRF 1065
            LPR                          H KR++  +   K+  F+  P+IL       
Sbjct: 765  LPR----------------------NLIIHLKRFDNMMN--KNNIFVRYPQIL------- 793

Query: 1066 VYDLT---KKNNTVVTYPLILNIVLKNNEVAKY--RLYSTINHFGTLISGHYTSLVNKDL 1120
              DLT     ++     P I + +    +V  +  RLY    HFGTL  GHYTS V+K  
Sbjct: 794  --DLTPFWANDSDGKLPPGITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDK-- 849

Query: 1121 QHEIREGKQK-WYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERIS 1169
                  G +K W YFDD + +         R      S   Y+LFY RI+
Sbjct: 850  ------GPEKGWIYFDDTVYR-------PVRFQNEFISPSAYVLFYHRIT 886

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 448 SSIKCSDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITS 507
           S I CS+L+ +++   +D +L ID+RP   Y+ +HI  +++I I+P+   ++     I  
Sbjct: 188 SGISCSELLSLMKMK-EDSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIEK 246

Query: 508 VNEFER-RLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELV 553
            +     + +  LF  R +F Y++ YTD     N  F+   +  E++
Sbjct: 247 TSMIPSPKHEIQLFQRRSEFQYIILYTDLEEKSNFYFQQLKSLLEIL 293

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score = 95.9 bits (237), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 111/262 (42%), Gaps = 41/262 (15%)

Query: 731 PTIEKNP-----NEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKS 785
           P+ E +P     N+Y      GL NM N+CYIN ++QCL  T E  N+FL+  Y R++  
Sbjct: 443 PSRESSPALGSANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHI-- 500

Query: 786 SNMDN-------MSRSFYMLFKKMYMNG-------GCSVVPSGFLKMCSYLKPDLRIPHG 831
            NM++       +++ F  L   MY N        G  V P  F   C  +    R   G
Sbjct: 501 -NMNSRLGSKGVLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR-ESG 558

Query: 832 QQDTQXXXXXXXXXXXXXXSYLAA-----VVNDYPQLLLHESSVLKVNDKEYTTWFDQNF 886
           QQD Q              +          ++D  + +  + S+   +  E+  +   +F
Sbjct: 559 QQDCQEFCQFLLDGLHEDLNQCGGNPPLKELSDEAEKMREKLSLRIASSIEWERFLTTDF 618

Query: 887 EKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLED 946
                S I  +FQGQ   QL CQ C  +S +Y  F VLS+ +P+        AK   + D
Sbjct: 619 -----SVIVDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVPH--------AKSCNIID 665

Query: 947 CINFFTCDEVLTGQNPWDCPKC 968
           C   FT  E L     W CP+C
Sbjct: 666 CFKEFTKVEKLETDEQWSCPRC 687

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 64/152 (42%), Gaps = 36/152 (23%)

Query: 1038 RYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV----------- 1086
            R  KK  + K L    LPR LIIHL RF  ++  KNN  V YP  L++            
Sbjct: 686  RCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRL 744

Query: 1087 ----------LKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD 1136
                         +    Y+LY   +H G+L  GHYTS V+K         K+ W YFDD
Sbjct: 745  PPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKG-------PKRGWCYFDD 797

Query: 1137 EIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
                  P      R  T   + + Y+LFY R+
Sbjct: 798  --TSFRPV-----RNATECITPNAYVLFYHRV 822

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 60/140 (42%), Gaps = 21/140 (15%)

Query: 448 SSIKCSDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTER 501
           S+I  S L  +++S   D  L IDLR    +   HI A+++I I+P+         + E+
Sbjct: 160 STISSSHLQQLIDSH-NDSTLLIDLRQRGEFSKLHINAKNVICIEPISFKAQYTDLEIEK 218

Query: 502 SAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHT---SMNMDFKFELTFFELVY---M 555
            + ITS  E     +  LF  R  F ++V YT       S + D + +    +L+     
Sbjct: 219 KSLITSPKE-----EIGLFRARDTFKFIVLYTSEDKESHSRSFDLQQQAILLDLLINHSF 273

Query: 556 GKP---RLLTKCLQGGYDQW 572
            KP         L+ G+  W
Sbjct: 274 AKPLNANTRVYVLKAGFSNW 293

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
            Ashbya gossypii AFR007W
          Length = 851

 Score = 91.3 bits (225), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 108/445 (24%), Positives = 163/445 (36%), Gaps = 104/445 (23%)

Query: 746  TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
             GL N  N+CY++ ++QCL  T E   +FL+N Y  ++    +  +   ++R F  L  +
Sbjct: 486  VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQ 545

Query: 802  MYMNGG----------CSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXS 851
            MY  G            +V+P+ F   C  +    R    QQD Q               
Sbjct: 546  MYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHED-- 602

Query: 852  YLAAVVNDYPQLLLHESS-----VLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906
             L    N+ P   L E +     ++ +       W  + +     S I  +FQGQ   QL
Sbjct: 603  -LNQCGNNPPLKELSEKAEKMREMMPMRIASSIEW--ERYLTTDFSVIVDLFQGQYASQL 659

Query: 907  SCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCP 966
             C+ C  +S +Y  F VLS+ +P+        +++  + DC   FT  E L     W CP
Sbjct: 660  RCKVCGRTSTTYQPFSVLSVPVPS--------SRQCTIIDCFTEFTKVETLDLDEQWSCP 711

Query: 967  KCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXX 1026
             C       +++   +                       LPR                  
Sbjct: 712  DCKKRQPSTKKITITR-----------------------LPR------------------ 730

Query: 1027 XXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFV---YDLTKKNNTVVTYPLIL 1083
                    H KR++  L   K+  F++   +L  +L+ F    YD    NN  V  P   
Sbjct: 731  ----NLIIHLKRFDNMLN--KNNVFVSYSAVL--NLTSFWANDYDKKVMNNNNVELPSRG 782

Query: 1084 NIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDP 1143
             +   N     Y+LY    H GTL  GHYT+ VNK            W Y+DD       
Sbjct: 783  QVPPFN-----YQLYGVACHTGTLYGGHYTAYVNKG-------ATLGWCYYDD------- 823

Query: 1144 NHGNYDRGITSVSSSDVYLLFYERI 1168
             +    R      S + Y+LFY RI
Sbjct: 824  TNWRQIRSSNEYISQNAYVLFYHRI 848

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 467 VLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDN--PLFTTRG 524
           VL ID+RP   +   HI    LI I+P+   D+     I   +      DN   LF  R 
Sbjct: 177 VLLIDIRPRVDFVNFHIKFESLICIEPVSFKDSHSDIDIAKKSMITSP-DNEIALFQERD 235

Query: 525 QFSYLVCYTDNHTSMNMDFKFELTFFELVY-------MGKPRLLTKCLQGGYDQW 572
           +F Y++ YT      + +   +    +L+        +   ++LT  L GG+  W
Sbjct: 236 KFEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQKSLYNTKILT--LDGGFSSW 288

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 89.0 bits (219), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 114/262 (43%), Gaps = 37/262 (14%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-------MSRSFYM 797
           I GL N+ N CY+N +LQCL  T +   +FL N Y  ++   N D+       ++++F +
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFI---NFDSSRGSKGLLAKNFAI 501

Query: 798 LFKKMYMNGGCS--------VVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXX 849
           L   M+ +G  +        V    F K+C ++ P +     QQD Q             
Sbjct: 502 LVNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEFCQFLLDGLHED 560

Query: 850 XSYLAAV-----VNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEH 904
            +   +      ++D  + +  + S+ K +  E+  +   +F     S I  +FQGQ   
Sbjct: 561 LNQNGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDF-----SAIIDLFQGQYAS 615

Query: 905 QLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWD 964
           +L CQ C+ +S +Y TF VLS+ +P        + K   + DC   FT  E L     W 
Sbjct: 616 RLQCQVCEHTSTTYQTFSVLSVPVP--------RVKTCNILDCFREFTKCERLGVDEQWS 667

Query: 965 CPKCGVNSSGDRQMNSEKSKRK 986
           CPKC       +Q+   +  +K
Sbjct: 668 CPKCLKKQPSTKQLKITRLPKK 689

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 67/150 (44%), Gaps = 40/150 (26%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI-----------VLKN 1089
            KK  + K L    LP+ LII+L RF   + K NN  V YP  L++            + N
Sbjct: 673  KKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWARDFNHEAIVN 731

Query: 1090 NEVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKL 1141
             ++         +YRLY    H G+L  GHYTS V K         K+ WY+FDD +   
Sbjct: 732  EDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSLY-- 782

Query: 1142 DPNHGNYDRGITSVS---SSDVYLLFYERI 1168
                    R IT  +   +   Y+LFYERI
Sbjct: 783  --------RPITFSTEFITPSAYVLFYERI 804

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 465 DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFER-RLDNPLFTTR 523
           D +L ID+RP   +   HI  +++I IDP    D+     I SV+       D   F+ R
Sbjct: 161 DALLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSNR 220

Query: 524 GQFSYLVCYTDNHTSMNMDFKFELTFFELVYMG---KPRLLTK--CLQGGYDQW 572
            +F +++ YTD     N   +      +++      KP   TK   L+ G+  W
Sbjct: 221 DKFKFIILYTDTQLHNNFQQRQTRILAKILSQNSVIKPLSGTKILILENGFSNW 274

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score = 89.0 bits (219), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 100/243 (41%), Gaps = 36/243 (14%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKKM 802
           GL NM N+CY+N ++QCL +  E   +FL+N Y +++    K  +   +++SF  L   M
Sbjct: 736 GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININSKLGSKGILAKSFARLVHSM 795

Query: 803 YMNGGCS-----------VVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXS 851
           Y NG  S           V P  F   C  +   L     QQD Q              +
Sbjct: 796 YQNGTLSIKNHSNKKNPPVQPITFKTACGSIN-SLFKGSNQQDCQEFCQFLLDGLHEDLN 854

Query: 852 YLAAVVNDYPQLLLHESSVLKVNDK------EYTTWFDQNFEKNGLSPIDSIFQGQIEHQ 905
              A     P L    +   ++ +K          W  + F     S I  ++QGQ   Q
Sbjct: 855 QCGA----NPPLKELSTEAERMREKLSLRIASSIEW--ERFLTTDFSVIIDLYQGQYASQ 908

Query: 906 LSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDC 965
           L CQ C  +S +Y TF VLS+ +P        K K + L DC N FT  E L     W C
Sbjct: 909 LKCQVCGTTSTTYQTFSVLSVPVP--------KNKSIHLLDCFNEFTKTEFLGKDELWSC 960

Query: 966 PKC 968
            +C
Sbjct: 961 TEC 963

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 57/121 (47%), Gaps = 29/121 (23%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI--------------- 1085
            KK  + K+L    LP+ LIIHL RF  ++  KNN  V YPLIL++               
Sbjct: 965  KKQPSTKTLTITRLPKNLIIHLKRFD-NMLHKNNVFVKYPLILDLTNYWANDFDGKLPPG 1023

Query: 1086 ----VLKNNEVA--KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
                +    ++   KY L     H G+L  GHYT+ VNK L       K  WYYFDD + 
Sbjct: 1024 VTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDDTVY 1076

Query: 1140 K 1140
            +
Sbjct: 1077 R 1077

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 49/95 (51%), Gaps = 14/95 (14%)

Query: 448 SSIKCSDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTER 501
           S I  S L  IL++D  D  L ID+R    +ELNHI +  +I I+P+         D ER
Sbjct: 178 SHITSSVLATILQTD-PDSTLLIDVRTRHDFELNHIKSNSIICIEPISFKNNYSDVDIER 236

Query: 502 SAPITSVN-EFERRLDNPLFTTRGQFSYLVCYTDN 535
            + ITS N E E      +F  R  + +++ YTD+
Sbjct: 237 KSLITSPNSEIE------IFKNRENYKFIILYTDD 265

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YDR069C (DOA4) and YER144C
            (UBP5)
          Length = 848

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 101/413 (24%), Positives = 153/413 (37%), Gaps = 98/413 (23%)

Query: 746  TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
             GL N  N+CY++ ++QCL  T E   +FL+N Y  ++    +  +   ++R F  L  +
Sbjct: 488  VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQ 547

Query: 802  MYMNGG----------CSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXS 851
            MY  G            +V+P+ F   C  +    +  + QQD Q               
Sbjct: 548  MYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHED-- 604

Query: 852  YLAAVVNDYPQLLLHESS-----VLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906
             L    N+ P   L E +     ++ +       W  + +     S I  +FQGQ   QL
Sbjct: 605  -LNQCGNNPPLKELSEEAEKMREMMPMRLASAIEW--ERYLTTDFSVIVDLFQGQYASQL 661

Query: 907  SCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCP 966
             C+ C  +S +Y  F VLS+ +P+         +   L DC   FT  E L  +  W CP
Sbjct: 662  QCKVCQRTSTTYQPFSVLSVPVPS--------TRTCTLTDCFTEFTKIETLEQEEQWSCP 713

Query: 967  KCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXX 1026
             C       +++   +                       LPR                  
Sbjct: 714  SCKKRQPSTKKITITR-----------------------LPR------------------ 732

Query: 1027 XXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFV---YDLTKKNNTVVTYPLIL 1083
                    H KR++  L   K+  F++ P +L   L+ F    YD    NN  V  P   
Sbjct: 733  ----NLIIHLKRFDNMLN--KNNVFVSYPSVL--DLTAFWANDYDKKVTNNN-VELPSRG 783

Query: 1084 NIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD 1136
             +   N     Y+LY    H GTL +GHYT+ VNK            W Y+DD
Sbjct: 784  QVPPFN-----YQLYGIACHDGTLRAGHYTAYVNKG-------AVLGWCYYDD 824

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 103/239 (43%), Gaps = 30/239 (12%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
            GL NM N+CYIN ++QCL  T E  N+FL+N Y R++    K  +   +++ F  L  +
Sbjct: 515 VGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQ 574

Query: 802 MYMNGGC-------SVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLA 854
           M+ +          +V P  F   C  +    R   GQQD+Q              +   
Sbjct: 575 MHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDLNQCG 633

Query: 855 A-----VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQ 909
                  +++  + +    S+   +  E+  +  ++F     S I  +FQGQ   QL C+
Sbjct: 634 GNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRDF-----SVIVDLFQGQYASQLRCK 688

Query: 910 RCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKC 968
            C+ +S +Y  F +L+  +P+        AK   L DC   FT  E L     W CP C
Sbjct: 689 VCNHTSTTYQPFSILAAPVPH--------AKSCYLLDCFKEFTKLEQLEKDEEWLCPYC 739

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 71/149 (47%), Gaps = 36/149 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI--------------- 1085
            KK  + K L    LPR LIIHL RF  +L  KNN +V YP  L++               
Sbjct: 741  KKQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPG 799

Query: 1086 ----VLKNNEVA--KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
                +    +VA  KY+LY+  +H G+L  GHYT+ V+K L        + WYYFDD   
Sbjct: 800  VTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLN-------KGWYYFDDTGY 852

Query: 1140 KLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            +         R  T   +S+ Y+LFY R+
Sbjct: 853  RP-------MRTPTECITSNAYVLFYHRV 874

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 69/144 (47%), Gaps = 27/144 (18%)

Query: 450 IKCSDLMIILESDIQDR-VLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERS 502
           I   +L  +L+SD  DR +L +D+R    +E  HI A ++I I+P+         + E+ 
Sbjct: 154 ISAKELEFLLKSD--DRNILLVDVRQRSEFEETHIKASNVICIEPISFKSSYTDLELEKK 211

Query: 503 APITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTS---MNMDFKFELTFFELVY---MG 556
           + ITS N     ++  +F  R +F++++ YTD +      N   + E+   +L+      
Sbjct: 212 SMITSPN-----VEIDIFKRRNEFTFVILYTDGNKENGHHNFYIQQEMVLLDLLINRSFA 266

Query: 557 KP-----RLLTKCLQGGYDQWRLY 575
           KP     ++L   L+ G   W+ +
Sbjct: 267 KPLHKDVKILV--LEAGISSWKFH 288

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 132/312 (42%), Gaps = 48/312 (15%)

Query: 694 LPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIA-LSI---TGLR 749
           +P   ++P P  YE PK+        S  S      +P    NP + +  L +   TGL 
Sbjct: 409 VPMGFKNPIPQMYEIPKYNP------SVNSGPKLPLLPPT-ANPQQIVPKLDLDFTTGLE 461

Query: 750 NMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-------MSRSFYMLFKKM 802
           N+ N+CY+N ++QCL ST +   L+L+N    +L   N++N       +S++F  L + M
Sbjct: 462 NVKNSCYMNCVIQCLLSTHDLTKLYLTNA---FLTQINVENKLGSKGFLSKNFANLIQTM 518

Query: 803 YMNGGCS---------VVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYL 853
           Y               V P  F   C  +   +     +QD Q              +  
Sbjct: 519 YKKSAFQPYNPNFLHPVAPLEFKNACGMMN-SIYAESTEQDCQEFCEFLLDGLHEDLNQC 577

Query: 854 AAVVNDYPQLL------LHESSVLKV-NDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906
           +   N  P+ L      L ES  +++ ++ E+ ++   NF     SPI ++FQGQ   +L
Sbjct: 578 SG--NPRPKELSANEAELRESLSMRIASEIEWESFLTTNF-----SPIINLFQGQYASRL 630

Query: 907 SCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCP 966
            C  C  +S +Y  F +LS+ +P   S  F   +   + DC   FT  E L     W CP
Sbjct: 631 QCLICQHTSTTYQPFSLLSIPVP---SMVFSNGQTCNILDCFKEFTKCERLDNDEKWFCP 687

Query: 967 KCGVNSSGDRQM 978
           KC       +Q+
Sbjct: 688 KCRRKQISTKQL 699

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 64/152 (42%), Gaps = 42/152 (27%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV-LKNNEVA------ 1093
            +K  + K L    LP+ LIIH  RF  +   KNN  V YP  L++  L  N+        
Sbjct: 691  RKQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPN 749

Query: 1094 --------------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD--- 1136
                          KY+L +   H G L SGHYT+ V+K L        + W+ FDD   
Sbjct: 750  FNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLY-------RGWFRFDDASY 802

Query: 1137 EIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
              VK            T   + D YLLFY+RI
Sbjct: 803  RPVKFG----------TEFLTPDAYLLFYQRI 824

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 18/119 (15%)

Query: 467 VLFIDLRPPKRYELNHIVARHLINIDPLLLWDT------ERSAPITSVNEFERRLDNPLF 520
           +L ID+R  K ++  HI A  ++ I PL    T      E+++ +TS   F+ R     F
Sbjct: 185 LLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIEQTSLLTST--FQER---NYF 239

Query: 521 TTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMG--KPRLLTKC-----LQGGYDQW 572
             R QF Y+V YT +       +   ++ F ++ +   K  +   C     L+GG   W
Sbjct: 240 KKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQICPSIFILKGGITSW 298

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 102/239 (42%), Gaps = 31/239 (12%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKKM 802
           GL NM N+CY+N ++QCL S+ EF  +FL+N Y +++    K  +   ++R+F  L   M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 803 YMNGG--------CSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLA 854
           Y  G           V P+ F   C  +    R    QQD+Q              +   
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDLNQCG 727

Query: 855 A-----VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQ 909
           A      ++   + +  + S+   +  E+  +   +F     S I   FQGQ   QL C+
Sbjct: 728 ANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTDF-----SVIVDQFQGQYASQLRCK 782

Query: 910 RCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKC 968
            C  +S +Y  F VLS+ +P        + K   + DC N FT  E L     W CP C
Sbjct: 783 VCGGTSTTYQAFSVLSVPVP--------RGKSCNIIDCFNEFTKVENLETDELWACPHC 833

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 70/149 (46%), Gaps = 37/149 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV--LKNNEVAK---- 1094
            KK  + K L    LPR LIIHL RF  ++  KNN  V YP +L++     N+   +    
Sbjct: 835  KKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPG 893

Query: 1095 ---------------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
                           Y+L +   HFG+L  GHYTS V+K        GK  W YFDD   
Sbjct: 894  VTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDD--T 943

Query: 1140 KLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            K+ P   +Y+       +S+ Y+LFY R+
Sbjct: 944  KIRPLKNSYE-----CITSNAYVLFYHRV 967

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 53/121 (43%), Gaps = 18/121 (14%)

Query: 465 DRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERSAPITSVNEFERRLDNP 518
           D +L ID+RP   +E +HI  +++I I+P+         + ++ + ITS ++  +     
Sbjct: 198 DTLLVIDVRPRMEFEESHIKCKNIICIEPVSFNESFTDLELQKKSMITSPSDEVKT---- 253

Query: 519 LFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVY-------MGKPRLLTKCLQGGYDQ 571
            F  +  F+Y+V  TD           +L   +L+        M +  +    L+ G+  
Sbjct: 254 -FAKKDTFNYIVICTDTDEKKQFYLHQQLVLLDLLMNKSFTKPMFQKNVKIFILEKGFKN 312

Query: 572 W 572
           W
Sbjct: 313 W 313

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 84.7 bits (208), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 99/240 (41%), Gaps = 31/240 (12%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
            GL NM N+CY+N ++QCL ST E   +FL+N Y +++    K  +   +++ F  L   
Sbjct: 519 VGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHT 578

Query: 802 MYMNGGCS--------VVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYL 853
           MY  G           + P  F   C  +   L   + QQD+Q              +  
Sbjct: 579 MYREGSFKRPLEKNKPIQPIQFKMACGSIN-SLFKDNTQQDSQEFCQFLLDGLHEDLNQC 637

Query: 854 AAVVNDYPQLLLHESS-----VLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSC 908
            A   + P   L E +      L +       W  + F     S I  +FQGQ   QL C
Sbjct: 638 GA---NPPLKELSEDAEKMREKLSMRIASSIEW--ERFLTTDFSVIVDLFQGQYASQLKC 692

Query: 909 QRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKC 968
           + C  +S +Y TF VLS+ +P+  S          + DC N FT  E L     W CP C
Sbjct: 693 KVCGCTSTTYQTFSVLSVPVPHVSS--------CHILDCFNEFTKVEKLGTDELWSCPTC 744

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 68/149 (45%), Gaps = 36/149 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI--------------- 1085
            KK  + K L    LPR LIIHL RF  ++  KNN  V YP +L++               
Sbjct: 746  KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPG 804

Query: 1086 ----VLKNNEVA--KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
                +    +V   +Y+L +  +H G+L  GHYT+ VNK +        + W+YFDD   
Sbjct: 805  VTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGIN-------RGWHYFDDTSY 857

Query: 1140 KLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            +   N        T   + + Y+LFY R+
Sbjct: 858  RPIKNE-------TECITPNAYVLFYHRV 879

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 11/73 (15%)

Query: 467 VLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERSAPITSVNEFERRLDNPLF 520
           +L ID+RP   ++  HI A+ +I ++P+         + E+ + ITS  +     +  LF
Sbjct: 186 LLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEKKSLITSPQK-----EIALF 240

Query: 521 TTRGQFSYLVCYT 533
             R +++Y+V YT
Sbjct: 241 QARDKYNYIVIYT 253

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 136/325 (41%), Gaps = 43/325 (13%)

Query: 674 SRITG--QIDHTQYNQP--EKYRYLPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFS 729
           S+ TG  Q+ + Q + P  EK   L  S+    P     P  +  +   ++A SS++H  
Sbjct: 536 SQATGSSQVQYPQISHPIDEKLNPLMGSKVPNSPQLPPLPSKSVSTNKIVTA-SSKSHLP 594

Query: 730 VPTIEKNPNEYIALS---------ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780
             +I  +   ++A S         + GL NM N+CY+N ++QCL    E   +FL N + 
Sbjct: 595 NNSILTSTGNHVAESTGPQFDLDFMVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFE 654

Query: 781 RYL----KSSNMDNMSRSFYMLFKKMYMN------GG--CSVVPSGFLKMCSYLKPDLRI 828
           +Y+    K  +   ++R F  L   MY N      GG    V P+ F   C  +    + 
Sbjct: 655 KYVNLNSKLGSKGVLARYFSRLIHTMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK- 713

Query: 829 PHGQQDTQXXXXXXXXXXXXXXSYLA-----AVVNDYPQLLLHESSVLKVNDKEYTTWFD 883
              QQD Q              +        A + +  + L  + S+   +  E+  +  
Sbjct: 714 GGSQQDCQEFCQFLLDGLHEDLNQCGGNKRLAELTEEAENLREKLSLRIASSIEWERFLT 773

Query: 884 QNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLR 943
            +F     S I  +FQGQ   +L C+ C  +S +Y  F VLS+ +P   SK   K   + 
Sbjct: 774 TDF-----SVIGDLFQGQYASRLQCKTCGKTSTTYQPFSVLSIPVP---SKHISKCSII- 824

Query: 944 LEDCINFFTCDEVLTGQNPWDCPKC 968
             DC + FT  E L     W CP+C
Sbjct: 825 --DCFDEFTKVENLEVDEQWSCPRC 847

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 70/151 (46%), Gaps = 35/151 (23%)

Query: 1038 RYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV----------- 1086
            R   K  + K L    LPR LIIHL RF   L K NN +V YP  L++            
Sbjct: 846  RCKSKQPSTKKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKL 904

Query: 1087 -LKNNEVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE 1137
             L  +E+          Y+LY    HFG+L  GHYT+ V+K +       K  WYYFDD 
Sbjct: 905  PLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGI-------KNGWYYFDDT 957

Query: 1138 IVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
              +   N       +  ++SS  Y+LFY+RI
Sbjct: 958  SCRPIKN------SMEPITSS-AYVLFYKRI 981

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 458 ILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERSAPITSVNEF 511
           IL      +VLFID+R    +   H    ++I I+P+         D E+ + ITS N+ 
Sbjct: 185 ILRDHDSSQVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSSYSDHDLEKKSMITSTND- 243

Query: 512 ERRLDNPLFTTRGQFSYLVCYT-DNHTSMNMDFKFELTFFELVYMG----KP---RLLTK 563
               +  LF  R +F+++V Y+ D      + +K   T    + +     KP   RL   
Sbjct: 244 ----EIVLFHRRQEFAFIVLYSNDTDKKSGIVYKERKTLLANLLLNHSFEKPLSNRLYV- 298

Query: 564 CLQGGYDQW 572
            L+ G+D W
Sbjct: 299 -LENGFDSW 306

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 99/248 (39%), Gaps = 27/248 (10%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
            GL NM N+CY+N +LQC+  T E   +FL+N Y +++    K  +   ++R F  L   
Sbjct: 583 VGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHI 642

Query: 802 MYMNG------GCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA 855
           M+            V P+ F    + +    R    QQD Q                L  
Sbjct: 643 MHQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDCQEFCQFLLDGLHED---LNQ 698

Query: 856 VVNDYPQLLLHESS-----VLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQR 910
             N+ P   L E +     +L +       W  + F     S I  +FQGQ   +L C  
Sbjct: 699 CGNNPPLKELSEEAEKKRELLSLRIASSIEW--ERFLTTNFSVIIDLFQGQYASRLKCSV 756

Query: 911 CDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGV 970
           C  +S +Y  F VLS+ LP       G    + L DC N FT  E L     W+CP C  
Sbjct: 757 CSNTSTTYQPFSVLSVPLPT------GTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTCKK 810

Query: 971 NSSGDRQM 978
                +Q+
Sbjct: 811 KQPSTKQL 818

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 72/150 (48%), Gaps = 37/150 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVL-----KNNEVA-- 1093
            KK  + K L    LPR LIIHL RF   + K N  ++ YP  L++       K++ +   
Sbjct: 810  KKQPSTKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPG 868

Query: 1094 ---------------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
                           KY LY+  NHFG+L  GHYTS VNK L        + WYYFDD+ 
Sbjct: 869  VSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLS-------RGWYYFDDQN 921

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             +L        +  + V +S+ Y+LFY R+
Sbjct: 922  YRL-------VKKTSEVVNSNAYVLFYRRV 944

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 80/309 (25%), Positives = 127/309 (41%), Gaps = 44/309 (14%)

Query: 683 TQYNQPEKYRYLPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIA 742
           + Y+ P    Y  +  +SPY I+    ++T  S   +       H +V T EK   EY  
Sbjct: 691 SDYSIPNITTYNDEREKSPYNIQKLQIQNTAGSNDLIP----HHHNNVTTHEK---EYDL 743

Query: 743 LSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL--------KSSNMDNMSRS 794
             I GL+NM N+CY+N ++QCL  T E   +FL+  + RY+        K     N+S+ 
Sbjct: 744 DFIIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKL 803

Query: 795 FYMLF----------KKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXX 844
            ++++          K    +G   + P  F   C  +  +L     QQD Q        
Sbjct: 804 IHLMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSIN-NLFKNCSQQDCQEFCQFLLD 862

Query: 845 XXXXXXSYLAA-----VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQ 899
                 +   +      ++   + +  + S+   +  E+  +   +F     S I  +FQ
Sbjct: 863 ALHEDLNQCGSNPPLKELSTKAESMREKLSLRIASSIEWERYLTTDF-----SVIVDLFQ 917

Query: 900 GQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTG 959
           GQ   +L C+ C  +S +Y  F VLS+ +P        K K L L DC   FT  E L  
Sbjct: 918 GQYASRLQCKTCIHTSTTYQPFSVLSVPIP--------KKKNLNLLDCFKDFTKIENLEV 969

Query: 960 QNPWDCPKC 968
              W CP C
Sbjct: 970 DEQWFCPNC 978

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 72/151 (47%), Gaps = 42/151 (27%)

Query: 1042 KLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI---------------- 1085
            K  + K L    LPR LIIHL RF  +L K N  ++ YP IL++                
Sbjct: 981  KQPSTKKLTITRLPRNLIIHLKRFDNNLNKNN-NLIDYPFILDLTQFWADDFDGELPPGV 1039

Query: 1086 ---VLKNNEVA--KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
               + K  ++   KYRLY    HFG+L  GHYT+ VNK     IR G   WYYFDD    
Sbjct: 1040 TDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKG----IRNG---WYYFDD---- 1088

Query: 1141 LDPNHGNYDRGITSVS---SSDVYLLFYERI 1168
                  NY R I +     SS+ Y+LFY RI
Sbjct: 1089 -----TNY-RPIKNEREPISSNAYVLFYHRI 1113

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 103/251 (41%), Gaps = 19/251 (7%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
            GL N+ N+CY+N ++QC+  T E   +FL + Y++++    K  +   +++ F  L   
Sbjct: 565 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 624

Query: 802 MYM-----NGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA- 855
           MY      +   S+ P  F   C  +    +    QQD Q              +   + 
Sbjct: 625 MYKEQVDSSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 683

Query: 856 -VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFS 914
             + +  Q        L +       W  + F     S I  +FQGQ   +L C+ C+ +
Sbjct: 684 PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVCNHT 741

Query: 915 SYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSG 974
           S +Y  F VLS+ +P   S+      K+ +EDC   FT  E L  +  W CP C      
Sbjct: 742 STTYQPFTVLSIPIPKKNSQ-----NKITIEDCFKEFTKCENLEVEEQWLCPHCKQRQPS 796

Query: 975 DRQMNSEKSKR 985
            +Q+   +  R
Sbjct: 797 TKQLTVTRLPR 807

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 66/146 (45%), Gaps = 37/146 (25%)

Query: 1045 TIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV--------------LKNN 1090
            + K L    LPR LI+HL RF  +   KNN  V YP +L++               + ++
Sbjct: 796  STKQLTVTRLPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDD 854

Query: 1091 EVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLD 1142
            E+         KY LY    HFGTL  GHYT+ V K L       K+ W YFDD   K  
Sbjct: 855  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPV 907

Query: 1143 PNHGNYDRGITSVSSSDVYLLFYERI 1168
             N        T   +S+ Y+LFY R+
Sbjct: 908  KNQ-------TDAINSNAYVLFYHRV 926

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 11/77 (14%)

Query: 464 QDRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERSAPITSVNEFERRLDN 517
           Q   L ID+R    +  +HI ++++I ++P+         D ER + ITS N+     + 
Sbjct: 206 QMETLLIDIRSRLEFNKSHIDSKNIICLEPISFKMSYSDHDLERKSLITSPND-----EI 260

Query: 518 PLFTTRGQFSYLVCYTD 534
            LF +R  F ++V YTD
Sbjct: 261 KLFQSRNLFKFIVLYTD 277

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 122/547 (22%), Positives = 207/547 (37%), Gaps = 85/547 (15%)

Query: 467 VLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPI---TSVNEFERRLDNPLFTTR 523
           +L +D+RP   +   HI   ++I I+P+   ++   + I   + +   +R +D  LF  R
Sbjct: 174 ILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILRKSLITASDREVD--LFKNR 231

Query: 524 GQFSYLVCYTDNHTSMNMDFKFELTFFELVYMG----KPRLLTKC--LQGGYDQWRLYLK 577
            +F  +V YTD        ++ +L   + +       KP   TK   LQ G + W+    
Sbjct: 232 DKFRLIVLYTDTDEHTKYYWQ-QLEVLQDILCNRSFDKPLHHTKVIVLQNGVNAWKEKYP 290

Query: 578 TNTKSI-HAKISDFMWRA---NFLGRDTSVSDHNPFRXXXXXXXXXXXXXXXXXXXXXXX 633
              K I  + ISD   +    NF     ++S++N                          
Sbjct: 291 MELKKIMESAISDIRTKPVEHNF--HPMALSNNNNIEKANSP------------------ 330

Query: 634 XYISSPRPVPFIPLQQPSLSLLHTSANIVKPGKA--ELRNELSRITGQIDHTQYNQPEKY 691
              S  +   F     P    L   A+I   G    +L    S +T  +        E Y
Sbjct: 331 ---SHSQTTSFT--HYPDAPFLTNGASIKTAGLVPNQLLPSTSNLTKALQQNDEGNSEPY 385

Query: 692 RYLPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNM 751
           +  P+       I+    +    + G     SS  + SV     +P+  +  +I GL N+
Sbjct: 386 KLQPNG------IKNHRQESNNHANGTNCIVSSNGNNSVAK-SGHPSINLDFAI-GLVNL 437

Query: 752 SNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKKMYMNG- 806
            N+CY+N ++QCL    E   +FL+N Y +++    +  +   ++  F  L +KMY  G 
Sbjct: 438 GNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFSQLVQKMYQQGK 497

Query: 807 ----------GCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA- 855
                       +V P+ F   C  +   L     QQD Q              +     
Sbjct: 498 LQAYNNTNMESTAVHPTQFKLACGSIN-SLFKGKQQQDCQEFCQFLLDGLHEDLNQCGTN 556

Query: 856 --VVNDYPQL-LLHESSVLKVNDK-EYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRC 911
             +    P+   + E+  +++    E+  +   +F     S I  +FQGQ   QL C+ C
Sbjct: 557 PPLKELSPEAEKMRETMPMRIASAIEWERYLTTDF-----SVIVDLFQGQYASQLRCKIC 611

Query: 912 DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVN 971
             +S +Y  F VLS+ +P        +A+   + DC   FT  E L     W CP C   
Sbjct: 612 AHTSTTYQAFSVLSVPVP--------RARSCTIYDCFKEFTKLETLEKDELWYCPYCKQR 663

Query: 972 SSGDRQM 978
               +Q+
Sbjct: 664 QPSTKQI 670

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 65/146 (44%), Gaps = 37/146 (25%)

Query: 1045 TIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI-----------VLKNNEVA 1093
            + K +    LP  LIIHL RF  ++  KNN  V YP  L++           + K+N V+
Sbjct: 666  STKQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVS 724

Query: 1094 ----------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDP 1143
                       YRL++  +H GTL  GHYTS V+K        G+  W  FDD   +   
Sbjct: 725  LPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDDVSWRKIR 776

Query: 1144 NHGNYDRGITSVSSSDVYLLFYERIS 1169
                Y        + + Y+LFY R++
Sbjct: 777  RKDEY-------ITPNAYVLFYRRVN 795

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 110/271 (40%), Gaps = 20/271 (7%)

Query: 719 LSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNK 778
           LS  SS  H        + N  +  ++ GL N+ N+CY+N ++QC+  T E   +FL + 
Sbjct: 537 LSNSSSLDHIDASQTSSSRNYDLDFAV-GLENLGNSCYMNCIIQCILGTHELTQIFLDDS 595

Query: 779 YSRYL--------KSSNMDNMSRSFYMLFKKMYMNGGC-SVVPSGFLKMCSYLKPDLRIP 829
           Y++++        K       +R  +M++KK   +    S+ P  F   C  +    +  
Sbjct: 596 YAKHININSKLGSKGILAKYFARLVHMMYKKQVDSSKKDSISPIKFKLACGSVNSLFKTA 655

Query: 830 HGQQDTQXXXXXXXXXXXXXXSYLAA--VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFE 887
             QQD Q              +   +   + +  Q        L +       W  + F 
Sbjct: 656 -SQQDCQEFCQFLLDGLHEDLNQCGSNPPLKELSQEAETRRERLSLRIASSIEW--ERFL 712

Query: 888 KNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDC 947
               S I  +FQGQ   +L C+ C+ +S +Y  F VLS+ +P   S+      K+ +EDC
Sbjct: 713 TTDFSVIVDLFQGQYASRLKCKTCNHTSTTYQPFTVLSIPIPKKNSQ-----NKITIEDC 767

Query: 948 INFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
              FT  E L     W CP C       +Q+
Sbjct: 768 FKEFTKCENLEIDEQWLCPHCEKRQPSTKQL 798

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 68/150 (45%), Gaps = 37/150 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV-------------- 1086
            K+  + K L    LPR LIIHL RF  +L  KNN  V YP +L++               
Sbjct: 790  KRQPSTKQLTITRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPG 848

Query: 1087 LKNNEVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
            + ++E+         KY LY    HFGTL  GHYTS V K L        + W YFDD  
Sbjct: 849  VNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGLS-------RGWLYFDDTK 901

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             +   N        T   +S+ Y+LFY R+
Sbjct: 902  YRPAKNQ-------TDAINSNAYVLFYHRV 924

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 11/79 (13%)

Query: 464 QDRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERSAPITSVNEFERRLDN 517
           Q   L ID+R    ++ +HI  +++I ++P+         D E+ + ITS N+     + 
Sbjct: 206 QMETLLIDIRSRLEFKKSHIDFKNIICLEPISFKTSYSDRDLEKKSLITSPND-----EI 260

Query: 518 PLFTTRGQFSYLVCYTDNH 536
            LF +R  F +++ YTD++
Sbjct: 261 KLFQSRNLFKFIILYTDSN 279

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 104/263 (39%), Gaps = 39/263 (14%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-------MSRSFYM 797
           I GL N  N CY+N +LQCL  T +   +FL N Y  ++   N D+       ++++F  
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFI---NFDSSKGSKGLLAKNFAT 501

Query: 798 LFKKMYMNGGCSVVPS--------GFLKMCSYLKPDLRIPHGQQDTQXXXX------XXX 843
           L + M+ N     V S         F K+C ++   +     QQD Q             
Sbjct: 502 LVRNMHRNSAFMPVNSRTTPVQTIQFKKICGHIN-SIYSDSMQQDCQEFCQFLLDGLHED 560

Query: 844 XXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIE 903
                   +L  +  +  Q    +   + +       W  + F     S I  +FQGQ  
Sbjct: 561 LNQNGGKEHLKQLTEEEEQ----KREKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYA 614

Query: 904 HQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPW 963
            +L CQ CD +S +Y TF VLS+ +P        +     + DC   FT  E L     W
Sbjct: 615 SRLQCQACDRTSTTYQTFSVLSVPVP--------RITTCNILDCFREFTKCEKLGIDELW 666

Query: 964 DCPKCGVNSSGDRQMNSEKSKRK 986
            CP+C       +Q+   +  +K
Sbjct: 667 SCPRCLKKQPSTKQLKITRLPKK 689

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 70/150 (46%), Gaps = 34/150 (22%)

Query: 1038 RYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI-----------V 1086
            R  KK  + K L    LP+ LII+L RF   + K NN  V YP  L++            
Sbjct: 670  RCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHEA 728

Query: 1087 LKNNEVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
            + N ++         +YRLY    H G+L  GHYTS V K         K+ WY+FDD I
Sbjct: 729  IVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSI 781

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             +  P   N D  IT     + Y+LFYERI
Sbjct: 782  YR--PIRFN-DEFIT----PNAYVLFYERI 804

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 465 DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEF-ERRLDNPLFTTR 523
           D +L ID+RP   +   HI  +++I I+P+   D+     + +V+     + D  LF+ R
Sbjct: 161 DTLLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENVSLITSSQSDIDLFSNR 220

Query: 524 GQFSYLVCYTD 534
             F Y+V YTD
Sbjct: 221 NMFKYIVLYTD 231

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 106/259 (40%), Gaps = 31/259 (11%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN----MSRSFYMLFK 800
           I GL NM N CY+N +LQCL  T +   +FL N Y  ++   N       +++++  L  
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKGLLAKNYATLVH 522

Query: 801 KMYMNGG--------CSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSY 852
            M+ +G           V    F K+C ++   +     QQD Q              + 
Sbjct: 523 NMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN-SIYSDSMQQDCQEFCQFLLDGLHEDLNQ 581

Query: 853 LAAV-----VNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLS 907
                    +++  + +    S+ K +  E+  +   +F     S I  +FQGQ   +L 
Sbjct: 582 NGGKKHLKQLSEQEERMRESMSIRKASALEWERFLLTDF-----SAIIDLFQGQYASRLQ 636

Query: 908 CQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPK 967
           CQ C+ +S +Y TF VLS+ +P        + +   + DC   FT  E L     W C K
Sbjct: 637 CQACEHTSTTYQTFSVLSVPVP--------RIRTCNILDCFREFTKCEKLGVDEQWSCSK 688

Query: 968 CGVNSSGDRQMNSEKSKRK 986
           C       +Q+   +  +K
Sbjct: 689 CLKKQPSTKQLKITRLPKK 707

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 69/148 (46%), Gaps = 36/148 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV-----------LKN 1089
            KK  + K L    LP+ LII+L RF   + K NN  V YP  L++            + N
Sbjct: 691  KKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNHESIVN 749

Query: 1090 NEVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQK-WYYFDDEIVK 1140
             ++         +YRLY    H G+L  GHYTS V K        G QK WY+FDD +  
Sbjct: 750  EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYK--------GPQKGWYFFDDSVYC 801

Query: 1141 LDPNHGNYDRGITSVSSSDVYLLFYERI 1168
              P   N D  IT     + Y+LFYERI
Sbjct: 802  --PIRFN-DEFIT----PNAYVLFYERI 822

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 17/102 (16%)

Query: 467 VLFIDLRPPKRYELNHIVARHLINIDPLLLWDT---ERSAPITSVNEFERRLDNPLFTTR 523
           +L ID+RP   +   HI  +++I I+P+   D+   ++   I+     +  +D  LF+ R
Sbjct: 179 ILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEID--LFSNR 236

Query: 524 GQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLTKCL 565
             F Y+V YTD  T +  DF          +  + R+LTK L
Sbjct: 237 DTFKYIVLYTD--TQLYGDF----------HQRQTRILTKIL 266

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 110/274 (40%), Gaps = 29/274 (10%)

Query: 729 SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNM 788
           S P I+ +   +    I GL NM N CY+N +LQCL  T +   +FL N Y  ++   NM
Sbjct: 412 SKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFDNM 471

Query: 789 DN----MSRSFYMLFKKMYMNGGCSVVPS--------GFLKMCSYLKPDLRIPHGQQDTQ 836
                 ++++F  L   M+ +G    + S         F K C ++   +     QQD Q
Sbjct: 472 RGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHIN-SIYSDSMQQDCQ 530

Query: 837 XXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSV---LKVNDKEYTTWFDQNFEKNGLSP 893
                         +          QL   E      + +       W  + F     S 
Sbjct: 531 EFCQFLLDGLHEDLNQNGG-KKHLKQLSEEEERTRENMSIRKASALEW--ERFLLTDFSA 587

Query: 894 IDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFT- 952
           +  +FQGQ   +L CQ C+ +S +Y TF VLS+ +P        +     + DC   FT 
Sbjct: 588 VIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVP--------RIMTCNVLDCFREFTK 639

Query: 953 CDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRK 986
           C+++  G+  W C +C       +Q+   +  +K
Sbjct: 640 CEKLGIGEQ-WSCSRCLKKQPSTKQLKITRLPKK 672

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 68/151 (45%), Gaps = 36/151 (23%)

Query: 1038 RYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLK-----NNEV 1092
            R  KK  + K L    LP+ LII+L RF   +  KNN  V YP  L++        N+E 
Sbjct: 653  RCLKKQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWARDFNHEA 711

Query: 1093 A--------------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQK-WYYFDDE 1137
                           +YRLY    H G+L  GHYTS V K        G QK WY+FDD 
Sbjct: 712  IIDEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYK--------GPQKGWYFFDDT 763

Query: 1138 IVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
            I +L        R      + + Y+LFYERI
Sbjct: 764  IYRL-------IRFNNEFITPNAYVLFYERI 787

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 465 DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVN-EFERRLDNPLFTTR 523
           D  L +D+RP   +   HI  +H++ IDP    D+     +  V+     +L+  LF+ R
Sbjct: 163 DAFLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVSLAASPQLEIELFSKR 222

Query: 524 GQFSYLVCYTDNHTSMNMDFK 544
             F  +V YTD  T +  DF+
Sbjct: 223 NTFKNIVLYTD--TQLQGDFQ 241

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 100/244 (40%), Gaps = 19/244 (7%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
            GL N+ N+CY+N ++QC+  T E   +FL + Y++++    K  +   +++ F  L   
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 802 MY---MNGG--CSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA- 855
           MY   ++G    S+ P  F   C  +    +    QQD Q              +   + 
Sbjct: 622 MYKEQVDGSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 856 -VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFS 914
             + +  Q        L +       W  + F     S I  +FQGQ   +L C+ C  +
Sbjct: 681 PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKVCSHT 738

Query: 915 SYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSG 974
           S +Y  F VLS+ +P   S+       + +EDC   FT  E L     W CP C      
Sbjct: 739 STTYQPFTVLSIPIPKKNSR-----NNITIEDCFREFTKCENLEVDEQWLCPHCEKRQPS 793

Query: 975 DRQM 978
            +Q+
Sbjct: 794 TKQL 797

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 69/150 (46%), Gaps = 37/150 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV-------------- 1086
            K+  + K L    LPR LI+HL RF  +L  KNN  V YP +L++               
Sbjct: 789  KRQPSTKQLTITRLPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPG 847

Query: 1087 LKNNEVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
            + ++E+         KY LY    HFGTL  GHYT+ V K L       K+ W YFDD  
Sbjct: 848  VNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDD-- 898

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             K  P     D       +S+ Y+LFY R+
Sbjct: 899  TKYKPVKNKAD-----AINSNAYVLFYHRV 923

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 11/77 (14%)

Query: 464 QDRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERSAPITSVNEFERRLDN 517
           Q  +L ID+R    +  +HI  +++I ++P+         D E+ + ITS N      + 
Sbjct: 206 QMEILLIDIRSRLEFNKSHIDTKNIICLEPISFKMSYSDHDLEKKSLITSPNS-----EI 260

Query: 518 PLFTTRGQFSYLVCYTD 534
            +F +R  F +++ YTD
Sbjct: 261 KMFQSRNLFKFIILYTD 277

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 74.7 bits (182), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 100/251 (39%), Gaps = 19/251 (7%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
            GL N+ N+CY+N ++QC+  T E   +FL + Y++++    K  +   +++ F  L   
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 802 MY-----MNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA- 855
           MY      +   S+ P  F   C  +    +    QQD Q              +   + 
Sbjct: 622 MYKEQVDASKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 856 -VVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFS 914
             + +  Q        L +       W  + F     S I  +FQGQ   +L C+ C  +
Sbjct: 681 PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKICGHT 738

Query: 915 SYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSG 974
           S +Y  F VLS+ +P    +      ++ +EDC   FT  E L     W CP C      
Sbjct: 739 STTYQPFTVLSIPIPRKVPQ-----NEITIEDCFKEFTKCENLEVDEQWLCPHCKKRQPS 793

Query: 975 DRQMNSEKSKR 985
            +Q+   +  R
Sbjct: 794 TKQLTVTRLPR 804

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 73/150 (48%), Gaps = 37/150 (24%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV-------------- 1086
            K+  + K L    LPR LIIHL RF  +L  KNN  V YP +L++               
Sbjct: 789  KRQPSTKQLTVTRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPG 847

Query: 1087 LKNNEVA--------KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
            + ++E+         KY LY    HFGTL  GHYT+ V K L    R+G   W YFDD  
Sbjct: 848  VNDDELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL----RKG---WLYFDD-- 898

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             K  P      +  T V++S+ Y+LFY R+
Sbjct: 899  TKFKP-----VKNKTDVTNSNAYVLFYHRV 923

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 11/77 (14%)

Query: 464 QDRVLFIDLRPPKRYELNHIVARHLINIDPLLL------WDTERSAPITSVNEFERRLDN 517
           Q   L ID+R    ++ +HI ++++I ++P+         D E+ + ITS N      + 
Sbjct: 206 QMETLLIDIRSRLEFDKSHIASKNIICLEPISFKISYSDHDLEKKSLITSPNN-----EI 260

Query: 518 PLFTTRGQFSYLVCYTD 534
            LF +R  F +++ YTD
Sbjct: 261 KLFQSRNLFKFIILYTD 277

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 114/285 (40%), Gaps = 46/285 (16%)

Query: 719 LSAGSSEAHF---SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           +S+ SS A++   S P   +N N  +     GL N+ N+CY+N ++QCL  T E   +FL
Sbjct: 470 VSSQSSVANYQNGSKPLTRRNTNFTV-----GLTNLGNSCYMNCIIQCLLGTHELTQIFL 524

Query: 776 SNKYSRYL----KSSNMDNMSRSFYMLFKKMYMNGG-----------CSVVPSGFLKMCS 820
            + Y  ++    K  +   +++ F  L   M                 +V P  F   C 
Sbjct: 525 DDSYKNHVNLNSKLGSKGVLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQPLHFKVACG 584

Query: 821 YLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLK-------V 873
            +    R    QQD Q              +      N   + L  E+  ++        
Sbjct: 585 SINSLFR-SSSQQDCQEFCQFLLDGLHEDLNQCGG--NPALKELSEEAEGIREKLCMRIA 641

Query: 874 NDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGS 933
           +  E+  +   +F     S I  +FQGQ   QL+C+ C  +S +Y  F VLS+ +P+ GS
Sbjct: 642 SSIEWERYLTTDF-----SVIVDLFQGQYASQLTCKVCGRTSTTYQPFSVLSVPVPS-GS 695

Query: 934 KAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           K         + DC   FT  E L     W CP+C       +++
Sbjct: 696 KC-------DIIDCFKEFTKVETLEKDEQWSCPRCKCKQPSTKKI 733

 Score = 62.4 bits (150), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 65/150 (43%), Gaps = 35/150 (23%)

Query: 1038 RYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV-LKNNE----- 1091
            R   K  + K +    LPR L+IHL RF  +L  KNN  V+YP  L++     N+     
Sbjct: 722  RCKCKQPSTKKITITRLPRNLVIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWANDFDGRL 780

Query: 1092 ---VAK-----------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE 1137
               VA+           Y LY+   HFGTL  GHYTS V+K         K  W YFDD 
Sbjct: 781  PPGVAELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDT 833

Query: 1138 IVKLDPNHGNYDRGITSVSSSDVYLLFYER 1167
              +   + G          +   Y+LFY R
Sbjct: 834  SWRKAKSQGE-------CITLSAYVLFYHR 856

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 16/117 (13%)

Query: 467 VLFIDLRPPKRYELNHIVARHLINIDPLLLWDT------ERSAPITSVNEFERRLDNPLF 520
            L IDLRP  ++  +HI    ++ I+P+   D+       R + ITS NE     +  LF
Sbjct: 178 ALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRRSLITSPNE-----EVQLF 232

Query: 521 TTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVY---MGKP--RLLTKCLQGGYDQW 572
             R +F Y+V YTD H       + + +  +L+      KP  R +   LQGG++ W
Sbjct: 233 QERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTIILTLQGGFENW 289

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 94/252 (37%), Gaps = 47/252 (18%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKK 801
            GL N+ N+CY+N ++QCL  T E   +FL++ Y  ++    K  +   +++ F  L   
Sbjct: 523 VGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHN 582

Query: 802 MYMNGGC----------------SVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXX 845
           MY                     +V P  F   C  +    R    QQD Q         
Sbjct: 583 MYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFR-DCSQQDCQEFCQFLLDG 641

Query: 846 XXXXXSYLAAVVNDYPQLLLHESSVLKVNDK---------EYTTWFDQNFEKNGLSPIDS 896
                +         P+L        K+ +K         E+  +   +F     S I  
Sbjct: 642 LHEDLNQCGG----NPRLKELSEEAEKIREKLSMRIASSIEWERYLTTDF-----SVIVD 692

Query: 897 IFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEV 956
           +FQGQ   QL CQ C  +S +Y  F VLS+ LP+         K   + DC   FT  E 
Sbjct: 693 LFQGQYASQLKCQVCGRTSTTYQPFSVLSVPLPS--------LKSCNILDCFQEFTKVET 744

Query: 957 LTGQNPWDCPKC 968
           L     W CP C
Sbjct: 745 LEKDEQWSCPDC 756

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 67/148 (45%), Gaps = 35/148 (23%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI--------------- 1085
            K+  + K +    LPR LIIHL RF  ++  KNN  V+YP  L++               
Sbjct: 758  KRQPSTKKITITRLPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPG 816

Query: 1086 ---VLKNNEVA--KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
               +    +V    Y+LY+  +H GTL  GHYT+ V+K  Q       + W YFDD    
Sbjct: 817  VTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKGSQ-------RGWCYFDD---- 865

Query: 1141 LDPNHGNYDRGITSVSSSDVYLLFYERI 1168
                +    R      +S+ Y+LFY R+
Sbjct: 866  ---TNWRRSRSDNECITSNAYVLFYHRV 890

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 16/92 (17%)

Query: 449 SIKCSDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT------ERS 502
           +I C  L  ++ +     VL IDLRP   +  +HI +  +I I+P+   DT       + 
Sbjct: 161 TIACQHLQNLMAAS---SVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKK 217

Query: 503 APITSVN-EFERRLDNPLFTTRGQFSYLVCYT 533
           + ITS N E E      LF+ R  F ++V YT
Sbjct: 218 SMITSPNCEIE------LFSKRDTFQFIVLYT 243

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 103/254 (40%), Gaps = 34/254 (13%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNM--SRSFYML-FKK 801
           I GL NMSN+CY+N ++QCL S  E   + L+N +   LK  NM++   S+   M  F K
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSF---LKHINMESKLGSKGVIMKHFAK 484

Query: 802 MYMNGGCSVVPSG------------FLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXX 849
           +  +     V +G            F   C+ +   +     QQD Q             
Sbjct: 485 LIQDMHSQQVKTGRSLFSYPVKTIDFKNACASVS-SIYSGSQQQDCQEFCEFLLDGLHED 543

Query: 850 XSYL-----AAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEH 904
            +       A  + D  + L  E   ++V       W  +NF  N  S I  +F GQ   
Sbjct: 544 LNQCGGNPPARELTDQEERL-REGLCMRVASS--MAW--ENFLHNNFSLIIDLFAGQYGS 598

Query: 905 QLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWD 964
           QL C  C ++S +Y  F +LS+ +P        +  +  + DC   FT  E L     W 
Sbjct: 599 QLRCCVCQYTSTTYQPFTLLSVPVP-----LSSRVSRCSIIDCFQEFTKCERLDKDEEWF 653

Query: 965 CPKCGVNSSGDRQM 978
           CP+C       +Q+
Sbjct: 654 CPQCKRKQPSTKQL 667

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 67/153 (43%), Gaps = 43/153 (28%)

Query: 1041 KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNI--------------- 1085
            +K  + K L    LP+ LIIH  RF  ++  KNN  + YP  L++               
Sbjct: 659  RKQPSTKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLG 717

Query: 1086 -----VLKNNEVA--KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD-- 1136
                 + K  +V   KY+L +   H GTL SGHYT+ VNK            WYYFDD  
Sbjct: 718  MTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNKG-------PDVGWYYFDDSS 770

Query: 1137 -EIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
              IVK+   + N           D YLLFY R+
Sbjct: 771  HRIVKIATEYMN----------PDAYLLFYHRV 793

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 461 SDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLL---WDTERSAPITSVNEFERRLDN 517
           SD +  VL ID+R    +E +HI +  ++ +DP+     +  ++   I+ +N     L  
Sbjct: 170 SDQKISVLLIDVRKRYEFEFSHINSVAVLPLDPISFKPTYTIDQLEKISFINSPMHELQ- 228

Query: 518 PLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFEL--------------VYMGKPRLLTK 563
            LF  R ++  +V YT ++      +K  ++   +                +  P++L  
Sbjct: 229 -LFQKRNEYDVIVLYTKDNDITAYYYKQMMSLLAILLNHLHHHHHHHHHHNIKYPKILF- 286

Query: 564 CLQGGYDQW 572
            L+GG+ +W
Sbjct: 287 -LKGGFSEW 294

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 117/316 (37%), Gaps = 54/316 (17%)

Query: 694 LPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSN 753
            P  ++SP P+     K T  S G L   S  +      +  N          GL N+ N
Sbjct: 18  FPSYKKSPSPL-----KETTLSSGPLQNHSMNSSLVKRGLNIN---------VGLVNLGN 63

Query: 754 TCYINSMLQCLFSTTEFRNLFLSNKYSRYL----KSSNMDNMSRSFYMLFKKMYM----- 804
           +CY+N ++QCL  T E   +FL + Y  ++    +  +   +++ F  L   M       
Sbjct: 64  SCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNMQQQAISA 123

Query: 805 --------NGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAV 856
                   N   +V P  F   C  +    +    QQD Q              +     
Sbjct: 124 SGRKSTSGNERNAVQPLHFKVACGSINSLFKTT-SQQDCQEFCQFLLDGLHEDLNQCGG- 181

Query: 857 VNDYPQLLLHESSVLK-------VNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQ 909
            N   + L  E+  ++        +  E+  +   +F     S I  +FQGQ   QL C+
Sbjct: 182 -NPALKELSEEAEAIREKLCMRIASSIEWERYLTTDF-----SVIVDLFQGQYASQLMCK 235

Query: 910 RCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCG 969
            C  +S +Y  F VLS+ +P        +  +  L DC   FT  E L     W CP+C 
Sbjct: 236 VCGRTSTTYQPFSVLSVPVP--------RGARCNLLDCFEEFTKIETLEKDEQWSCPRCK 287

Query: 970 VNSSGDRQMNSEKSKR 985
           V     +++   +  R
Sbjct: 288 VKQPSTKKITITRLPR 303

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 68/150 (45%), Gaps = 35/150 (23%)

Query: 1038 RYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV-LKNNE----- 1091
            R   K  + K +    LPR LIIHL RF  +L  KNN  V+YP  L++     N+     
Sbjct: 285  RCKVKQPSTKKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGSL 343

Query: 1092 ---VAK-----------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE 1137
               VA+           Y LY+   HFGTL  GHYT+ VNK       E K  W YFDD 
Sbjct: 344  PKGVAELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNK-------EDKNGWCYFDDT 396

Query: 1138 IVKLDPNHGNYDRGITSVSSSDVYLLFYER 1167
              +   +    D  IT    +  Y+LFY R
Sbjct: 397  CWRKAKSE---DECIT----TSAYVLFYHR 419

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 96/240 (40%), Gaps = 29/240 (12%)

Query: 737 PNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN--------M 788
           PN      I G++N  N CY+N ++QCL    EF N FL N Y   +  ++        +
Sbjct: 335 PNYTSPTVIKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVV 394

Query: 789 DNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXX 848
            N ++     F+    N   +V  + F +  + L P+    + Q D              
Sbjct: 395 KNWAKIIQAFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHE 453

Query: 849 XXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSC 908
             ++        PQ   +  + ++V+D     W    + K   S I   F+GQI+ QL+C
Sbjct: 454 DSNW------GRPQ---NSDAAMQVDDYR-EAW--NLYRKGNSSYIVDTFKGQIKSQLTC 501

Query: 909 QRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKC 968
           Q C   S +Y  F +L+L +P              + DC+       VLTG + W C  C
Sbjct: 502 QVCQTQSNNYEPFSILNLPIP--------LVSMCHIYDCMKELFKVHVLTGDDRWYCSTC 553

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 56/118 (47%), Gaps = 20/118 (16%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAK----YRLYSTINHFGTLIS 1109
            +P +LIIH +RF  +L  K    V YP +L++   N  + K    Y+L +   H GTL S
Sbjct: 568  VPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLFS 626

Query: 1110 GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYER 1167
            GHYT+   K+        +  WY+FDD   K   N            S   YLLFY++
Sbjct: 627  GHYTAYCFKN-------SENGWYHFDDTQCKPVSN--------GECISQSAYLLFYQK 669

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 61/146 (41%), Gaps = 35/146 (23%)

Query: 1041 KKL-ATIKSLNFITLPRILIIHLSRFV--YDLTKKNNTVVTYPLI--------------- 1082
            KKL    + +   + P IL++HL RF   Y  T K N  V +PL                
Sbjct: 960  KKLRQATRQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDG 1019

Query: 1083 LNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD-EIVKL 1141
                        Y L +  NHFG L SGHYT+ V   +         KWY FDD E+ ++
Sbjct: 1020 DGDGDDGGRENVYDLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVREV 1072

Query: 1142 DPNHGNYDRGITSVSSSDVYLLFYER 1167
            D           SV+SS  YLLFY R
Sbjct: 1073 DAE---------SVASSFGYLLFYRR 1089

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 8/97 (8%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNM----DNMSRSFYMLFKKM 802
           GL N+ +TC+INS+LQCL   TE R+ FL N ++  L + N       ++ +F  + + +
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVAGAFAEVVQAL 411

Query: 803 YMNGGC---SVVPSGFLKMCSYLKPDLRIPHGQQDTQ 836
           + +      +   S F     Y +P L  P+ QQD+ 
Sbjct: 412 FGDKIAQFPTYAASNFRATIGYFRPALG-PYVQQDSH 447

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 934 KAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           +A  + ++  LEDC++ FT  EVL   + W CP C       RQ+
Sbjct: 925 RAGRQKQETTLEDCLDLFTAPEVLNTADSWYCPACKKLRQATRQI 969

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 87/221 (39%), Gaps = 63/221 (28%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFK 800
           ITGL N+ NTCY+NS LQCL    E R+ FL + ++  + S N      N++++F +L K
Sbjct: 301 ITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSLLVK 360

Query: 801 KMYMNGGCSVVPSGF----LKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAV 856
            ++     S     F     KM       +   + QQD+Q               +LA +
Sbjct: 361 SLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYMQQDSQ--------------EFLAFL 406

Query: 857 VNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSP----------------------- 893
           ++      LHE  + +V+DK Y        EK  LSP                       
Sbjct: 407 LDG-----LHE-DLNRVHDKPY-------IEKPSLSPNSDVTDRDTIKKLAEDTWKMHLL 453

Query: 894 -----IDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALP 929
                +  +F    E  L C  C   S ++  +  L+L LP
Sbjct: 454 RNDSIVTDLFVALYESTLECPECRNVSITFDPYNDLTLPLP 494

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 26/129 (20%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYP-----LILNIVLKNNEVAKYRLYS 1099
            K +   + P +L+IHL RF      + K +  V +P     +  ++V ++   + Y L +
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 1100 TINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD-EIVKLDPNHGNYDRGITSVSSS 1158
              NHFG L  GHYT+ V  +          KW+YFDD  + +  P         +S++ S
Sbjct: 964  VDNHFGGLGGGHYTAYVKTN---------DKWFYFDDSRVTETKPE--------SSIAGS 1006

Query: 1159 DVYLLFYER 1167
              YLLFY R
Sbjct: 1007 -AYLLFYLR 1014

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 934 KAFGKAKK-LRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           +A G+ K+ + L DC+  F+  EVL+  + W CP C  +    +Q+
Sbjct: 861 EAEGQEKRAISLHDCLKLFSKKEVLSMNDSWYCPTCKDHRQATKQI 906

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 85/199 (42%), Gaps = 25/199 (12%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-------MSRSFYMLF 799
           GL N+ NTCY+NS LQCL    + R+ FL   Y  + K  N+DN       ++RSF +L 
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFL---YKVFEKEINLDNPLGYQGHVARSFAILI 399

Query: 800 KKMYMNG---GCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLA-A 855
           + ++ +      S  P+ F     +    +   + QQD+Q              + +   
Sbjct: 400 QNLFKDELLPSLSYSPTTFKSTVGHFNS-MFSGYLQQDSQEFIAFLLDGLHEDLNRITNK 458

Query: 856 VVNDYPQL-----LLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQR 910
            V + P L     + ++  + K+ D    TW       + +  I  IF G  +  L C  
Sbjct: 459 PVVEKPSLKPEDDVSNQEVIKKLADD---TWNSHLLRNDSI--ITDIFVGLYKSTLHCPE 513

Query: 911 CDFSSYSYSTFYVLSLALP 929
           CD  S ++  +  L+L LP
Sbjct: 514 CDNLSVTFDPYNDLTLPLP 532

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 64/132 (48%), Gaps = 25/132 (18%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLI---LNIVLKNNEVAK---YRLY 1098
            K L   + P IL+IHL RF      + K +  V +P+    L+  + NN+ +K   Y L 
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLV 1002

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVSS 1157
            S  NH+G L  GHYT+ V   +        +KWYYFDD  + +  P     +R I    +
Sbjct: 1003 SVDNHYGGLGGGHYTAYVKNFVD-------KKWYYFDDSRVTETVP-----ERSI----A 1046

Query: 1158 SDVYLLFYERIS 1169
               YLLFY R S
Sbjct: 1047 GSAYLLFYMRRS 1058

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 940 KKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           KK+ L+DC+N F   EVL   + W CP C  +    +Q+
Sbjct: 907 KKITLDDCLNLFAKKEVLGMNDSWYCPTCKEHRQATKQL 945

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 84/202 (41%), Gaps = 22/202 (10%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFK 800
           ITGL N+ NTCY+NS LQCL    E R+ FL N +   +  +N       ++R+F  L +
Sbjct: 292 ITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSGLVQ 351

Query: 801 KMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDY 860
            ++   GC  + SG     +Y     +   G  ++                 L  +  D 
Sbjct: 352 NLF---GCKTLSSGSTLTPAYSPTGFKSTIGHFNSMFSGYMQQDSQEFITFLLDGLHEDL 408

Query: 861 PQLL----LHESSVLKVNDKE---------YTTWFDQNFEKNGLSPIDSIFQGQIEHQLS 907
            +++    + + S+   +D             TW   + ++N  S I  +F G  E  L 
Sbjct: 409 NRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTW-KLHLQRND-SVITDLFVGLYESTLQ 466

Query: 908 CQRCDFSSYSYSTFYVLSLALP 929
           C  C+  S ++  +  L+L LP
Sbjct: 467 CPECNNVSITFDPYNDLTLPLP 488

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 60/130 (46%), Gaps = 25/130 (19%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLI---LNIVLKNNEVAK---YRLY 1098
            K +     P +L+IHL RF  +   + K + VV +P+    ++  L N    +   Y L 
Sbjct: 914  KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLV 973

Query: 1099 STINHFGTLISGHYTSLV-NKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSS 1157
            +  NH+G L  GHYT+   N D          KWYYFDD  V         +RGI    +
Sbjct: 974  AVDNHYGGLGGGHYTAYAKNVD--------DSKWYYFDDSRV----TETTPERGI----A 1017

Query: 1158 SDVYLLFYER 1167
            S  YLLFY R
Sbjct: 1018 SSAYLLFYVR 1027

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 938 KAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           + KK+ L DC+  F+  EVL   + W CP C  +    +Q+
Sbjct: 876 EEKKITLHDCLKLFSKREVLGMNDSWYCPSCKEHRQATKQI 916

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 97/237 (40%), Gaps = 38/237 (16%)

Query: 710 KHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTE 769
           K  E+ + WLS        S P+            I GL N+ N+CY+NS LQCL    E
Sbjct: 273 KGVEKDQHWLSNYYYYNKLSPPS-----------GIVGLSNLGNSCYMNSALQCLVHIPE 321

Query: 770 FRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFKKMYMNGGCSV---VPSGFLKMCSYL 822
            R+ FL   + + + +SN       ++++F  L K ++ +   ++    P  F  +  + 
Sbjct: 322 LRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALVKSLFDDKASALQAFSPRAFKSIIGHH 381

Query: 823 KPDLRIPHGQQDTQXXXXXXXXXXXXXXS-YLAAVVNDYPQLLLHESSVLKVNDKEYT-- 879
              +     QQD+Q              +  +     + P+L    +S   VND +    
Sbjct: 382 N-GMFAGFLQQDSQELLAFLLDGLHEDLNRIMKKPFVEKPEL----ASSDDVNDIDVIRN 436

Query: 880 ----TWFDQNFEKNGL---SPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALP 929
               TW     EK+ L   S I  +F G  +  L+C  CD  S ++  F  L+L LP
Sbjct: 437 LASLTW-----EKHKLRNESVIVDLFVGLYKSTLTCPACDRVSVTFDPFSDLTLPLP 488

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 1047 KSLNFITLPRILIIHLSRFV--YDLTKKNNTVVTYPLI-----LNIVLKN-NEVAKYRLY 1098
            K +     P IL IHL RF   +  + K + VV +P+       ++V  + N+ + Y L 
Sbjct: 906  KQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSMYDLI 965

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSS 1158
            +  NH+G L  GHYT+ V   +         KWYYFDD  V    +    +R I+  +  
Sbjct: 966  AVDNHYGGLGGGHYTAYVKNFMD-------GKWYYFDDSRV----SETEAERAISGAA-- 1012

Query: 1159 DVYLLFYER 1167
              YLLFY R
Sbjct: 1013 --YLLFYRR 1019

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 103/262 (39%), Gaps = 62/262 (23%)

Query: 709 PKHTERSRGWLSAGSSEAHFSVPTIEKN---PNEYIALS-------ITGLRNMSNTCYIN 758
           P   E     +++  S+    +  IE N   P+ Y A +        TGL N+ NTCY+N
Sbjct: 317 PDMFENRLDKITSNPSDLVIEIKPIEGNHHWPSNYFAYNKLEPASGTTGLVNLGNTCYMN 376

Query: 759 SMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFKKMY------MNGGC 808
           S LQCL    + R+ FL + Y   +   N       ++R+F  L +K++      M    
Sbjct: 377 SALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDLVQKLFQNRMSIMQRNA 436

Query: 809 SVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLLHES 868
           +  PS F     +    +   + QQD+Q               +LA +++      LHE 
Sbjct: 437 AFPPSMFKSTIGHFNS-MFSGYMQQDSQ--------------EFLAFLLDS-----LHE- 475

Query: 869 SVLKVNDKEYT------------TW------FDQNFE---KNGLSPIDSIFQGQIEHQLS 907
            + ++  KEYT             W       D  +E   K   S I  +F G  +  L 
Sbjct: 476 DLNRIIKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRNCSVITDLFVGMYKSTLY 535

Query: 908 CQRCDFSSYSYSTFYVLSLALP 929
           C  C   S ++  +  ++L LP
Sbjct: 536 CPECQNVSITFDPYNDVTLPLP 557

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 59/131 (45%), Gaps = 27/131 (20%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD--LTKKNNTVVTYPLILNIVLKNNEVAK-------YRL 1097
            K +     P IL+IHL RF      + K +  V +P I ++ L    V K       Y L
Sbjct: 996  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSRYVVYKDDPRGLIYDL 1054

Query: 1098 YSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVS 1156
            Y+  NH+G L  GHYT+ V             KWYYFDD  + +  P +        S++
Sbjct: 1055 YAVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTETAPEN--------SIA 1099

Query: 1157 SSDVYLLFYER 1167
             S  YLLFY R
Sbjct: 1100 GS-AYLLFYIR 1109

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%)

Query: 937 GKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
            K + + L+DC+  F+  E+L   + W CP C  +    +Q+
Sbjct: 957 AKERTITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQATKQI 998

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1.137
            YJL197W
          Length = 1462

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 63/132 (47%), Gaps = 25/132 (18%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYP-----LILNIVLKNNEVAK-YRLY 1098
            K +     P IL+IHL RF      + K + VV +P     L  +IV  + E +  Y L 
Sbjct: 1104 KQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLI 1163

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKL-DPNHGNYDRGITSVSS 1157
            +  NH+G L  GHYT+ V   +        QKWYYFDD  V L DP          S+S 
Sbjct: 1164 AVDNHYGGLGGGHYTAYVKNFVD-------QKWYYFDDSRVSLADPQR--------SISG 1208

Query: 1158 SDVYLLFYERIS 1169
            S  YLLFY R S
Sbjct: 1209 S-AYLLFYVRRS 1219

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFKKM 802
           GL N+ NTCY+NS LQCL    +F   FL N Y + +   N      N++ +F  L  K+
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGKLIHKL 474

Query: 803 Y 803
           +
Sbjct: 475 F 475

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 934  KAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
            + F K K + L+DC+  F+  E+L  Q+ W CP C  +    +Q+
Sbjct: 1062 QIFEKEKTILLDDCLRLFSKPEILGLQDSWYCPTCKDHRQATKQI 1106

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 54/129 (41%), Gaps = 15/129 (11%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYST 1100
            +S+    LP  L +HL RF Y  TK +N      V YPL L++     N+   KY L   
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 1101 INHFGTLIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSD 1159
            + H G     GHY SL   D           W  FDDE V+        D    S + + 
Sbjct: 664  VVHMGGGPQHGHYVSLCKND--------NFGWLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1160 VYLLFYERI 1168
             Y+LFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++ TEFR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 110/258 (42%), Gaps = 36/258 (13%)

Query: 729 SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN- 787
           S+PT+ +      A  + GL NM +TCY++S+LQCL     F +L +   +  Y K  + 
Sbjct: 126 SIPTLTQ------AHGLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQDP 179

Query: 788 MDNMSRSFYMLFKKMYMNGGCSVVPS-GFLKM--CSYLKPDLRIPHGQQDTQXXXXXXXX 844
           M  MS +   +  + Y  G     P+ G + +  CS+        + QQD          
Sbjct: 180 MKCMSCAIDNIISETY--GNKKTTPNEGLVDILNCSWRVNKNLAGYTQQDAHEFLQFI-- 235

Query: 845 XXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPID----SIFQG 900
                   L  + NDY    +H+++  ++N  ++ T  + N  K  L   +    +IFQG
Sbjct: 236 --------LNQMHNDYKLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLHLCNCLPHTIFQG 287

Query: 901 QIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQ 960
            ++  +SC  C   S +    Y + L+L   G        K  L +C+  F   E L   
Sbjct: 288 FLKSIISCSECKAQSQTTIDPY-MDLSLDVKG--------KSTLYECLESFHRTERL-HD 337

Query: 961 NPWDCPKCGVNSSGDRQM 978
             ++C KC  +   +RQ+
Sbjct: 338 FTYNCKKCNKSQDANRQL 355

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 50/129 (38%), Gaps = 30/129 (23%)

Query: 1037 KRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTK---KNNTVVTYPLILNI-------- 1085
            K+ NK     + L+ + L  I++I L RF + +T    K N  V +PL LN+        
Sbjct: 343  KKCNKSQDANRQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPT 402

Query: 1086 -----------VLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYF 1134
                         K+     Y L   + H GT+  GHY +          +     WY F
Sbjct: 403  PDTDPTNLNEKTNKSTPDMIYELTGIVTHRGTVNEGHYITYT--------KTADGVWYQF 454

Query: 1135 DDEIVKLDP 1143
            +D +V   P
Sbjct: 455  NDSVVMKVP 463

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 742 ALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYM 797
           A   TGL N+ NTCY+NS LQCL    + R+ FL N Y + +   N       ++R+F  
Sbjct: 357 ASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSD 416

Query: 798 LFKKMYMN 805
           L +K++ N
Sbjct: 417 LIQKLFQN 424

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 62/131 (47%), Gaps = 27/131 (20%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLILNIVLKNNEVAK-------YRL 1097
            K +     P IL+IHL RF      + K +  V +P I ++ L  + V K       Y L
Sbjct: 995  KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFP-ITDLDLSEHVVYKDDPRGSIYDL 1053

Query: 1098 YSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD-EIVKLDPNHGNYDRGITSVS 1156
            Y+  NH+G L  GHYT+ V   + +       KWYYFDD  + +  P +        SV+
Sbjct: 1054 YAVDNHYGGLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVPEN--------SVA 1098

Query: 1157 SSDVYLLFYER 1167
             S  YLLFY R
Sbjct: 1099 GS-AYLLFYIR 1108

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 86/206 (41%), Gaps = 34/206 (16%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFKK 801
           TGL N+ NTCY+NS LQCL    + R+ FL N Y   +   N       ++R+F  L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 802 MY------MNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA 855
           ++      M    +  PS F     +    +   + QQD+Q              ++L  
Sbjct: 424 LFHNKLSSMQRNAAFPPSMFKSTVGHFN-SMFSGYMQQDSQ-----------EFLAFLLD 471

Query: 856 VVNDYPQLLLHESSVLKVN---DKEYTTW------FDQNFE---KNGLSPIDSIFQGQIE 903
            +++    ++ ++ + K +   D +   W       D  +E   K   S I  +F G  +
Sbjct: 472 SLHEDLNRIIKKAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRNCSVITDLFVGLYK 531

Query: 904 HQLSCQRCDFSSYSYSTFYVLSLALP 929
             L C  C   S ++  +  ++L LP
Sbjct: 532 STLYCPECKNVSITFDPYNDVTLPLP 557

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 25/130 (19%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLIL-----NIVLKNNEVAK-YRLY 1098
            K +     P IL++HL RF      + K +  V +P+       ++V K++     Y LY
Sbjct: 998  KQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLY 1057

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVSS 1157
            +  NH+G L  GHYT+ V             KWYYFDD  + +  P +        S+S 
Sbjct: 1058 AVDNHYGGLGGGHYTAYVK-------NFADSKWYYFDDSRVTETVPEN--------SISG 1102

Query: 1158 SDVYLLFYER 1167
            S  YLLFY R
Sbjct: 1103 S-AYLLFYIR 1111

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 82/193 (42%), Gaps = 13/193 (6%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFKKM 802
           GL N+ NTCY+NS LQCL    EF++ FL N Y + +   N      +++ +F  + + +
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQAL 406

Query: 803 Y---MNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXS-YLAAVVN 858
           +    +   S  P  F     +L   +   + QQD+Q              +  +     
Sbjct: 407 FGKRHSAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHEDLNRIIEKPYV 465

Query: 859 DYPQLL-LHESSVLKVNDK-EYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSY 916
           + P+L    +++  KV  K    TW       + +  I  +F G  +  L C  C  +S 
Sbjct: 466 EKPELTSTDDTAEFKVIKKLADDTWGKHKLRNDSV--ITDLFVGLYKSTLICPVCKKTSV 523

Query: 917 SYSTFYVLSLALP 929
           ++  +  L+L LP
Sbjct: 524 TFDPYNDLTLPLP 536

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 58/129 (44%), Gaps = 24/129 (18%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLI-LN----IVLKNNEVAK-YRLY 1098
            K +     P IL+IHL RF      + K    V +P+  L+    +V KN +    Y L 
Sbjct: 996  KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLI 1055

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSS 1158
            +  NH+G L  GHYT+ V        +    KWYYFDD  V    +    +R I    + 
Sbjct: 1056 AVDNHYGGLGGGHYTAYV--------KNIDGKWYYFDDSRV----SETLPERSI----AG 1099

Query: 1159 DVYLLFYER 1167
              YLLFY R
Sbjct: 1100 SAYLLFYRR 1108

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 940 KKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           KK+ L DC+  F+  EVL   + W CP C  +    +Q+
Sbjct: 960 KKITLHDCLTLFSTPEVLGATDSWFCPNCKEHRQATKQI 998

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 12/82 (14%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFKKM 802
           GL N+ NTCY+NS LQCL    + R+ F+ N + + +  +N      +M+RSF+ L + +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHGLIQSL 381

Query: 803 YMNGGCSVVPSGFLKMCSYLKP 824
           +   G S+ P       SY+ P
Sbjct: 382 F---GDSIAP-----FPSYVSP 395

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 59/131 (45%), Gaps = 27/131 (20%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLILNIVLKNNEVAK-------YRL 1097
            K +     P + +IHL RF      + K +  + +P I ++ +    V K       Y L
Sbjct: 927  KKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFP-IEDLDMSEYLVYKDDPRGSVYDL 985

Query: 1098 YSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVS 1156
             +  NH+G +  GHYT+ V K+L        Q WYYFDD  + K  P          S++
Sbjct: 986  IAVDNHYGGMGGGHYTAYV-KNLT------DQNWYYFDDSRVSKTSPEK--------SIA 1030

Query: 1157 SSDVYLLFYER 1167
             S  YLLFY R
Sbjct: 1031 GS-AYLLFYLR 1040

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 940 KKLRLEDCINFFTCDEVLTGQNPWDCPKC 968
           ++  L+DC+N F+  EVL   + W CP C
Sbjct: 891 QETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 56/123 (45%), Gaps = 15/123 (12%)

Query: 1053 TLPRILIIHLSRFVYDLTKKNNT----VVTYPLILNIVLK-NNEVAK-YRLYSTINHFGT 1106
            +LP+ L +HL RF Y   K  N      + YPLILN     ++ V+K YRL   + H G 
Sbjct: 563  SLPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGVVVHMGN 622

Query: 1107 LI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFY 1165
                GHY SL + +L          W  FDDE V+        D   +  S +  Y+LFY
Sbjct: 623  GPHHGHYVSLCHTEL--------FGWLLFDDETVESVDESYVLDFVGSHESPTTAYVLFY 674

Query: 1166 ERI 1168
              I
Sbjct: 675  SEI 677

 Score = 38.9 bits (89), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL+   EFR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 742 ALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN 790
           +L ITGL N+ NTCY+NS LQC+     FR  FL   YS Y K  N DN
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFL---YSGYEKELNTDN 362

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 57/131 (43%), Gaps = 23/131 (17%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLI-----LNIVLKNNEVAK-YRLY 1098
            K +     P +L+IHL RF      + K + VV +P+       ++V K++     Y L 
Sbjct: 930  KQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLI 989

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSS 1158
            +  NH+G L  GHYT+               KWYYFDD  V         +  IT  +  
Sbjct: 990  AVDNHYGGLGGGHYTAYAK-------NSTDGKWYYFDDSRV----TETVAENSITGAA-- 1036

Query: 1159 DVYLLFYERIS 1169
              YLLFY R S
Sbjct: 1037 --YLLFYLRRS 1045

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 938 KAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           K K++ L DC+N F+  E+L+  + W CP C  +    +Q+
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTCKEHRQATKQI 932

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
            to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
            ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 29/130 (22%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPL--------ILNIVLKNNEVAKYR 1096
            K L     P IL+IHL RF      + K + VV +P+        +++ V+++  +  Y 
Sbjct: 879  KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YD 936

Query: 1097 LYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSV 1155
            L++  NH+G L  GHYTS V  ++ +       +WYYFDD  +   DP          SV
Sbjct: 937  LFAVDNHYGGLGGGHYTSYVKNNIDN-------RWYYFDDSRVSSTDPKK--------SV 981

Query: 1156 SSSDVYLLFY 1165
            + S  YLLFY
Sbjct: 982  AGS-AYLLFY 990

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 86/203 (42%), Gaps = 27/203 (13%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-------MSRSFYM 797
           I GL N+ NTCY+NS LQCL    + R+ F    Y  Y +  N+DN       ++ +F  
Sbjct: 288 IVGLSNLGNTCYMNSGLQCLVHIPKLRDYFF---YGGYEQEINLDNPLGYNGTVATAFGN 344

Query: 798 LFKKMY-----MNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXS- 851
           L + +Y          S  P+ F KM       +   + QQD+Q              + 
Sbjct: 345 LIQNLYSYHWNQQQYQSYSPNRF-KMTLGQANSMFAGYMQQDSQEFLAFLLDSLHEDLNR 403

Query: 852 -----YLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906
                Y+     +  + L  E++V ++  K   TW D +  +N  S I+ +F G  +  L
Sbjct: 404 IHDKPYIEKPTLETSEELADENAVKQLAKK---TW-DAHLARND-SVINDLFVGMYKSTL 458

Query: 907 SCQRCDFSSYSYSTFYVLSLALP 929
            C  C   S ++  +  L+L LP
Sbjct: 459 KCPTCKNISITFDPYNDLTLPLP 481

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 57/122 (46%), Gaps = 19/122 (15%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNIVLKNNEVA--KYRLYSTINHFGTL 1107
            LPRIL +HL RF Y   +  N      +TYPL L +  K +     KY L   + H G  
Sbjct: 548  LPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGG 607

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKL--DPNHGNYDRGITSVSSSDVYLLF 1164
               GHY S+   D           W +FDDE V+   +P   N+    T+ +++  Y+LF
Sbjct: 608  PQHGHYVSVCKTD--------NFGWLFFDDETVETLDEPQVLNFTGDTTTSTTA--YVLF 657

Query: 1165 YE 1166
            Y+
Sbjct: 658  YK 659

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 22/31 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           I G  N  NTCY NS+LQCLF+ TEFRN  L
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTK----KNNTVVTYPLILNI--------VLKNNEVAK 1094
            K + F + P IL + L RF YD       K N    +P  +++        + +N E  K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G + +GHY +++  DLQ        +WY FDDE V
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQ-------DQWYRFDDEKV 481

 Score = 35.8 bits (81), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKL 234

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 87/219 (39%), Gaps = 52/219 (23%)

Query: 742 ALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYM 797
           A   TGL N+ NTCY+NS LQCL    + R+ FL + Y   +   N       ++R+F  
Sbjct: 360 ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVARAFSD 419

Query: 798 LFKKMY------MNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXS 851
           L +K++      M    +  PS F     +    +   + QQD+Q               
Sbjct: 420 LIQKIFQNRLSVMQRNGAFPPSMFKSTVGHFN-SMFSGYMQQDSQ--------------E 464

Query: 852 YLAAVVNDYPQLLLHESSVLKVNDKEYT------------TW------FDQNFE---KNG 890
           +LA +++      LHE  + ++  KEY              W       D  +E   K  
Sbjct: 465 FLAFLLDS-----LHE-DLNRIIKKEYIEKPSLSPGDDVDDWNVVKKLADDTWEMHLKRN 518

Query: 891 LSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALP 929
            S I  +F G  +  L C  C   S ++  +  ++L LP
Sbjct: 519 CSVITDLFVGMYKSTLYCPECKNVSITFDPYNDVTLPLP 557

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 60/131 (45%), Gaps = 27/131 (20%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLILNIVLKNNEVAK-------YRL 1097
            K +     P IL+IHL RF      + K +  V +P I ++ L  N V K       Y L
Sbjct: 992  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSKNVVYKDDPRGSIYDL 1050

Query: 1098 YSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVS 1156
            Y+  NH+G L  GHYT+ V             KWYYFDD  + +  P +        S++
Sbjct: 1051 YAVDNHYGGLGGGHYTAYVK-------NFANNKWYYFDDSRVTETVPEN--------SIA 1095

Query: 1157 SSDVYLLFYER 1167
             S  YLLFY R
Sbjct: 1096 GS-AYLLFYIR 1105

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%)

Query: 937 GKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
            K + + L+DC+  F+  E+L   + W CP C  +    +Q+
Sbjct: 953 AKERTITLDDCLQLFSKPEILGLSDSWYCPTCKEHRQATKQI 994

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 86/217 (39%), Gaps = 59/217 (27%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-------MSRSFYML 798
            GL N+ NTCY+NS LQCL    EF++ FL   Y+ Y K  N+DN       ++ +F  L
Sbjct: 349 VGLGNLGNTCYMNSALQCLVHIPEFKDYFL---YNAYEKEINVDNPLGHKGHIAWAFGTL 405

Query: 799 FKKMY---MNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAA 855
            + ++    N   S  P  F     +L   +   + QQD+Q               +LA 
Sbjct: 406 IQSLFGKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQ--------------EFLAF 450

Query: 856 VVNDYPQLLLHESSVLKVNDKEYT-----------------------TWFDQNFEKNGLS 892
           +++      LHE  + ++ DK Y                        TW       + + 
Sbjct: 451 LLDG-----LHE-DLNRIVDKPYVEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSV- 503

Query: 893 PIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALP 929
            I  +F G  +  L C  C   S ++  +  L+L LP
Sbjct: 504 -ILDLFVGLYKSTLICPTCKKVSTTFDPYNDLTLPLP 539

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLI-LN----IVLKNNEVAK-YRLY 1098
            K +     P IL+IHL RF      + K   +V +P+  L+    +V K+++    Y L 
Sbjct: 971  KQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLI 1030

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSS 1158
            +  NH+G L  GHYT+ V   L +       KWYYFDD  V    N    +R I    + 
Sbjct: 1031 AVDNHYGGLGGGHYTAYVKNFLDN-------KWYYFDDSRV----NETVPERSI----AG 1075

Query: 1159 DVYLLFYER 1167
              YLLFY R
Sbjct: 1076 SAYLLFYRR 1084

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 911 CDFSSYSYSTFYVLSLAL--------PNPGSKAFGKA------KKLRLEDCINFFTCDEV 956
           C+++S SY   +  SL +        PN   +A  +       KK+ L DC+  F+  EV
Sbjct: 892 CEWNSKSYDEVFNSSLKVNWDSPGEVPNTELEASKRERNAQEEKKITLHDCLTLFSTPEV 951

Query: 957 LTGQNPWDCPKCGVNSSGDRQM 978
           L   + W CP C  +    +Q+
Sbjct: 952 LGATDSWYCPSCKEHRQATKQI 973

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 36/146 (24%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNI--VLKN 1089
            H ++ N K   I+ L    LP +L++ L RF + +   + K N  + +P  L++    + 
Sbjct: 324  HCEKCNTKQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQT 383

Query: 1090 NEVAK-----YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPN 1144
            ++V +     Y L   I+H G++  GHYTS+       +I  G  +W+ F+D +V     
Sbjct: 384  DKVGETPAIVYELIGLISHQGSVNQGHYTSIC------KIPGG--QWFKFNDSMV----- 430

Query: 1145 HGNYDRGITSVSSSDV-----YLLFY 1165
                    T+V+  DV     YLLFY
Sbjct: 431  --------TAVAEIDVLKEQAYLLFY 448

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 56/121 (46%), Gaps = 17/121 (14%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNTV-----VTYPLILNIVLK-NNEVA-KYRLYSTINHFGT 1106
            LP  L +HL RF Y   K+N  +     + YPL LN+    N+EV  KY L   + H G 
Sbjct: 557  LPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMGG 615

Query: 1107 LIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFY 1165
                GHY SL     +HEI      W  FDDE V+        +    S + +  Y+LFY
Sbjct: 616  GPQHGHYVSLC----KHEIF----GWLLFDDETVEAVKEEAVLEFTGESPNMATAYVLFY 667

Query: 1166 E 1166
            +
Sbjct: 668  K 668

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  NTCY NS+LQCL++ +  R   L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRENIL 170

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1198

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 62/130 (47%), Gaps = 25/130 (19%)

Query: 1047 KSLNFITLPRILIIHLSRFV--YDLTKKNNTVVTYPLI-LN----IVLKNNEVAK-YRLY 1098
            K +     P IL IHL RF   +  + K + VV +P+  LN    +V ++ E    Y L 
Sbjct: 937  KQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLV 996

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVSS 1157
            +  NH+G L  GHYT+     +         KWYYFDD  + + DP         TSVS 
Sbjct: 997  AVDNHYGGLGGGHYTAFAKNPVD-------GKWYYFDDSRVSETDPE--------TSVSG 1041

Query: 1158 SDVYLLFYER 1167
            +  YLLFY R
Sbjct: 1042 A-AYLLFYRR 1050

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 86/200 (43%), Gaps = 25/200 (12%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-------MSRSFYML 798
           TGL N+ N+CY+NS LQCL    E ++ FL   Y  Y +  N  N       ++++F  L
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFL---YGGYEEDVNTQNPLGYKGLVAQAFAAL 390

Query: 799 FKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHG--QQDTQXXXXXXXXXXXXXXS-YLAA 855
            K ++     S       +  S +     +  G  QQD+Q              +  +  
Sbjct: 391 IKSLFDERSSSAFAFSPREFKSIIGQQNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIEK 450

Query: 856 VVNDYPQLLLHESSVLKVNDKEYT------TWFDQNFEKNGLSPIDSIFQGQIEHQLSCQ 909
              + P+L   E     VN++E        TW D++  +N  S I  +F G  +  L+C 
Sbjct: 451 PFVEKPELSPDED----VNNREVIHRLASKTW-DKHKLRND-SVILDLFVGLYKSTLTCP 504

Query: 910 RCDFSSYSYSTFYVLSLALP 929
            CD +S ++  +  L+L LP
Sbjct: 505 VCDKTSVTFDPYSDLTLPLP 524

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 940 KKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           +++ L DC+  F+  EVL+  + W CP C  +    +Q+
Sbjct: 901 RRISLFDCLKLFSKPEVLSAADSWYCPTCREHRQATKQI 939

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNTV-----VTYPLILNIVLK-NNEVA-KYRLYSTINHFGT 1106
            LP  L +HL RF Y   K+N  +     + YPL LN+    N+EV  KY L   + H G 
Sbjct: 555  LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMGG 613

Query: 1107 LIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFY 1165
                GHY SL         +  K  W  FDDE V+        +    S + +  Y+LFY
Sbjct: 614  GPQHGHYVSLC--------KHQKFGWLLFDDETVEAVKEETVLEFTGESANMATAYVLFY 665

Query: 1166 ERI 1168
            + +
Sbjct: 666  KAV 668

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  NTCY NS+LQCL++ +  R   L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENIL 169

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 11/98 (11%)

Query: 1042 KLATIKSLNFITLPRILIIHLSRFVYDLT--KKNNTVVTYP--LILN-IVLKNNE----- 1091
            K   +K    +  PR+LI+HLSR V++     KN   VT+P  L++N  +L+NN+     
Sbjct: 375  KSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVR 434

Query: 1092 VAKYRLYSTINHFGTLISGHYTSLVNK-DLQHEIREGK 1128
              +Y+L + I H GT   GHY    +K D + + R G+
Sbjct: 435  AVRYKLCAMIKHIGTHSQGHYACFRHKPDFRKDPRTGE 472

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 58/123 (47%), Gaps = 17/123 (13%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNTV-----VTYPLILNIVLK-NNEVA-KYRLYSTINHFGT 1106
            LP  L +HL RF Y   K+N  +     + YPL LN+    N+EV  KY+L   + H G 
Sbjct: 558  LPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMGG 616

Query: 1107 LIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFY 1165
                GHY SL     +HE    K  W  FDDE V+        +    S + +  Y+LFY
Sbjct: 617  GPQHGHYVSLC----KHE----KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 668

Query: 1166 ERI 1168
            + +
Sbjct: 669  KAM 671

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  NTCY NS+LQCL++ +  R   L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 170

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 50/112 (44%), Gaps = 15/112 (13%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNI--VLKN 1089
            H  R N     IK L    LP +L++ L RF + L   + K N +V +PL LN+      
Sbjct: 338  HCDRCNTTQNAIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDG 397

Query: 1090 NEVAK--YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            ++V    + L   I H GT+  GHY +       H        W+ F+D +V
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMV 441

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 55/127 (43%), Gaps = 25/127 (19%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYSTINHFGTL 1107
            LP+ L++HL RF Y   K  N      V YP  LNI  V  ++   KY L S + H G  
Sbjct: 540  LPKHLVVHLKRFKYCEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGES 599

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSV-----SSSDVY 1161
               GHY +L         +     W  +DDE V+        D  ++ +      S+  Y
Sbjct: 600  PQLGHYVTLC--------KHKSYGWLIYDDETVQ-----AVSDELVSRILNNEQRSATAY 646

Query: 1162 LLFYERI 1168
            LLFYE +
Sbjct: 647  LLFYEEV 653

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRN 772
           + G +N   TCY NS+LQ LF+   FR+
Sbjct: 105 VFGFQNFGYTCYCNSILQALFNIGSFRD 132

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 78/206 (37%), Gaps = 35/206 (16%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSF----Y 796
           I GL N+ NTCY+NS LQCL    E    FL   Y R +  +N      +++ +F    Y
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLLY 397

Query: 797 MLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLA-- 854
            LF   Y        P  F     +    L   +GQQD+Q              + +   
Sbjct: 398 SLFAPSY-GQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDLNRVIEK 455

Query: 855 -----------AVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIE 903
                        ++D  Q++L     L  N  +Y        +K   S I  +F G  +
Sbjct: 456 PYVNKPEFPNDGQIDDTDQIVL-----LAANMWDY-------IKKRNDSVIMDLFVGLYK 503

Query: 904 HQLSCQRCDFSSYSYSTFYVLSLALP 929
             L C  C+  S ++  +  L+L LP
Sbjct: 504 STLVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 59/130 (45%), Gaps = 25/130 (19%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYP---LILNIVL---KNNEVAKYRLY 1098
            K +     P IL+IHL RF      + K +  V +P   L ++  L   K  E   Y L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 1099 STINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV-KLDPNHGNYDRGITSVSS 1157
            +  NH+G L  GHYT+     +         KWYYFDD  V ++ P +        S++ 
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFID-------GKWYYFDDSRVNEVSPEN--------SIAG 1040

Query: 1158 SDVYLLFYER 1167
            S  YLLFY R
Sbjct: 1041 S-AYLLFYRR 1049

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 57/133 (42%), Gaps = 34/133 (25%)

Query: 1046 IKSLNFITLPRILIIHLSRFVYDLTKKN---NTVVTYPLILNI-----VLKNNEVAKYRL 1097
            IK L    LP +L++ L RF +    +N   N  + +P  LN+       +NN    Y L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 1098 YSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSS 1157
               I+H GT+  GHY + +  D           W+ F+D +V             TS+S 
Sbjct: 383  NGVISHIGTVNEGHYIATLKLD--------SNNWFKFNDSMV-------------TSISE 421

Query: 1158 SDV-----YLLFY 1165
             +V     YLLFY
Sbjct: 422  EEVLKDQAYLLFY 434

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 52/122 (42%), Gaps = 15/122 (12%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNIV--LKNNEVAKYRLYSTINHF-GT 1106
            LP  L +HL RF Y   +  N      V YPL L++     ++   KY L   + H  G+
Sbjct: 541  LPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGS 600

Query: 1107 LISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYE 1166
               GHY SL   D        K  W  FDDE V+        +    S + +  Y+LFY+
Sbjct: 601  PQHGHYVSLCKND--------KFGWLLFDDETVESVTEKTVLEFTGDSSNQATAYVLFYK 652

Query: 1167 RI 1168
             +
Sbjct: 653  EL 654

 Score = 38.9 bits (89), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++ TE R
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 69/162 (42%), Gaps = 41/162 (25%)

Query: 1042 KLATIKSLNFITLPRILIIHLSRFVYDLTK--KNNTVVTYPLILNIVLKNN------EVA 1093
            K A I+       P IL +HLSR +++     +N   V YP  L IVL+ +      E  
Sbjct: 315  KTAIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETL-IVLQRDVENGTAERI 373

Query: 1094 KYRLYSTINHFGTLISGHYTS---------------LVNKD---------LQHEIREGK- 1128
             YRL S I H GT  SGHY                  VN+          +Q  ++  K 
Sbjct: 374  TYRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKS 433

Query: 1129 -QKW-YYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             ++W Y+F  + V  + N G   R      S  VY+LFYER+
Sbjct: 434  VRRWPYWFISDAVVRESNAGKMLR-----ESKYVYMLFYERV 470

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 53/122 (43%), Gaps = 15/122 (12%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNIVLK-NNEVAK-YRLYSTINHFGTL 1107
            LP IL +HL RF Y   K  N      V YPL LN+    ++ + K Y L   + H G+ 
Sbjct: 645  LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYE 1166
               GHY SL   D        K  W  FDDE V+        +      + +  Y+LFY+
Sbjct: 705  PQHGHYVSLCKND--------KFGWLLFDDETVESVSESTVLEFTGDPNNQATAYVLFYK 756

Query: 1167 RI 1168
             I
Sbjct: 757  EI 758

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++  EFR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
            YJL197W
          Length = 1171

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 61/131 (46%), Gaps = 27/131 (20%)

Query: 1047 KSLNFITLPRILIIHLSRF--VYDLTKKNNTVVTYPLILNIVLKNNEVAK-------YRL 1097
            K +     P +L+IHL RF      + K +  V +P I N+ +    V K       Y L
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFP-IENLDMSPYLVHKDDPRGTVYDL 964

Query: 1098 YSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVS 1156
            Y+  NH+G L  GHYT+ V   + +       KWYYFDD  + + DP          SVS
Sbjct: 965  YAVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRVYETDPEK--------SVS 1009

Query: 1157 SSDVYLLFYER 1167
             S  YLLFY R
Sbjct: 1010 GS-AYLLFYLR 1019

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 742 ALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNM 791
           A    GL N+ NTCY+NS LQCL    + R+ FL   YS Y    N DN+
Sbjct: 319 AKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYFL---YSAYEAELNTDNL 365

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 937 GKAKKLRLEDCINFFTCDEVLTGQNPWDCPKC 968
           G  K++ L DC+N F+  EVL   + W CP C
Sbjct: 867 GSDKEITLNDCLNLFSKREVLGLNDSWYCPHC 898

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNTV-----VTYPLILNIV--LKNNEVAKYRLYSTINHFGT 1106
            LP  L +HL RF Y   K+N  +     + YPL LN+   + +    KY L   + H G 
Sbjct: 555  LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMGG 613

Query: 1107 LIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFY 1165
                GHY SL     +HE    K  W  FDDE V+        +    S + +  Y+LFY
Sbjct: 614  GPQHGHYVSLC----KHE----KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 665

Query: 1166 ERI 1168
            + +
Sbjct: 666  KAM 668

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  NTCY NS+LQCL++ +  R   L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 169

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 46/104 (44%), Gaps = 18/104 (17%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMD--------NMSRSFYML 798
           GL+NM NTCY+N+ LQ LF   E ++L L    S+   S   D         + R+F  L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETL 169

Query: 799 FKKMYMNGGCSVVPSGFLKMCSYLKPDL--RIPHG----QQDTQ 836
            K+ +     SV+P   L       P    R P G    QQD +
Sbjct: 170 KKRSFK----SVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAE 209

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 53/107 (49%), Gaps = 21/107 (19%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKN---NEV 1092
            K + F + P++L + L RF YD     L K N+      ++   P +   VLKN    E 
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 1093 AKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
              Y+L+  + H G + +GHY +++  DL      G Q WY FDDE V
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKPDL------GDQ-WYRFDDERV 485

 Score = 35.8 bits (81), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKL 236

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 59/137 (43%), Gaps = 36/137 (26%)

Query: 1044 ATIKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNIVLKNNEV-------A 1093
              +K L     P +L+I L RF + L   + K N  V +PL LN+     ++        
Sbjct: 328  GVVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNI 387

Query: 1094 KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGIT 1153
             Y L + ++H GT+  GHYT++   +          +W+ F+D +V             T
Sbjct: 388  AYDLLNVVSHQGTVDQGHYTTVSKTE--------DGQWFKFNDSVV-------------T 426

Query: 1154 SVSSSDV-----YLLFY 1165
            SV+   V     YLLFY
Sbjct: 427  SVTEEQVLEQQAYLLFY 443

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 97/253 (38%), Gaps = 58/253 (22%)

Query: 744 SITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK--------SSNMDNMSRSF 795
            + GL NM +TC+++S++Q +     F    LS+K+             S  +D ++  F
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKCVSCALDEIACDF 190

Query: 796 YMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPH-----GQQDTQXXXXXXXXXXXXXX 850
           Y         G  S V  GF+ +   L     I H      QQD                
Sbjct: 191 Y---GNGPGTGKSSSVSKGFVNL---LSASWHINHHLVGSSQQDA--------------- 229

Query: 851 SYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQR 910
                  ++Y Q LL++         ++   F  +   +       IFQG +++ L C +
Sbjct: 230 -------HEYWQFLLNQLHT------DHARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQ 276

Query: 911 CDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGV 970
           C FS  +      LSL + N            +LEDC++ F  +E LT  + ++C  C  
Sbjct: 277 CGFSKTTIDPIMDLSLEIKN----------NPKLEDCLDHFQREETLTDFH-YECQSCKQ 325

Query: 971 NSSGDRQMNSEKS 983
           N    +Q+   K+
Sbjct: 326 NQGVVKQLTLHKA 338

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 15/129 (11%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTKKNN----TVVTYPLIL--NIVLKNNEVAKYRLYST 1100
            +++    LP  LI+HL RF Y   + +N    + V YPLIL  N   K  +  KY L   
Sbjct: 511  RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 1101 INHFGTLIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSD 1159
            + H G     GHY +L   +        K  W ++DDE V+               + S 
Sbjct: 571  VIHVGDGPQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEKTQST 622

Query: 1160 VYLLFYERI 1168
             Y+LFY+++
Sbjct: 623  AYVLFYKKL 631

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++  EFR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 894 IDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTC 953
           I+ IFQG + +++ C  CD  +     F  L + +   G     +  K        +++ 
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKENGDTDIQRVLK--------YYSQ 488

Query: 954 DEVLTGQNPWDCPKCGVNSSGDRQMNSEK 982
            E+L G N ++C +C      +R +  +K
Sbjct: 489 REMLNGSNKFNCSQCCALQEAERAVELKK 517

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 38/80 (47%), Gaps = 13/80 (16%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMD-------NMSRSFYML 798
            GL N+ NTCY+NS LQCL      R+ F   K+  Y    N+D       N++ +F  L
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYF---KFGAYKNEINLDNPLGFQGNIANAFSAL 454

Query: 799 FKKMYMNG---GCSVVPSGF 815
            + +Y N      S  PS F
Sbjct: 455 VQNLYKNQFIPSASYAPSQF 474

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 61/130 (46%), Gaps = 25/130 (19%)

Query: 1047 KSLNFITLPRILIIHLSRFVY--DLTKKNNTVVTYP---LILNIVLKNNEVAKYRLYSTI 1101
            K +   + P IL IHL RF      + K + VV +P   L L+  + +   ++  +Y  I
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLI 1055

Query: 1102 ---NHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDE-IVKLDPNHGNYDRGITSVSS 1157
               NH+G L  GHYT+ +   + +       KWYYFDD  + +  P          SV+ 
Sbjct: 1056 AVDNHYGGLGGGHYTAYIKNLIDN-------KWYYFDDSRVSETVPER--------SVAG 1100

Query: 1158 SDVYLLFYER 1167
            S  YLLFY R
Sbjct: 1101 S-AYLLFYMR 1109

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 938 KAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           + K + LED +N F   EVL   + W CPKC  +    +Q+
Sbjct: 958 EEKNITLEDSLNLFERAEVLGINDSWYCPKCKHHRQASKQI 998

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 26/141 (18%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKN---NTVVTYPLILNIVL---- 1087
            H  R N  L  IK      LP +L++ L RF + +   N   N  V YPL LN+      
Sbjct: 336  HCSRCNTSLDPIKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDR 395

Query: 1088 -KNNEVAK--YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPN 1144
              N E     Y L   ++H G++  GHY  ++      +I +G  +W+ F+D ++ +   
Sbjct: 396  NTNQETPDIIYELTGILSHIGSINEGHYVVVL------KINDG--RWFKFNDSMISVIKE 447

Query: 1145 HGNYDRGITSVSSSDVYLLFY 1165
                D  +        YLLFY
Sbjct: 448  ----DEAL----KQQAYLLFY 460

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD--LTKKNNTVVTYPLILNI--VLKNNEVAKYRLYSTIN 1102
            K++ F  LP+ L +HL RF  D  +  K    + YPL L +     N+    Y L   + 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 1103 HFG-TLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVY 1161
            H G +   GHY S+     +HE    K  W  +DDE ++  P            +    Y
Sbjct: 591  HVGASPTHGHYVSIC----KHE----KYGWLMYDDETIESIPEEAVTSHVGEPNNPITAY 642

Query: 1162 LLFY-ERI 1168
            +LFY E+I
Sbjct: 643  VLFYSEKI 650

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  +TCY NS+LQC+++  EFR   L
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFRKSIL 150

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 15/93 (16%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI-VLKNNEVAK-YRLYSTINHFGTL 1107
            LP  LI+HL RF Y   + +N      + YPL+L +    N++++K Y L   + H G  
Sbjct: 520  LPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGGG 579

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
               GHY S+         +  K  W  FDDE+V
Sbjct: 580  PQHGHYVSIC--------KNEKYGWLLFDDEVV 604

 Score = 39.3 bits (90), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 24/107 (22%)

Query: 680 IDHTQYNQPEKYRYLP-----------DSR---ESPYPIEYEDPKHTERSRGWLSAGSSE 725
           ID+ ++N+  ++  +P           +SR   ESP P+  +DP+   ++         +
Sbjct: 42  IDNFEFNETTEHYEVPGINKTAQLLNSNSRALSESPTPVPLKDPRELVKN-----DSDHQ 96

Query: 726 AHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRN 772
               +  +  + N+     + G  N  NTCY NS+LQCL++  E R+
Sbjct: 97  KLLEITKLSDSSNK-----VFGYENFGNTCYCNSVLQCLYNIPELRD 138

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 16/103 (15%)

Query: 1045 TIKSLNFITLPRILIIHLSRFVYDLT--KKNNTVVTYPLILNIVLKNNEV-----AKYRL 1097
             +KS   I  P  L++HL +F ++ T   K    V+YP+ L++    +E       +Y+L
Sbjct: 582  ALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISSLPVRYQL 641

Query: 1098 YSTINHFG-TLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
             S + H G +L SGHY +          ++    W  +DDE +
Sbjct: 642  ISVVVHEGRSLSSGHYIA--------HCKQPDGSWATYDDEYI 676

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 57/145 (39%), Gaps = 19/145 (13%)

Query: 1035 HEKRYNKKLATI----KSLNFITLPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI- 1085
            H K Y  +  T+    +++    LP  L +HL RF Y      N      + YPL LN+ 
Sbjct: 602  HNKFYCSQCCTLQEAQRTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVS 661

Query: 1086 -VLKNNEVAKYRLYSTINHFGTL-ISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDP 1143
                ++   KY+L   + H G+    GHY ++   D        K  W  FDDE      
Sbjct: 662  SSFTSSISKKYKLQGIVVHMGSSPQQGHYVAICKTD--------KYGWLLFDDETASWIN 713

Query: 1144 NHGNYDRGITSVSSSDVYLLFYERI 1168
                        S +  Y+LFYE +
Sbjct: 714  EEEVLSFIGDEKSQNTAYVLFYEEV 738

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           I G  N  NTCY NS+LQCL+   +F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN----MDNMSRSFYMLFKKM 802
           GL N+ NTCY+NS LQC+     FR+ FL   + + +   N       M+R+F  L + +
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMARAFSDLIQSL 390

Query: 803 YMNGGCSVV---PSGF 815
           + +   S     PS F
Sbjct: 391 FGDNITSTTAYSPSYF 406

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 55/130 (42%), Gaps = 25/130 (19%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTKKNNTV--VTYPLILNIVLKNNEVAK-------YRL 1097
            K +     P IL+IHL RF    +  +  V  V +P I +  +  + V K       Y L
Sbjct: 973  KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFP-ITDFDISEHLVYKEDPRGNVYDL 1031

Query: 1098 YSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSS 1157
             +  NH+G L  GHYT+               KWYYFDD  V +            S++ 
Sbjct: 1032 IAVDNHYGGLGGGHYTAYAK-------NANDNKWYYFDDSRVSVTAPEK-------SIAG 1077

Query: 1158 SDVYLLFYER 1167
            S  YLLFY R
Sbjct: 1078 S-AYLLFYVR 1086

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 928 LPNPGSKAFGKAKK------LRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQM 978
           LPNP  +   + +       + L+DC+  F+  E+L+  + W CP C  +    +Q+
Sbjct: 919 LPNPQLEKLKEQRDKQEERHITLDDCLKLFSKPEILSSNDSWYCPHCKEHRQATKQI 975

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780
           GL+N+ NTCY+N+ LQCLF     R + L+ K S
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKMYMN 805
           GL+NM NTCY+N+ LQ LF     R+L L+   +   K+S  D M     +  K+ + N
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILNYDPA---KASPQDEMHHKIVLEMKRCFEN 163

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  NTCY NS+LQCL++ TEFR L L
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 51/124 (41%), Gaps = 17/124 (13%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILN--IVLKNNEVAKYRLYSTINHFGTL 1107
            LP  L +HL RF Y   +  N      + YPL L+      ++   KY L   + H G  
Sbjct: 568  LPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGGG 627

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSS-SDVYLLFY 1165
               GHY SL   D           W  FDDE V+   +     + I    S +  Y+LFY
Sbjct: 628  PQHGHYVSLCKND--------NFGWLLFDDETVEA-VHESTVSKFIGDRDSLTTAYVLFY 678

Query: 1166 ERIS 1169
            + I+
Sbjct: 679  KEIA 682

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 36/135 (26%)

Query: 1046 IKSLNFITLPRILIIHLSRFVYDLTKKN---NTVVTYPLILNIV-LKNNEVAK------Y 1095
            IK +    LP +L++ L RF + +   N   N  +TYP  LN+    ++  A+      Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 1096 RLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSV 1155
             L + I+  G++  GHYT +       ++  G  +W+ F+D +             I S+
Sbjct: 394  ELVAVISQEGSVNQGHYTCMC------KVPGG--QWFRFNDTM-------------IVSI 432

Query: 1156 SSSDV-----YLLFY 1165
            +  DV     YLLFY
Sbjct: 433  TEEDVLRQQAYLLFY 447

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 36/135 (26%)

Query: 1046 IKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNIVLKNNEVAK-------Y 1095
            IK +    LP +L++ L RF + +   + K N  + YP  LN+    ++          Y
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMY 394

Query: 1096 RLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSV 1155
             L + I+H G++  GHYTS+       +I  G  +W+ F+D +             I S+
Sbjct: 395  ELVAVISHEGSVNQGHYTSMC------KIPGG--QWFRFNDSM-------------IVSI 433

Query: 1156 SSSD-----VYLLFY 1165
            S  +      YLLFY
Sbjct: 434  SEEEALRQQAYLLFY 448

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 15/94 (15%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYSTINHFGTL 1107
            LP IL +HL RF Y   +K+N      + YPL L++      +   KY L   + H G+ 
Sbjct: 554  LPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSG 613

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
               GHY  +         R  K  W  +DDE V+
Sbjct: 614  PQHGHYVCIC--------RNEKFGWLLYDDETVE 639

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++  EFR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 46/105 (43%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLT----KKNNTVVTYPLILNIVL--------KNNEVAK 1094
            K + F + P IL + L RF YD       K N    +P   +            NNE   
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G + +GHY +++  DL+        +WY FDDE V
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLE-------DQWYRFDDEKV 475

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKL 228

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTKKNN----TVVTYPLILNIVLKNNEVA--KYRLYST 1100
            +++    LP+IL +HL RF Y    ++N      + YPL L +  K++ +    Y L   
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGI 642

Query: 1101 INHFGTLIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
            + H G     GHY ++   D+          W  +DDE V+
Sbjct: 643  VIHMGGGPQHGHYVAICKHDM--------FGWLLYDDETVE 675

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + GL N  NTCY NS+LQCLF+ +E R   L
Sbjct: 132 VFGLENFGNTCYCNSVLQCLFNLSELRTNIL 162

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 894 IDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTC 953
           + S+FQG + + + C  CD  + S   F  L  A+P        + +++ ++D ++ F  
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIP------VNEDEEVNIQDMLSNFNQ 560

Query: 954 DEVLTGQNPWDCPKC 968
            E+L G N + C  C
Sbjct: 561 REMLNGANKFYCDSC 575

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN------MDNMSRSFYMLFK 800
           GL NM NTCY+NS LQ L+     R++ L  K    ++  +      +  + R F  L K
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKRCFENLQK 169

Query: 801 KMYMNGGCSVVPSGFLKMCSYLKP 824
           K Y     SV+P  FL +     P
Sbjct: 170 KSYE----SVMPVVFLNLLRKCYP 189

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 20/106 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTK----KNNTVVTYPLILNIV---------LKNNEVA 1093
            K + F + P +L + L RF YD       K N    +P  +++          L N E  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 1094 KYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
             Y L+  + H G + +GHY +++   +  E       WY FDD+ V
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRPGVSDE-------WYRFDDDKV 478

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKMYMN 805
            G +N   TCY+NS+LQ  F T  FR L        Y   ++MD+ + S  +  ++ +  
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV-------YEIPTDMDSPNNSVPLALQRAFYQ 255

Query: 806 GGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQ 836
              S  P   L++      D      Q D Q
Sbjct: 256 LQVSNEPLDTLELTRSFGWDNGDAFTQHDVQ 286

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + GL N  NTCY NS+LQCL++  EFR   L
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRENIL 160

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 52/128 (40%), Gaps = 15/128 (11%)

Query: 1049 LNFITLPRILIIHLSRFVYDLTKKNNT----VVTYPLILNIVLKNNE-VAK-YRLYSTIN 1102
            L    LP+ L IHL RF Y      N      + YP+ L +    +E V+K Y L   + 
Sbjct: 522  LGLKELPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVV 581

Query: 1103 HFGTLIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVY 1161
            H G     GHY S+         +     W  FDDE V+             S S+   Y
Sbjct: 582  HIGIGPQHGHYISVC--------KTSDYGWLLFDDETVECISEDTVLSFVGDSNSAGTAY 633

Query: 1162 LLFYERIS 1169
            +LFY+ I+
Sbjct: 634  VLFYKEIN 641

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 60/136 (44%), Gaps = 37/136 (27%)

Query: 1046 IKSLNFITLPRILIIHLSRFVYDLTKKN---NTVVTYPLILNI--VLKNNE------VAK 1094
            IK      LP +L++ L RF + ++  N   N  + +P IL++   LK+N+         
Sbjct: 341  IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITS 1154
            Y L   I+H G++  GHY +        +I  G  +W+ F+D +V             T 
Sbjct: 401  YELIGIISHTGSVNEGHYVAFC------KIENG--EWFKFNDSMV-------------TK 439

Query: 1155 VSSSDV-----YLLFY 1165
            +   DV     YLLFY
Sbjct: 440  ILEKDVLKEQAYLLFY 455

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 6/56 (10%)

Query: 725 EAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780
           E + +VPT+++         + GL NM +TCY++S++QC+         F+  ++S
Sbjct: 122 EEYTNVPTVDQID------GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHS 171

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           I G  N  NTCY NS+LQCL++  EFRN  L
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRNDML 179

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 51/120 (42%), Gaps = 15/120 (12%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNT----VVTYPLILNIVLK-NNEVAK-YRLYSTINHFGTL 1107
            LP+ L +HL RF Y   + +N      V+YPL L +    N  ++K Y L   + H G  
Sbjct: 566  LPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGGG 625

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYE 1166
               GHY SL   +        K  W  FDDE V+               + +  Y+LFY+
Sbjct: 626  PQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKDTMTTAYVLFYQ 677

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 1040 NKKLATIKSLNFITLPRILIIHLSRFVYD-LTKKNN----------TVVTYPLILNIVLK 1088
            N K   IK    + LP ILI+HLSR  ++ +T   N          T+  Y L  +  + 
Sbjct: 325  NIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTIT 384

Query: 1089 NNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQ 1129
             N   KY L S + H G+  SGHY     K    EIR GK+
Sbjct: 385  ENRQVKYNLKSVVKHTGSHSSGHYMCYRRKT---EIRFGKE 422

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 60/152 (39%), Gaps = 42/152 (27%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTV---VTYPLILNI--VLKN 1089
            H    N     IK L    LP +L++ L RF + L   N  +   + +P  LN+      
Sbjct: 335  HCGECNSTQDAIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCST 394

Query: 1090 NEVAK-----------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
             E  K           Y L   ++H GT+  GHY +        +I  G  +W+ F+D +
Sbjct: 395  GESEKHTGNGKVPDIIYELIGIVSHRGTVNEGHYIAFC------KISGG--QWFKFNDSV 446

Query: 1139 VKLDPNHGNYDRGITSVSSSDV-----YLLFY 1165
            V             TS++  +V     YLLFY
Sbjct: 447  V-------------TSIAQGEVLKEQAYLLFY 465

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 103/263 (39%), Gaps = 52/263 (19%)

Query: 729 SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK---- 784
           +VP +E+         ++GL NM +TC+++S+LQCL     F    +S  +S   K    
Sbjct: 126 TVPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVGSP 179

Query: 785 ----SSNMDNMSRSFYMLFKKMYMNGGCSVV--PSGFLKM--CSYLKPDLRIPHGQQDTQ 836
               S  +D + +  Y +      +   S     +GF+ +  C++        + QQD  
Sbjct: 180 DKCFSCALDKIIQELYGVLNTDQPSPSSSATNRQTGFIYLLTCAWKINQNLAGYSQQDAH 239

Query: 837 XXXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDS 896
                          +   ++N   Q   H+S     N KE     D+   K     + S
Sbjct: 240 --------------EFWQFIINQIHQSYTHDSP----NAKE----IDRVNNKRCECIVHS 277

Query: 897 IFQGQIEHQLSCQRCDFSS-YSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDE 955
           +F+G +E  + C  C  +S  +   F  LSL + +          K +L +C++ F   E
Sbjct: 278 VFEGSLESSIVCPGCQKNSKTTIDPFMDLSLDIKD----------KKKLYECLDSFHKKE 327

Query: 956 VLTGQNPWDCPKCGVNSSGDRQM 978
            L   N + C +C       +Q+
Sbjct: 328 QLKDFN-YHCGECNSTQDAIKQL 349

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  NTCY NS+LQCL++ TEFR   L
Sbjct: 114 VFGYENFGNTCYCNSVLQCLYNLTEFRTEIL 144

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 43/99 (43%), Gaps = 25/99 (25%)

Query: 693 YLPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYI-----ALS--- 744
           +L DS E P    ++DP  T          +S  H  V    ++PNE +      LS   
Sbjct: 78  FLDDSTE-PRLTSHQDPIQT----SVFYDSNSNNHKQVENFTESPNESVDHCFPVLSTHT 132

Query: 745 ------------ITGLRNMSNTCYINSMLQCLFSTTEFR 771
                       + G  N  NTCY NS+LQCL++ TEFR
Sbjct: 133 TDLLPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLTEFR 171

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 62/138 (44%), Gaps = 41/138 (29%)

Query: 1046 IKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNI--------VLKNNEVAK 1094
            I+ L    LP +L++ L RF + +   + K N  +++PL LN+         L       
Sbjct: 349  IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMM 408

Query: 1095 YRLYSTINHFGTLISGHYTSL--VNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGI 1152
            Y+L + I+H GT+  GHYT++  +N D+          W  F+D +V             
Sbjct: 409  YKLSAIISHHGTVHQGHYTTICRINGDI----------WAKFNDSMV------------- 445

Query: 1153 TSVSSSDV-----YLLFY 1165
            T +S  D+     YLL+Y
Sbjct: 446  TVISEEDMLKEQAYLLYY 463

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 63/152 (41%), Gaps = 42/152 (27%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTV---VTYPLILNIVL---- 1087
            H    N     IK L    LP +L++ L RF + L   N  +   + +P  LN+      
Sbjct: 335  HCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCST 394

Query: 1088 ----KNNEVAK-----YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
                K++E  K     Y L   ++H GT+  GHY +        +I  G  +W+ F+D +
Sbjct: 395  KEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGG--QWFKFNDSM 446

Query: 1139 VKLDPNHGNYDRGITSVSSSDV-----YLLFY 1165
            V             +S+S  +V     YLLFY
Sbjct: 447  V-------------SSISQEEVLKEQAYLLFY 465

 Score = 35.4 bits (80), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 108/267 (40%), Gaps = 54/267 (20%)

Query: 730 VPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK----- 784
           VP++E+         ++GL NM +TC+++S+LQCL     F    +S  +S   K     
Sbjct: 127 VPSMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPD 180

Query: 785 ---SSNMDNMSRSFYMLF--KKMYMNGGCSVVPSGFLKM--CSYLKPDLRIPHGQQDTQX 837
              S  +D +    Y     K+   +   +   +GF+ +  C++        + QQD   
Sbjct: 181 KCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAH- 239

Query: 838 XXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKV-NDKEYTTWFDQNFEKNGLSPIDS 896
                         +   ++N      +H+S VL + N KE +   ++  E      + +
Sbjct: 240 -------------EFWQFIINQ-----IHQSYVLDLPNAKEVSRANNKQCE----CIVHT 277

Query: 897 IFQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDE 955
           +F+G +E  + C  C + S  +   F  LSL + +          K +L +C++ F   E
Sbjct: 278 VFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKD----------KKKLYECLDSFHKKE 327

Query: 956 VLTGQNPWDCPKCGVNSSGDRQMNSEK 982
            L   N + C +C       +Q+   K
Sbjct: 328 QLKDFN-YHCGECNSTQDAIKQLGIHK 353

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 54/124 (43%), Gaps = 27/124 (21%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNIVL---- 1087
            H    N     IK L    L  +L+  L RF + L   T K N  + YPL LN+      
Sbjct: 354  HCSECNSTQDPIKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQS 413

Query: 1088 KNNEVAK------------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFD 1135
             NN+  +            Y L S I+H GT+  GHY  +V      ++ +G  +W+ F+
Sbjct: 414  SNNDTEEEESNSENVPDMIYELTSIISHKGTVNEGHYIVVV------KVNDG--QWFKFN 465

Query: 1136 DEIV 1139
            D +V
Sbjct: 466  DSMV 469

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 25/48 (52%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRS 794
           G +NM NTCY+NS LQ L+     R L LS   S    SS  D+   S
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVES 156

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
            Anc_8.540 YPL072W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 85/391 (21%), Positives = 142/391 (36%), Gaps = 83/391 (21%)

Query: 746  TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKMYMN 805
            TGL N  N C+INS LQ L           S +++ YL S     + R    L +     
Sbjct: 69   TGLINKGNDCFINSSLQGLAG---------SQRFNHYLNS-----VLRCLKFLNENPKQE 114

Query: 806  GGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVND---YPQ 862
            G    +P    ++ +    DL+ P      +                ++   ND   + Q
Sbjct: 115  GNRYALP--LHQVMAEFIYDLQAPTFLNTVESSDKIIVTMESIFKQKMSRRQNDAQEFTQ 172

Query: 863  LLLHESSVLKVNDKEYTTWFD-QNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSS-YSYST 920
            LLL      +V   EY       NF  N L      F+G+  H+L+C +C  +S      
Sbjct: 173  LLL------EVLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNSEVKMFD 226

Query: 921  FYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNP-----WDCPKCGVNSSGD 975
            F +L+L LP   S                  + DE+++G N      + C  C V++   
Sbjct: 227  FDILTLNLPAQPS-----------------ISLDELISGSNSDVIEGFSCTVCKVSA--- 266

Query: 976  RQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTH 1035
                           +G    ++ N+ R  +  L                        +H
Sbjct: 267  --------------ILGGTGTHNPNT-RSLIKSLKEIFPELKINTELDEPLNSFVDSYSH 311

Query: 1036 EKRY--NKKLATIKSLNFITLPRILIIHLSRFVYD----------LTKKNNTVVTYPLIL 1083
            +     N K   +K   F+ +P IL+IHL+R +++          +      ++ + L++
Sbjct: 312  DGVITRNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVM 371

Query: 1084 N--IVLKNNEVAKYRLYSTINHFGTLISGHY 1112
            +   V++NN   +Y L S I H G+   GHY
Sbjct: 372  DGVSVMRNN--IQYTLSSAIKHSGSHSMGHY 400

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 62/154 (40%), Gaps = 44/154 (28%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTV---VTYPLILNIV----- 1086
            H    N     IK L    LP +L++ L RF + L   N  +   + +P  LN+      
Sbjct: 335  HCGECNSTQDAIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCST 394

Query: 1087 --------LKNNEVAK--YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDD 1136
                    + N +V    Y L   ++H GT+  GHY +        +I  G  +W+ F+D
Sbjct: 395  AESESENHIGNGKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGG--QWFKFND 446

Query: 1137 EIVKLDPNHGNYDRGITSVSSSDV-----YLLFY 1165
             +V             +S+S  +V     YLLFY
Sbjct: 447  SMV-------------SSISQEEVLKEQAYLLFY 467

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 104/263 (39%), Gaps = 54/263 (20%)

Query: 730 VPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK----- 784
           VP +E+         ++GL NM +TC+++S+LQCL     F    +   +S   K     
Sbjct: 127 VPAMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMRQIHSNKCKVRSPD 180

Query: 785 ---SSNMDNMSRSFYMLFKKMYMNGGCSVV--PSGFLKM--CSYLKPDLRIPHGQQDTQX 837
              S  +D +    Y +      +   S      GF+ +  C++        + QQD   
Sbjct: 181 KCFSCALDKIVHELYGVLNTDQPSSSSSATNRQGGFIHLLTCAWKINQSLAGYSQQDAH- 239

Query: 838 XXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKV-NDKEYTTWFDQNFEKNGLSPIDS 896
                         +   ++N+     +H+S VL + N KE     D+   K     + +
Sbjct: 240 -------------EFWQFLINE-----IHQSYVLSLPNPKE----VDRANNKRCDCIVHT 277

Query: 897 IFQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDE 955
           +F+G +E  + C  C + S  +   F  LSL + +          K +L +C++ F   E
Sbjct: 278 VFEGSLESSIVCPGCQNNSKTTIDPFMDLSLDIKD----------KQKLYECLDSFHKKE 327

Query: 956 VLTGQNPWDCPKCGVNSSGDRQM 978
           +L   N + C +C       +Q+
Sbjct: 328 LLKDFN-YHCGECNSTQDAIKQL 349

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 62/152 (40%), Gaps = 42/152 (27%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTV---VTYPLILNIV----- 1086
            H    N     IK L    LP +L++ L RF + L   N  +   + +P  LN+      
Sbjct: 335  HCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSI 394

Query: 1087 ------LKNNEVAK--YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEI 1138
                  + N +V    Y L   ++H GT+  GHY +        +I  G  +W+ F+D +
Sbjct: 395  RESEKHIGNKKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGG--QWFKFNDSM 446

Query: 1139 VKLDPNHGNYDRGITSVSSSDV-----YLLFY 1165
            V             +S+S  +V     YLLFY
Sbjct: 447  V-------------SSISQEEVLKEQAYLLFY 465

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 102/266 (38%), Gaps = 52/266 (19%)

Query: 730 VPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMD 789
           VP +E+         ++GL NM +TC+++S+LQCL     F    +S  +    K  + D
Sbjct: 127 VPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIKHSMSQSHFNKCKVRSPD 180

Query: 790 N-MSRSFYMLFKKMYMNGGCSVVPS---------GFLKM--CSYLKPDLRIPHGQQDTQX 837
           N  S +   +  ++Y        PS         GF+ +  C++        + QQD   
Sbjct: 181 NCFSCALDKIVHELYGVLNTDQPPSSSSATNRQAGFIYLLTCAWKINQNLAGYSQQDAH- 239

Query: 838 XXXXXXXXXXXXXSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSI 897
                         +   ++N   Q  +      K +DKE     D          + ++
Sbjct: 240 -------------EFWQFIINQIHQNYVLSLPSTKESDKENIKHCD--------CIVHTV 278

Query: 898 FQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEV 956
           F+G +E  + C  C + S  +   F  LSL + +          K +L +C++ F   E+
Sbjct: 279 FEGSLESSIVCPSCQNNSKTTIDPFMDLSLDIKD----------KKKLYECLDSFHKKEL 328

Query: 957 LTGQNPWDCPKCGVNSSGDRQMNSEK 982
           L   N + C +C       +Q+   K
Sbjct: 329 LKDFN-YHCGECNSTQDAIKQLGIHK 353

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
            Ashbya gossypii AEL242W
          Length = 696

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 18/94 (19%)

Query: 1037 KRYNKKLATIKSLN--------FITLPRILIIHLSRFVYDLT--KKNNTVVTYP--LILN 1084
            K Y+K    I SL          ++ P++L++HLSR V+D     KN+  V +P  LILN
Sbjct: 378  KSYHKDGCHIPSLKSRILKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILN 437

Query: 1085 --IVLKNNEVA----KYRLYSTINHFGTLISGHY 1112
               + ++  +A    +Y+L + I H GT   GHY
Sbjct: 438  EQEIKEDRCIAVHCVRYKLQAMIKHTGTHFQGHY 471

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 8/50 (16%)

Query: 717 GWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFS 766
           GWLS GS++   S P  ++          TGL N  N C+ NS +Q L S
Sbjct: 63  GWLSPGSADMFKSSPREDRY--------TTGLTNSRNDCFANSSIQALAS 104

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 48/123 (39%), Gaps = 17/123 (13%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYSTINHFGTL 1107
            LP+ L +HL RF Y   K  N      + YP  L +     +    +Y L S + H G  
Sbjct: 512  LPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASAVIHLGDG 571

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYE 1166
               GHY SL         +     W  FDDE V+            T  +S   Y+LFY 
Sbjct: 572  PQYGHYISLC--------KTETFGWLLFDDETVEAVDEQTVL--SFTGENSDTAYVLFYN 621

Query: 1167 RIS 1169
             +S
Sbjct: 622  EVS 624

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
           I G  N  NTCY NS+LQC F+ + FR   LS
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKNNEVAK- 1094
            K + F + P +L + L RF YD     L K N+      T+   P +   VLK  +    
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G + +GHY +++             KWY FDDE V
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKP-------TTDDKWYRFDDEKV 533

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR+L
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDL 286

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 15/94 (15%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYSTINHFGTL 1107
            LP IL +HL RF Y   +K+N      + YPL L++      +   KY L   + H G+ 
Sbjct: 552  LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
               GHY  +   +        K  W  +DDE V+
Sbjct: 612  PQHGHYVCICKNE--------KFGWLLYDDETVE 637

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++  EFR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
            to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 770

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 1093 AKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYD 1149
            AKY+L + I H G  + SGHY + + K     + EGK++W  ++DE + L  +  N++
Sbjct: 703  AKYKLTAVICHKGNSVHSGHYVAFIKK-----VVEGKEQWVLYNDEKILLANDEPNFE 755

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKMY 803
           G +NM NTCY+N+ LQ LF   + R L L+     +   +  D M     +  K  +
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQDEMHHKLILELKHCF 165

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++ +EFR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFR 151

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 15/94 (15%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYSTINHFGTL 1107
            LP IL +HL RF Y   +++N      + YPL L++     ++   KY L   + H G+ 
Sbjct: 546  LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
               GHY  +   +        K  W  +DDE V+
Sbjct: 606  PQHGHYVCICKNE--------KFGWLLYDDETVE 631

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 55/123 (44%), Gaps = 27/123 (21%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNNT------VVTYPLILNIVLKNNEVAK- 1094
            K + F + P +L + L RF YD     L K N+       +   P +   VL+ N   + 
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV-------KLDPNHGN 1147
            Y L+  + H G + +GHY +L+   L+        +WY FDDE V         D N G 
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLE-------DQWYRFDDERVWKVSKKQAFDENFG- 491

Query: 1148 YDR 1150
            +DR
Sbjct: 492  FDR 494

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRY-LKSSNMDNMSRSFYML 798
            G RN   TCY+NS+LQ  F T  FR L      S+   K S +  + R+FY L
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQENPKDSVVLALQRAFYQL 256

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKNNEVAK- 1094
            K + F + P +L + L RF YD     L K N+      ++   P + +  L+ N   K 
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y+L+  + H G + +GHY +L+           K +WY FDD+ V
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKP-------STKDEWYRFDDDRV 477

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  + T  FR L
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRL 230

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 11/101 (10%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN-MDNMSRSFYMLFKKMYMN 805
           G +NM NTCY+N+ LQ L+ T + R + L  K      + N  D M     +  K+ + N
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILDYKPPAQSSTYNPEDEMHHKIVLEIKRCFEN 171

Query: 806 ----GGCSVVPSGFLKMCSYLKPDL--RIPHG----QQDTQ 836
                  SV+P   L +     P    R P G    QQD +
Sbjct: 172 LEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAE 212

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 14/82 (17%)

Query: 741 IALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN---------- 790
            A S  G +NM NTCY+N+ LQ L+   + R++ L+   S  + SS+  +          
Sbjct: 104 FAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIE 163

Query: 791 MSRSFYMLFKKMYMNGGCSVVP 812
           M R F  L  K +     SV+P
Sbjct: 164 MKRCFENLHNKSFK----SVLP 181

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 50/104 (48%), Gaps = 18/104 (17%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTK----KNNTVVTYPLILNI--VLKNNEVAK-----Y 1095
            K + F + P +L + L RF YD       K N    +P  +++   L++++  K     Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 1096 RLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
             L+  + H G + +GHY +L+   L+        +WY FDDE V
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKPGLE-------DQWYRFDDERV 476

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRL 230

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSN 777
           TG+ N+ NTCY+NS+LQ  FS T FR  F+ N
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFRE-FIEN 788

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKNNE-VAK 1094
            K + F + P +L + L RF YD     L K N+      T+   P +   VLK N     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G +  GHY +++  D+      G Q W+ FDD+ V
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDV------GDQ-WFRFDDDKV 476

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNL-FLSNKYSRYLKSSNMDNMSRSFYMLFK 800
           GL+N   TCY+NS+LQ  F T  FR + +     +     S +  + RSFY+L K
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIVYKIPSENESPNDSVLLALQRSFYLLQK 257

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 62/144 (43%), Gaps = 34/144 (23%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKN---NTVVTYPLILNI--VLKN 1089
            H  R       IK L    L   L++ L RF +  + +N   N  V +PL L++      
Sbjct: 328  HCPRCQTSRDPIKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTG 387

Query: 1090 NEVAK---YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHG 1146
             E      YRL   ++H GT+  GHYT+++      ++  G  +W+ F+D +        
Sbjct: 388  GEPTTSIVYRLSGVVSHSGTVNEGHYTAVL------QLNSG--EWFKFNDSM-------- 431

Query: 1147 NYDRGITSVSSSDV-----YLLFY 1165
                 I+ VS+ DV     YLL Y
Sbjct: 432  -----ISVVSAEDVLREQAYLLLY 450

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 718 WLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSN 777
           W SA S +   S+PT  +    Y      GL N+ +TC+++S+LQ L   T  +  FL++
Sbjct: 117 WDSAMSKQV--SLPTSLRRDGLY------GLLNLGSTCFMSSILQSLIHNTYIQYWFLNS 168

Query: 778 KYSR 781
            ++R
Sbjct: 169 GHAR 172

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKNNEVAK- 1094
            K + F + P +L + L RF YD     L K N+       +   P +   +LK     K 
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y+L+  + H G + +GHY +++   L+        +WY FDDE V
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLE-------DQWYRFDDEKV 478

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 82/228 (35%), Gaps = 52/228 (22%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKMYMN 805
            G RN   TCY+NS+LQ  F T  FR L        Y   +N +N + S  +  ++ +  
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YGIPTNGENPNDSVPLALQRAFYQ 256

Query: 806 GGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQXXXXXXXXXXXXXXSYLAAVVNDYPQLLL 865
              S  P   L++      D      Q D Q                L  ++ D  +  +
Sbjct: 257 LQVSKFPLDTLELTRSFGWDTADAFTQHDVQE---------------LNRILMDRLENRM 301

Query: 866 HESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLS 925
             ++V                       ++ IF G+++  + C+  D+ S     F+ + 
Sbjct: 302 KGTNV--------------------EGKLNEIFVGKMKSYIRCKNVDYESSRVEDFWDIQ 341

Query: 926 LALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSS 973
           L + N  S          L++    +   E++ G+N +  P  G+  +
Sbjct: 342 LNVKNFKS----------LQESFENYIEVELMNGENQYAAPDFGLQDA 379

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 25/111 (22%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLK------- 1088
            K + F + P +L + L RF YD     + K N+      T+   P +   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 1089 NNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            N     Y L+  + H G + +GHY +L+   ++        +WY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 485

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar to
            gnl|GLV|KLLA0E23463g Kluyveromyces lactis KLLA0E23463g
            and some similarites with YPL072W uniprot|Q02863
            Saccharomyces cerevisiae YPL072W UBP16 Putative
            ubiquitin-specific protease
          Length = 767

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 1042 KLATIKSLNFITLPRILIIHLSRFVYDLTK--KNNTVVTYPLILN----IVLKNNEVA-- 1093
            K   +K    +  P +LIIHLSR V++     +N+  V +   L     I+ KN  V   
Sbjct: 440  KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 1094 --KYRLYSTINHFGTLISGHY 1112
              KYRL +T+ H GT  +GHY
Sbjct: 500  NVKYRLRATVRHQGTHSAGHY 520

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 21/120 (17%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTK---KNNTVVTYPLILN------I 1085
            H K  N      K L    L  +L+    RF + L+    K N V+ +PL LN      +
Sbjct: 333  HCKNCNTSQDPTKQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDV 392

Query: 1086 VLKNNEVAK----YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKL 1141
              +++  +K    Y L   I H GT+  GHYT++       +I EG  +W  F+D +V +
Sbjct: 393  EQRDDSNSKPDLIYELIGIICHTGTVNEGHYTAIC------KIPEG--QWIKFNDSMVTI 444

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK--------SSNMDNMSRSFY 796
           ++GL NM +TCY++ ++QCL     F    L+  + +  K        S  +D++   FY
Sbjct: 136 LSGLVNMGSTCYVSCIIQCLVRNPYFLKYSLNQSHFKICKTHDPTTCISCALDSIVTDFY 195

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
            (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 93/244 (38%), Gaps = 69/244 (28%)

Query: 898  FQGQIEHQLSCQRCDFSSY-SYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEV 956
            F+G++   LSC  C  +S  + STF +L +  P   S          LE+ I     D++
Sbjct: 209  FEGKLASYLSCLNCGQTSIPNISTFNILPIQTPQEYSA--------ELEEIIYGNQIDQI 260

Query: 957  LTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDH---------LP 1007
                  + C  C  N+     + +EK+           N +  N+  +H         LP
Sbjct: 261  ----TDYSCLVCQTNAI----LKNEKT-----------NGHKGNTTDEHEIVKYLEDVLP 301

Query: 1008 RLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNK--------KLATIKSLNFITLPRILI 1059
             L                         + K YNK        K   IK  + I  P+IL+
Sbjct: 302  VLRINEELDSKTL-------------NYIKYYNKYGMKSGNIKSTIIKKNSIIETPKILM 348

Query: 1060 IHLSRFVYD--LTKKNNTVVTYPLILNIVLKNN---------EVAKYRLYSTINHFGTLI 1108
            IHLSR +Y+  +  +N+  V +   ++I  +           E+  Y+L S I H GT  
Sbjct: 349  IHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKIELVDYQLQSIIKHTGTHN 408

Query: 1109 SGHY 1112
            SGHY
Sbjct: 409  SGHY 412

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKM 802
           GL+NM NTCY+N+ LQ L+  T  R   L+  + +  KS N      S ++L +++
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILN--FDK--KSGNFPADDESHFLLVQEL 156

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKS---SNMDNMSRSFYMLFKKMY 803
           G+ N+ NTCY+N+ LQ LF     R   L     R +K    +    + R   + F+K+ 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLK 162

Query: 804 MNGGCSVVPSGFLKMCSYLKP 824
              G ++ P   L++   + P
Sbjct: 163 DRKGENITPLLLLEILRRVFP 183

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQCL++  EFR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 50/122 (40%), Gaps = 15/122 (12%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYSTINHFGTL 1107
            +P IL +HL RF Y   + +N      + YPL L++      +   +Y L   + H G+ 
Sbjct: 557  VPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSG 616

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYE 1166
               GHY  +   +        K  W  +DDE V+             S   +  Y+LFY+
Sbjct: 617  PQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVLKFTGHSGDQTTAYVLFYK 668

Query: 1167 RI 1168
             I
Sbjct: 669  EI 670

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 5/82 (6%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMD----NMSRSFYMLFKKM 802
           G+ NM NTCY+N+ LQ L+     R   L+    +   +  MD     + R     F+K+
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFD-DKKATAEGMDLYHVQLIREIQATFRKL 119

Query: 803 YMNGGCSVVPSGFLKMCSYLKP 824
               G ++ P   L++   + P
Sbjct: 120 RDKKGEAITPMLLLEILRRVFP 141

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 38.9 bits (89), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 739 EYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSR 781
           ++++ +  GL+N+ NTCY+NS LQ L+     R+  L+ K  R
Sbjct: 53  QHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPR 95

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 46/107 (42%), Gaps = 20/107 (18%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN----------MSRSF 795
            G +NM NTCY+N+ LQ L+   + R + L+   S+ + ++ + +          M R F
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDEETHKQIVIEMKRCF 168

Query: 796 YMLFKKMYMNGGCSVVPSGFLKMCSYLKPDL--RIPHG----QQDTQ 836
             L  K +     SV+P   L       P    R P G    QQD +
Sbjct: 169 ENLQNKSFK----SVLPIVLLNTLRKCYPQFAERDPQGGFYKQQDAE 211

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
            G +NM NTCY+N+ LQ L+   + R++ L+
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLRDMILN 139

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
            G +NM NTCY+N+ LQ L+   + R++ L+
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVDDLRDMILN 139

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + GL N  NTCY NS+LQCL++  E R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 894 IDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTC 953
           I ++FQG + + + C  CD  + +   F+    A+P        + ++L ++D +  F  
Sbjct: 464 IHTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIP------VSEDEELNVQDILRDFHQ 515

Query: 954 DEVLTGQNPWDCPKC 968
            E+L G N + C  C
Sbjct: 516 REMLNGANKFYCDSC 530

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 38.5 bits (88), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 19/116 (16%)

Query: 1035 HEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNI----VL 1087
            H    N     IK L+   LP +L++ L RF + L   + K N  + YP  LN+      
Sbjct: 332  HCPNCNTSQDAIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSS 391

Query: 1088 KNNEV----AKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
             +++V      Y L   + H GT+  GHY +          +   ++W+ F+D +V
Sbjct: 392  GDSDVDVPDLIYELIGVVAHKGTVNEGHYVATT--------KVAGRQWFKFNDSMV 439

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKMYMN 805
           G +NM NTCY+N+ LQ L+     R++ L   Y++   ++ +D   +   +  K+ + N
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILD--YNQNSTTTPVDETHKKIVVEMKRCFEN 166

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 9/71 (12%)

Query: 1095 YRLYSTINHFGT-LISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGIT 1153
            Y L   I H G    SGHY S +  D+  +      KWY F+D+ V + P       G+ 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDED------KWYNFNDDKVSVVPKEKI--EGLA 476

Query: 1154 SVSSSDVYLLF 1164
                SD  L+ 
Sbjct: 477  GGGESDSALIL 487

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR-NLFL 775
           + G  N  NTCY NS+LQCL++ +E R NL L
Sbjct: 126 VFGFENFGNTCYCNSVLQCLYNFSELRDNLIL 157

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 53/124 (42%), Gaps = 19/124 (15%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNT------VVTYPLILNI--VLKNNEVAKYRLYSTINHFG 1105
            LP+IL +HL RF Y  +++NN        +TYP  L++      +   KY L   I H G
Sbjct: 549  LPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLG 606

Query: 1106 TLIS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLF 1164
                 GHY ++         +  K  W  +DDE V+             S   +  Y+LF
Sbjct: 607  AGPQHGHYVAMC--------KTEKFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAYILF 658

Query: 1165 YERI 1168
            Y+ I
Sbjct: 659  YKTI 662

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKNNEVAK- 1094
            K + F + P +L + L RF YD     + K N+      T+   P +   VLK    ++ 
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 1095 -------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
                   Y L+  + H G + +GHY +L+   ++        +WY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           I G  N  NTCY NS+LQCLF   +FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 43/94 (45%), Gaps = 15/94 (15%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNT----VVTYPLILNIVLKNNEV--AKYRLYS-TINHFGT 1106
            LP  L +HL RF Y   K  NT     + YPLIL++    N+    KY L S  ++  G 
Sbjct: 504  LPHTLALHLKRFKYLEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIVVHLGGG 563

Query: 1107 LISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
               GHY S+   D        K  W  FDDE V+
Sbjct: 564  PHHGHYVSICKSD--------KFGWLLFDDETVE 589

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 898 FQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVL 957
           FQG + +Q+ C  CD  + +   F    + + N         + L ++D +N +   E+L
Sbjct: 426 FQGTLTNQIKCLTCDTLTSNNEPFLDFPIEVKNDD-------EDLNIQDILNKYHQREIL 478

Query: 958 TGQNPWDCPKC 968
            G N + C +C
Sbjct: 479 NGTNKFYCNQC 489

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
           TGL N+ NTCY+NS+LQ  FS +  R+  L+
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVLN 731

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 3/33 (9%)

Query: 733 IEKNPNEYIALSITGLRNMSNTCYINSMLQCLF 765
           ++ NP++ +     GL NM N+CY+NS+LQCLF
Sbjct: 310 VKLNPSKEVG---CGLINMGNSCYLNSVLQCLF 339

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRS 794
           TG+ N+ NTCY+NS+LQ  FS    R+  L+  Y + L + N D++S S
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLNNFN-DHLSNS 781

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           TGL N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin-specific
            protease
          Length = 782

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 10/81 (12%)

Query: 1042 KLATIKSLNFITLPRILIIHLSRFVYDLT--KKNNTVVTY--PLILN-IVLKNNEVA--- 1093
            K   +K    +  P +LI+HLSR V+D    +KN   V++   L++N  V++NN+     
Sbjct: 435  KSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNKCVGIR 494

Query: 1094 --KYRLYSTINHFGTLISGHY 1112
               Y+L S + H G+  +GHY
Sbjct: 495  KDSYKLRSMLRHQGSHSTGHY 515

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 1095 YRLYSTINHFGTLISG-HYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGIT 1153
            YRL   + H G   SG HYT+    D+ H+ ++   KWY  DD  V        + RG  
Sbjct: 723  YRLTGVVYHHGLSPSGGHYTA----DVLHQTQD---KWYRIDDNNVTEIRQEDVFKRGDE 775

Query: 1154 SVSSSDVYLLFYER 1167
            +  S   Y+L Y+R
Sbjct: 776  ASDSKTAYILIYQR 789

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKNNEV-AK 1094
            K + F + P +L + L RF YD     L K N+      ++   P +   V +++   AK
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G + +GHY +++   L+         WY FDD+ V
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLE-------DAWYRFDDDKV 464

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            GL+N   TCY+NS+LQ  + T  FR L
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKL 217

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRS 794
           TG+ N+ NTCY+NS+LQ  FS    R   L  +Y + L + N D++S S
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--EYQKTLDNFN-DHLSNS 781

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNK 778
           G +NM NTCY+NS LQ LF     +++ L+ K
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin- specific
            protease
          Length = 752

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 10/68 (14%)

Query: 1055 PRILIIHLSRFVYDLTK--KNNTVVTYPLILNI---VLKNNEVA-----KYRLYSTINHF 1104
            P ILI+HLSR V++ T   +N+  V +   L+     ++NN        KY+L S + H 
Sbjct: 445  PEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKYKLKSMVKHQ 504

Query: 1105 GTLISGHY 1112
            GT   GHY
Sbjct: 505  GTHSQGHY 512

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVLKNNEVAK- 1094
            K + F + P +L + L RF YD     + K N+      T+   P +   VLK +  +  
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 1095 -------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
                   Y L+  + H G + +GHY +L+   ++        +WY FDDE V
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 100/271 (36%), Gaps = 59/271 (21%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYMLFKKMYM 804
           + GL N  NTC++NS+LQ L S+ E  + FL +       + N  N S +F  L  K+  
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAH-FLDDIIEESEPNKNELNFSVAFKTLLDKLNA 123

Query: 805 -----------NGGCSVVPSG-----------------FLKMCSYLKPDLRIPHGQQDTQ 836
                      N     + SG                 F ++ S L+ DL+      D +
Sbjct: 124 KYGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDTDGDFK 183

Query: 837 XXXXXXXXXXXXXXSYLAAVVNDYP-QLLLHESSVLKVNDKEY-TTWFDQNFEKNG---- 890
                           L +   D P   LL++ ++ KV      T   + NF        
Sbjct: 184 KEESVQPSSEDDKTPILES---DLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGEHE 240

Query: 891 --------LSPIDSIFQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKK 941
                   L+P+D I    I  ++ C  C +     YS    LSL LPN    A      
Sbjct: 241 SFYTPYKLLTPLDGI----IAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGA-----T 291

Query: 942 LRLEDCINFFTCDEVLTGQNPWDCPKCGVNS 972
           L+L + ++ +   E++ G    DC +C + +
Sbjct: 292 LKLSELLDKWVEPEIIEG---VDCNRCALEA 319

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 80/200 (40%), Gaps = 28/200 (14%)

Query: 891  LSPIDSIFQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCIN 949
            ++P+D I       ++ C +C +     YS    +SL LP   S+  G    L+L D +N
Sbjct: 310  VTPLDGI----TAERIGCLQCGENGGIRYSVTSSMSLNLP---SEDIGST--LKLSDLLN 360

Query: 950  FFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRL 1009
             +   E++ G +   C +C + +  D  +   K           +  N  +S  + L + 
Sbjct: 361  QWIKPEIIEGVS---CNRCALEAVRDHLLEQLK-----------QYENKGDSIPEKLLQA 406

Query: 1010 XXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYD- 1068
                                     H +   +K +  K + F+  P +L IH++R V+D 
Sbjct: 407  FKARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDP 466

Query: 1069 ---LTKKNNTVVTYPLILNI 1085
               + +KNN+ V +   LN+
Sbjct: 467  RTYMIRKNNSRVLFKSRLNL 486

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK 784
            G+ N+ NTCY+NS+LQ  FS    RN  L  +YS+ ++
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLRNYVL--QYSKTIE 749

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
            YPL072W
          Length = 494

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 96/242 (39%), Gaps = 65/242 (26%)

Query: 898  FQGQIEHQLSCQRCDFSSY-SYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEV 956
            F+G + + L C +C  +S+ +   FY+  L LP  GS        ++L D +N    +++
Sbjct: 191  FKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQGS--------VKLSDLVN---GEQM 239

Query: 957  LTGQNPWDCPKCGVNS--SGDRQMNSEKSKRKN-----KFFMGSENANSANSNRDHLPRL 1009
             T +N + C  C   +  + +R+  S  S+        KF  G  +    N   + LP  
Sbjct: 240  ETIEN-YSCMYCKTVAMLTNEREEKSNVSRTDAELNILKFLKGKLSTLLIN---EELPE- 294

Query: 1010 XXXXXXXXXXXXXXXXXXXXXXXXTHE-KRYNK--------KLATIKSLNFITLPRILII 1060
                                    TH    YNK        K   ++   F   P I +I
Sbjct: 295  ----------------------HITHYINSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLI 332

Query: 1061 HLSRFVYDLT--KKNNTVVTYP---LILNIVLKNN-----EVAKYRLYSTINHFGTLISG 1110
            HLSR V++     +N   V +    L+   +LK++     E  KY+L S + H G+   G
Sbjct: 333  HLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFETVKYKLKSIVKHTGSHYQG 392

Query: 1111 HY 1112
            HY
Sbjct: 393  HY 394

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 26/112 (23%)

Query: 1047 KSLNFITLPRILIIHLSRFVYD-----LTKKNN------TVVTYPLILNIVL-------- 1087
            K + F + P +L + L RF YD     + K N+      T+   P +   VL        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 1088 KNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            K+     Y L+  + H G + +GHY +L+   ++        +WY FDDE V
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

 Score = 35.8 bits (81), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G RN   TCY+NS+LQ  F T  FR L
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
            YBR058C (UBP14) - Ubiquitin-specific protease [contig
            183] FULL
          Length = 762

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 8/55 (14%)

Query: 1093 AKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDE--IVKLDPN 1144
            A +RL + I H G+ + SGHY + + KD+++E      KW  ++DE  +V  DP+
Sbjct: 696  ANFRLSAVICHKGSSVHSGHYVAFIKKDVENET-----KWVLYNDEKMVVADDPS 745

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL------SNKYSRYLKSSNM 788
           TG+ N+ NTCY+NS+LQ  F+ +  R   L      SN  +  + SS+M
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNLLNNAVSSSDM 725

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           + G  N  NTCY NS+LQCL++ T  R   L
Sbjct: 515 VFGYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 15/94 (15%)

Query: 1054 LPRILIIHLSRFVYDLTKKNN----TVVTYPLILNI--VLKNNEVAKYRLYSTINHFGTL 1107
            LP+ L +HL RF Y   +  N      V YPL L++      N   +Y L   + H G  
Sbjct: 959  LPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGIVVHMGGG 1018

Query: 1108 IS-GHYTSLVNKDLQHEIREGKQKWYYFDDEIVK 1140
               GHY ++   D        K  W   DDE V+
Sbjct: 1019 PQHGHYVAICKND--------KFGWLLMDDETVE 1044

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
           GLRNM NTCY N+ LQ L+     R   L+
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA 136

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYM 797
           TG+ N+ NTCY+NS+LQ  FS    R   L  +Y + +++ N D++S S ++
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL--EYQKTVENFN-DHLSNSGHI 784

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           TGL N+ NTCY+NS+LQ  FS    R   L
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
           G +NM NTCY+N+ LQ L+   + R+  L+
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLN 137

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRS 794
           TG+ N+ NTCY+NS+LQ  FS    R   L   Y + +++ N D++S S
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILD--YQKTVENFN-DHLSNS 780

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNM 791
           TG+ N+ NTCY+NS+LQ  F+ +  R   +  + +    SSN D++
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIVQYQKTIADLSSNPDSI 767

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTK----KNNTVVTYPLILNIV-LKNNEVAK------- 1094
            K + F + P +L + L RF YD       K N    +P  +++    + EV K       
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G + +GHY +++   L         KWY FDD+ V
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKV 473

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNL 773
             GL+N   TCY+NS+LQ  + T  FR L
Sbjct: 198 FVGLKNQGATCYLNSLLQSYYFTKYFRKL 226

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTK----KNNTVVTYPLILN--------IVLKNNEVAK 1094
            K + F + P +L + L RF YD       K N    +P  ++        I   N +   
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G + +GHY +++   ++        +WY FDD+ V
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIE-------DQWYRFDDDKV 480

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G +N   TCY+NS+LQ  F T  FR L
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKL 233

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRN 772
           TGL N+ NTCY+NS+LQ  F+ +  R+
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
            GL N+ NTCY+NS+LQ  FS    R+  L
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVL 781

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYS 780
           GL N+ NTCY+NS+LQ  FS    R   L+ K S
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 57/141 (40%), Gaps = 35/141 (24%)

Query: 1054 LPRILIIHLSRFVYDLTKKNNTV------------------------VTYPL--ILNIVL 1087
            LPR+L+I L RF + +T  N                           +T P+  + +  L
Sbjct: 783  LPRVLLIQLKRFAF-VTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTIPIESVSSTSL 841

Query: 1088 KNNEVAKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHG 1146
            +++   +Y+L   I H G+    GHYT+    D+ H+      KWY  DD  +    N  
Sbjct: 842  RDDANREYKLTGVIYHHGSSPDGGHYTA----DVFHQ---QTNKWYRIDDVNISELKNDH 894

Query: 1147 NYDRGITSVSSSDVYLLFYER 1167
              D     + +   Y+L YE+
Sbjct: 895  VLDADDNDMGTRTAYILIYEK 915

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
           GL N+ NTCY+NS+LQ  F+    RN   S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 57/141 (40%), Gaps = 33/141 (23%)

Query: 1054 LPRILIIHLSRFVY-DLTKKNNTVVTYPL-------ILNIVLKNNEVA------------ 1093
            LP +L+IHL RF + + T K+N++  Y         I   +  N+E+             
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 1094 -----KYRLYSTINHFG-TLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGN 1147
                  Y L   + H G +   GHYT+    D+ H+  +   KWY  DD  V        
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTA----DIYHKEVD---KWYRIDDVTVTELEKDDV 998

Query: 1148 YDRGITSVSSSDVYLLFYERI 1168
               G  S  S   Y+L Y+++
Sbjct: 999  LKGGENSTDSRTAYILMYQKL 1019

>Kpol_1056.45 s1056 complement(114032..115387) [1356 bp, 451 aa] {ON}
            complement(114032..115387) [1356 nt, 452 aa]
          Length = 451

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 15/108 (13%)

Query: 1043 LATIKSLNFITLPRILIIHLSRF----VYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLY 1098
            L  +K    + LPR LI+H +RF       +  +N T+V +P ++ +     +  KY+L 
Sbjct: 328  LGGVKKYKILKLPRYLILHFNRFDNKEKTPVKDRNQTLVEFPTLMEL-----QKTKYQLI 382

Query: 1099 STINHFGTLISGHYTSLVNKDLQHE-----IREGKQKWYYFDDEIVKL 1141
            + I H   L      +  N+DLQ +     + E  ++WY  D   VK+
Sbjct: 383  ANIIH-EPLHELSVDNTSNEDLQSKWKAQLLNEKDEQWYEIDGTEVKI 429

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRN 772
           TGL N+ NTCY+NS+LQ  F+ +  R+
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 95/242 (39%), Gaps = 39/242 (16%)

Query: 886  FEKNGLSPIDSI---FQGQIEHQLSCQRCDFSSYSYST-FYVLSLALPNPGSKAFGKAKK 941
            F KN   P+D     F+G++   L C  C  SS    T F +L LA+P        +A  
Sbjct: 320  FAKNQKLPVDIPEIPFRGKVADHLVCTACRNSSKVRVTQFNMLPLAVP--------QAIT 371

Query: 942  LRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANS 1001
             +L + ++    D  +     + C  C V     + + +EK +  + +    +N  ++ +
Sbjct: 372  AKLAEMVS----DNQVESIEGYSCLTCKVG----KILENEKGRDTSSYETTEQNTLASLA 423

Query: 1002 NRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFIT-LPRILII 1060
                 P L                        +  K      +TI   N +   P++L+I
Sbjct: 424  RA--FPNLTINDDVSEELMNYINGYNRDGLVTSQLK------STIVKKNVVVDAPQVLLI 475

Query: 1061 HLSRFVYDLTK--KNNTVVTYPLILNI---VLKNNEV-----AKYRLYSTINHFGTLISG 1110
            HLSR +++ T   +N   V +  IL +   V++N+         Y L + + H G+   G
Sbjct: 476  HLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGINSVNYELKAIVKHAGSHSQG 535

Query: 1111 HY 1112
            HY
Sbjct: 536  HY 537

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 18/21 (85%)

Query: 746 TGLRNMSNTCYINSMLQCLFS 766
            GL N+ N+CY+NS+LQCLF+
Sbjct: 323 CGLINLGNSCYLNSVLQCLFN 343

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 35.4 bits (80), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 1090 NEVAKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            NE  KY+L S + H G  + SGHY + + K++     E  ++W  ++DE +
Sbjct: 182  NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEI-----ENVERWVLYNDEKI 227

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEF 770
           + GL N  NTC++NS+LQCL S+ E 
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSKEL 108

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
            GL+N+ NTCY+NS LQ L+     R   L+
Sbjct: 106 VGLKNLGNTCYMNSTLQALYQIRPLREEILN 136

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 11/84 (13%)

Query: 1040 NKKLATIKSLNFITLPRILIIHLSRFVYD-LTKKNN----------TVVTYPLILNIVLK 1088
            N K   IK    + LP++L+IHLSR  ++ +T   N           +  Y  I N+ L 
Sbjct: 333  NVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLT 392

Query: 1089 NNEVAKYRLYSTINHFGTLISGHY 1112
             N    Y L S + H G+   GHY
Sbjct: 393  ENRQIVYNLKSVVKHTGSHSRGHY 416

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776
            G+ N+ NTCY+NS+LQ  F+    R+  L+
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFILN 728

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775
           TGL N+ NTCY+NS+LQ  F  +  R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 59/150 (39%), Gaps = 36/150 (24%)

Query: 1047 KSLNFI-TLPRILIIHLSRFVY--DLTKKNNTV---------------VTYPLILNI--- 1085
            K   FI  LP+IL+I L RF +  +  K N                  ++Y   L I   
Sbjct: 673  KKQTFIDKLPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDE 732

Query: 1086 -----VLKNNEVAKYRLYSTINHFG-TLISGHYTSLVNKDLQHEIREGKQKWYYFDD-EI 1138
                  L+NN    Y L   I H G +   GHYT+ V         +  + WY  DD  I
Sbjct: 733  TLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTADV-------FHKQTKTWYRIDDVNI 785

Query: 1139 VKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168
             KL+ +      G  ++ S   Y+L Y+ +
Sbjct: 786  TKLE-DDDVLKGGEDNMDSRTAYILMYQNV 814

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 35.8 bits (81), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 20/106 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLTK----KNNTVVTYPLILNIVLKNNEVAK-------- 1094
            K + F + P +L + L RF YD       K N    +P  +++    +++          
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 1095 -YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
             Y+L+  + H G + +GHY +++    +        +WY FDDE V
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKPSTE-------DQWYRFDDEKV 468

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNL 773
            G +N   TCY+NS+LQ  F T  FR L
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRL 220

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 17/107 (15%)

Query: 1043 LATIKSLNFITLPRILIIHLSRFVYDLTK----KNNTVVTYPLILNI------VLKNNEV 1092
            L   + + F + P +L + L RF YD       K N    +P  +++          +  
Sbjct: 369  LQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTP 428

Query: 1093 AKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            A Y L+  + H G + +GHY +++  D           WY FDD+ V
Sbjct: 429  ADYILHGVLVHSGDISTGHYYAMIQPD-------AHGSWYRFDDDRV 468

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 21/112 (18%)

Query: 704 IEYEDPKHTERSR--GWLSAGSSEAHFSVPTIEK----------NPNEYIALSITGLRNM 751
           IE +  KH  R++  G+L+ G+      + +IE           N +        G +N 
Sbjct: 143 IEVDYLKHYSRNKPSGFLNQGAVNISVFIRSIEDPTGVLWHNFLNYDSKKMTGFVGFKNQ 202

Query: 752 SNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDN-----MSRSFYML 798
             TCY+NS+LQ    T  FR L     Y    +  N  N     + R+FY+L
Sbjct: 203 GATCYLNSLLQSYHFTKLFRKLV----YQIPTEDENPTNSVALALQRAFYLL 250

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
            YPL072W
          Length = 498

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 89/230 (38%), Gaps = 41/230 (17%)

Query: 898  FQGQIEHQLSCQRCD-FSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEV 956
            F+G   + L C +C+ +S   +S F +L +A+P   S+        +L D I   + DE+
Sbjct: 201  FEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPGNYSE--------KLTDLI-LHSQDEI 251

Query: 957  LTGQNPWDCPKCGVNS--SGDRQMNS--EKSKRKNKFFMGSENANSANSNRDHLPRLXXX 1012
            + G   + C  C VN     ++ +N   E S+ +        N        D LP     
Sbjct: 252  IEG---YSCLYCKVNMILKNEKYLNQLPEYSQEEQSILNFLRNQILTLYINDDLP----- 303

Query: 1013 XXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYD---L 1069
                                   +    KK A IK       P  LI+HLSR +++   +
Sbjct: 304  ---ADVSFYVDHYSKNGCVTANFKSNIIKKNAVIKE------PASLIVHLSRSIFNGATI 354

Query: 1070 TKKNNTV-------VTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHY 1112
            T+    V       +   +++N   +  E  KY L S + H G+ + GHY
Sbjct: 355  TRSACRVEYEQSLNLQRQVMINDAFERTEPIKYELKSVVKHTGSHVQGHY 404

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFRN 772
            GL N+ NTCY+NS+LQ  F  +  RN
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFR 771
           TGL N+ NTCY+NS+LQ  F  +  R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 89/234 (38%), Gaps = 50/234 (21%)

Query: 898  FQGQIEHQLSCQRCDFSS-YSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEV 956
            F GQ+   L C +C  SS  +   F +  L +P        +A   +L D ++    D +
Sbjct: 298  FGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVP--------QAMSAKLSDMVSDNQTDTI 349

Query: 957  LTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXX 1016
                  + C  C V++     +N EK +   K     E      +  D LP +       
Sbjct: 350  ----EGYSCLTCKVSTI----VNYEKGRGYAKCTQ--EEKRILKTLEDALPDMAINDELS 399

Query: 1017 XXXXXXXXXXXXXXXXXTHEKRYNK--------KLATIKSLNFITLPRILIIHLSRFVYD 1068
                             ++   YNK        K   +K    +  P+ L++HLSR ++D
Sbjct: 400  DELT-------------SYINSYNKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFD 446

Query: 1069 LT--KKNNTVVTYPLILNI---VLKNNEVA-----KYRLYSTINHFGTLISGHY 1112
                ++N+  V +  IL     V+++N+        Y+L + + H G+   GHY
Sbjct: 447  GISYQRNSCGVAFDEILESREQVIRHNKCVGINPISYKLKAIVAHSGSHSQGHY 500

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 51/137 (37%), Gaps = 31/137 (22%)

Query: 1044 ATIKSLNFITLPRILIIHLSRFVYDL---TKKNNTVVTYPLILNI----VLKNNEVAK-- 1094
              +K L    LP +L++ L RF + L   + K N  + YP  L +       +NE     
Sbjct: 337  GALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSP 396

Query: 1095 ------YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNY 1148
                  Y L   I H GT+  GHY            +    +W  F+D ++ +  N    
Sbjct: 397  DDSDIIYELIGVICHTGTVNEGHYIC--------SCKLANNQWVKFNDSMITIVDNE--- 445

Query: 1149 DRGITSVSSSDVYLLFY 1165
                 +V     YLL Y
Sbjct: 446  -----TVLKEQAYLLIY 457

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 746 TGLRNMSNTCYINSMLQCLFS 766
            GL N+ N+CY+NS LQCLF+
Sbjct: 331 CGLINLGNSCYLNSTLQCLFN 351

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa] {ON}
            YPL072W (UBP16) - putative deubiquitinating enzyme
            [contig 24] FULL
          Length = 749

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 10/68 (14%)

Query: 1055 PRILIIHLSRFVYDLTK--KNNTVVTYPLILNIV---LKNNEVA-----KYRLYSTINHF 1104
            P ILI+HLSR V++     +N+  VT+   L+     ++NN        KY+L + + H 
Sbjct: 447  PDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVKPIKYKLKAMVKHE 506

Query: 1105 GTLISGHY 1112
            GT   GHY
Sbjct: 507  GTHSQGHY 514

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
            (REAL)
          Length = 501

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 41/95 (43%), Gaps = 19/95 (20%)

Query: 1037 KRYNK--------KLATIKSLNFITLPRILIIHLSRFVYD-LTKKNN----------TVV 1077
            KRY+K        K   IK    + LP IL++HLSR  ++ +T   N           + 
Sbjct: 314  KRYSKDKLHISKVKGKIIKKDVAVQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLP 373

Query: 1078 TYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHY 1112
             Y L  N  +  N   KY L S + H G+   GHY
Sbjct: 374  EYTLAENRAITENRQVKYNLKSVVKHTGSHSRGHY 408

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 746 TGLRNMSNTCYINSMLQCLFS 766
            GL N+ N+CYINS+LQCL +
Sbjct: 322 CGLINLGNSCYINSVLQCLLN 342

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 702 YPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSIT-----GLRNMSNTCY 756
           Y I+      TE+S   L       +++   ++ + NE I L  +     G  N+ N+CY
Sbjct: 285 YQIDVSSKMGTEKSLIELQV-EQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCY 343

Query: 757 INSMLQCLFS 766
           +NS+LQCLF+
Sbjct: 344 LNSVLQCLFN 353

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 1044 ATIKSLNFITLPRILIIHLSRFVYD--LTKKNNTVVTYPLILNIV------LKNNEVAK- 1094
            + +K   F+  P I +IHLSR  Y+     +N   V +   L+          +NE  K 
Sbjct: 324  SILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKR 383

Query: 1095 --YRLYSTINHFGTLISGHYTSLVNK 1118
              YRL S + H G+  SGHY  L  K
Sbjct: 384  VRYRLKSIVIHTGSHYSGHYQVLRRK 409

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRY 782
           I GL N  NTC++NS+LQ L S+ E  +   +N    Y
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTY 137

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRY 782
           I GL N  NTC++NS+LQ L S+ E  +   +N    Y
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTY 137

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 90/231 (38%), Gaps = 39/231 (16%)

Query: 861  PQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRC-DFSSYSYS 919
            P  +LH+ S+     K +T +         ++P+D I   +I     C +C +     YS
Sbjct: 306  PNSILHDKSI-----KNFTPY-------KLITPLDGITAERI----GCLQCGENGGIRYS 349

Query: 920  TFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMN 979
             F  LSL LPN           L+L   ++ ++  E++ G    +C +C + ++    + 
Sbjct: 350  VFSGLSLNLPNENIGC-----TLKLSQLLSDWSKPEIIEG---VECNRCALTAAHSHLLG 401

Query: 980  SEKSKRKNKFFMGSENANSANSNRDHLPRLXXXXXXXXXXXXXXXXXXXXXXXXTHEKRY 1039
              K  RK     GS      N+  D + ++                         H    
Sbjct: 402  QLKEFRKKP--EGSIPEKLINAVEDRVQQIEEVLAKPVIDDEDYEK--------LHTANM 451

Query: 1040 NKKLATIKSLNFITLPRILIIHLSRFVYD----LTKKNNTVVTYPLILNIV 1086
             +K +  K +     P +L IH++R V+D    + +KNN+ V +   LN+ 
Sbjct: 452  VRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLA 502

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 25/110 (22%)

Query: 1046 IKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAK----------- 1094
            I+ L+   LP +L++ L RF + +   +  +  Y +  ++ L   +  K           
Sbjct: 352  IRQLSMAKLPPVLMLQLKRFEHLINGTSVKINDY-IFFSVDLNMKDYCKPMDDQHPVPNL 410

Query: 1095 -YRLYSTINHFGTLISGHYTSL--VNKDLQHEIREGKQKWYYFDDEIVKL 1141
             ++L + I H GT+  GHYT++  +N D+          W  F+D +V L
Sbjct: 411  TFKLSAIIPHQGTVDKGHYTTICRINGDV----------WAKFNDSMVTL 450

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 746 TGLRNMSNTCYINSMLQCLFSTTEFR 771
            GL N+ NTCY+NS+LQ  F+ +  R
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLR 787

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSR 781
           I GL N  NTC++NS+LQ L S+ E    FL N   R
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELME-FLDNNVIR 135

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 81/201 (40%), Gaps = 27/201 (13%)

Query: 891  LSPIDSIFQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCIN 949
            ++P+D I   +I     C +C +     YS F  LSL LPN           L+L   ++
Sbjct: 324  MTPLDGITAERI----GCLQCGENGGIRYSVFSGLSLNLPNENI-----GSTLKLSQLLS 374

Query: 950  FFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRL 1009
             ++  E++ G    +C +C + ++    M  E+  +  K   GS      N+ +D + ++
Sbjct: 375  DWSKPEIIEG---VECNRCALTAAHSHLM--EQLDQFQKKPEGSIPEKLMNAVKDRVQQI 429

Query: 1010 XXXXXXXXXXXXXXXXXXXXXXXXTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYD- 1068
                                     H     +K +  K +     P +L IH++R V+D 
Sbjct: 430  QEVLAKPVIDDEDYKK--------LHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDP 481

Query: 1069 ---LTKKNNTVVTYPLILNIV 1086
               + +KNN+ V +   LN+ 
Sbjct: 482  RTYMIRKNNSKVLFKSRLNLA 502

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRY 782
           I GL N  NTC++NS+LQ L S+ E      +N    Y
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTY 137

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 19/105 (18%)

Query: 1047 KSLNFITLPRILIIHLSRFVYDLT----KKNNTVVTYPLILNIV------LKNN--EVAK 1094
            K + F + P +L + L RF YD       K N    +P  +++       +K+N      
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 1095 YRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV 1139
            Y L+  + H G + +GHY +++  ++         +W+ FDD+ V
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKV 476

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 747 GLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMD-NMSRSFYMLFK 800
           G +N   TCY+NS+LQ  F T  FR +           + ++   + RSFY+L K
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMVYKIPSDNESPNDSVSLALQRSFYLLEK 257

>TDEL0C01260 Chr3 complement(214580..215959) [1380 bp, 459 aa] {ON}
            Anc_8.97 YFR005C
          Length = 459

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 1046 IKSLNFITLPRILIIHLSRF----VYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTI 1101
            I     + LP+ L++H+ RF       +  +N+T+V +PL + +     E + Y+L + I
Sbjct: 341  IMQYKILKLPKYLVLHVDRFDSTDAQPVKNRNHTLVEFPLTMKV-----EGSTYKLLANI 395

Query: 1102 NHFGTLISGHYTSLVNKDLQ 1121
             H  +  +G  T+ V KD Q
Sbjct: 396  VHQVSRTAG--TTRVEKDDQ 413

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 745 ITGLRNMSNTCYINSMLQCLFSTTEFR 771
           + G  N  NTCY NS+LQ L++  E R
Sbjct: 142 VFGYENFGNTCYCNSVLQVLYNLPELR 168

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 17/21 (80%)

Query: 746 TGLRNMSNTCYINSMLQCLFS 766
            GL N+ N+CY+NS+LQC ++
Sbjct: 326 VGLINLGNSCYLNSILQCFYN 346

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 17/21 (80%)

Query: 746 TGLRNMSNTCYINSMLQCLFS 766
            GL N+ N+CY+NS++QCL +
Sbjct: 342 CGLINLGNSCYLNSVMQCLLN 362

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 746 TGLRNMSNTCYINSMLQCLFS 766
            GL N+ N+CY+NS+LQ LF+
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFN 333

>SAKL0B01078g Chr2 (97198..101106) [3909 bp, 1302 aa] {ON} similar
           to uniprot|P13433 Saccharomyces cerevisiae YFL036W
          Length = 1302

 Score = 32.3 bits (72), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 14/95 (14%)

Query: 668 ELRNELSRITGQIDHTQYNQPEKYRYLPDSRE---SPYPIEYEDPKHTERSRG-----WL 719
           +L NEL  +  Q      + PE+ R L +S E   SP P+  ++ KHT R++       +
Sbjct: 213 KLVNELKLVELQ------DLPEEIRPLIESSEDVTSPEPVHQQEQKHTLRTQSGEIQTIM 266

Query: 720 SAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNT 754
              S      V T+EK+    +A+   G+R + +T
Sbjct: 267 ERSSVSLKEDVGTLEKDAKTLVAVDTIGMRVVRHT 301

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 112,038,946
Number of extensions: 4794014
Number of successful extensions: 14364
Number of sequences better than 10.0: 247
Number of HSP's gapped: 14314
Number of HSP's successfully gapped: 490
Length of query: 1169
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1048
Effective length of database: 39,606,813
Effective search space: 41507940024
Effective search space used: 41507940024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)