Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR295W5.711ON63163131690.0
Ecym_40105.711ON64464326510.0
KLLA0A00418g5.711ON64259023470.0
SAKL0E15114g5.711ON64959623450.0
KLTH0E00836g5.711ON64164222730.0
Kwal_55.196495.711ON64160922270.0
CAGL0H06699g5.711ON65059622200.0
Kpol_1043.775.711ON65762222150.0
TDEL0B020905.711ON64359221940.0
TPHA0E001505.711ON64658921920.0
KAFR0D021705.711ON66061221930.0
NCAS0G001805.711ON65459621460.0
ZYRO0B16522g5.711ON64361021130.0
TBLA0E017505.711ON66560221080.0
NDAI0F002105.711ON65359720810.0
YIL155C (GUT2)5.711ON64961920290.0
Skud_9.135.711ON64960220140.0
Smik_9.145.711ON65261920020.0
KNAG0L021905.711ON64559419440.0
Suva_9.325.711ON53853918110.0
Suva_10.5264.276ON114447790.61
TPHA0D040303.443ON256257781.1
TBLA0E007407.8ON698151761.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR295W
         (631 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...  1225   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...  1025   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   908   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   907   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   880   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   862   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   859   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   857   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   849   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   848   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   849   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   831   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   818   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   816   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   806   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   786   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   780   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   775   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   753   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   702   0.0  
Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR41...    35   0.61 
TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3....    35   1.1  
TBLA0E00740 Chr5 complement(152407..154503) [2097 bp, 698 aa] {O...    34   1.6  

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score = 1225 bits (3169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/631 (94%), Positives = 595/631 (94%)

Query: 1   MFRHTSRRLLPWXXXXXXXXXXXXXXSRPSLVNEVPTELKLERRAPAPPSRSELLEKLQK 60
           MFRHTSRRLLPW              SRPSLVNEVPTELKLERRAPAPPSRSELLEKLQK
Sbjct: 1   MFRHTSRRLLPWACGAVAAAAAVGAVSRPSLVNEVPTELKLERRAPAPPSRSELLEKLQK 60

Query: 61  TNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKMAHGGVRYLEKAV 120
           TNQFDVLVI          LDASTRGLNVALLEMNDFASGTSSKSTKMAHGGVRYLEKAV
Sbjct: 61  TNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTKMAHGGVRYLEKAV 120

Query: 121 WELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGS 180
           WELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGS
Sbjct: 121 WELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGS 180

Query: 181 QNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAVTAIENGATVLNY 240
           QN            GEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAVTAIENGATVLNY
Sbjct: 181 QNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAVTAIENGATVLNY 240

Query: 241 MEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLLQMDNHPEGLPDD 300
           MEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLLQMDNHPEGLPDD
Sbjct: 241 MEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLLQMDNHPEGLPDD 300

Query: 301 KILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAETSDGRVMFFLP 360
           KILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAETSDGRVMFFLP
Sbjct: 301 KILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAETSDGRVMFFLP 360

Query: 361 WQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVK 420
           WQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVK
Sbjct: 361 WQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVK 420

Query: 421 DPRKNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCI 480
           DPRKNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCI
Sbjct: 421 DPRKNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCI 480

Query: 481 TRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVS 540
           TRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVS
Sbjct: 481 TRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVS 540

Query: 541 LAADKPTSIDYNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGT 600
           LAADKPTSIDYNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGT
Sbjct: 541 LAADKPTSIDYNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGT 600

Query: 601 VKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           VKVMGDALGWDSAKRVAETKYAIEYIKTFGV
Sbjct: 601 VKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/643 (75%), Positives = 554/643 (86%), Gaps = 12/643 (1%)

Query: 1   MFRHTSRRLLPWXXXXXXXX----------XXXXXXSRPSLV-NEVPTELKLERRAPAPP 49
            FR+TSR+++PW                        S    V NE+P ELKLE+ APAPP
Sbjct: 2   FFRYTSRKVIPWAAAAATVTGASVVSWQFVSQQHAISNTGFVANELPAELKLEKHAPAPP 61

Query: 50  SRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKMA 109
           SR++LLEKLQKT+QFDVLVI          LDA+TRGLNVALLEMND+ASGTSSKSTKMA
Sbjct: 62  SRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKMA 121

Query: 110 HGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFYV 169
           HGGVRYLEKA WELSKAQLDLVIEALNERAH+L+TAPHLCK+LPIMIPVYKWWQVPYFYV
Sbjct: 122 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFYV 181

Query: 170 GTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAVT 229
           GTKMYDFFAG QN             +VAPMLDASKLKAGLVYHDGSFNDSRMN+T+AVT
Sbjct: 182 GTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAVT 241

Query: 230 AIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLLQ 289
           AIENGAT+LNYMEVK+L+KNPE GKVEGA+A+DRETGK+Y+V+AKVVV+ATGPFSDR+LQ
Sbjct: 242 AIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRILQ 301

Query: 290 MDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAE 349
           M+NHP+GLPDD  L   N+ +TI T+VAVA+PKMVVPSSGVHIILPS+YCPK+MGLLDAE
Sbjct: 302 MENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDAE 361

Query: 350 TSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDVQ 409
           TSDGRVMFFLPWQGKVLAGTTDIPMKQVP NPTATEADIQDILKELQHYIKFPVKREDVQ
Sbjct: 362 TSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVQ 421

Query: 410 SAWAGIRPLVKDPRKNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVK 469
           SAWAGIRPLVKDPRK+ SDTQ LVRSH +FTS +G+VTISGGKWTTYREMA+ET++EVVK
Sbjct: 422 SAWAGIRPLVKDPRKDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVVK 481

Query: 470 VGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELF 529
           VG FVNAKPCITRK+KL G+E+WD NLPA+LS QYN+PP+L+E+LS+NYGTKAA +CE+F
Sbjct: 482 VGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEIF 541

Query: 530 EDDRANMLPVSLAADKPTS-IDYNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFL 588
           + D+ N LPVSLAA+K  + +DY+AFRYP+T+GELK+ + +EYAR PLDFLMRRTRYAFL
Sbjct: 542 QSDKRNQLPVSLAAEKAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFL 601

Query: 589 DAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           DAKQA+ AV GTVK+MGD LGWDSAKR  ETKYAIE+IKTFGV
Sbjct: 602 DAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/590 (73%), Positives = 499/590 (84%), Gaps = 8/590 (1%)

Query: 49  PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKM 108
           PSR+ LL +L KT++FDVL+I          LDASTRGLNVAL+EMNDFASGTSSKSTKM
Sbjct: 54  PSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKM 113

Query: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168
           AHGGVRYLEKA WELSKAQLDLVIEALNERAH+L TAPHLCK+LPIMIPVY +WQVPYFY
Sbjct: 114 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFY 173

Query: 169 VGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228
           VGTKMYD FAGSQN             EVAPMLDASKLKAGLVYHDGSFNDSRMN+++A+
Sbjct: 174 VGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAI 233

Query: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288
           TAIE GATVLNY+++K+L+KN E GKVEGA+A+DRETG EY ++AKVVVNATGP+SDRLL
Sbjct: 234 TAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLL 293

Query: 289 QMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDA 348
           QMD  P GLPDD +L  IN+++T++T++AV NPKMVVPS+GVHI+LPS+YCPK +GLLDA
Sbjct: 294 QMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDA 353

Query: 349 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDV 408
           +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+P NPTATEADIQDILKELQHYI FPVKREDV
Sbjct: 354 QTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDV 413

Query: 409 QSAWAGIRPLVKDPRKNLS---DTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVN 465
            SAWAGIRPLVKDPRK  S    TQ LVRSH +FTS + +VTISGGKWTTYREMAEET++
Sbjct: 414 LSAWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETID 473

Query: 466 EVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQV 525
           EVVKVG+F N+KPC+T+KLKL G E+W+ NL ALLS +Y++   ++EHL+ NYGT+A  +
Sbjct: 474 EVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLI 532

Query: 526 CELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGELKFTMTHEYARTPLDFLMR 581
           CELF +D  N LPV+LA  +  S    +DY++FRYPYTIGELK+++ +EYAR  LDFLMR
Sbjct: 533 CELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMR 592

Query: 582 RTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           RTRYAFLDAKQAL AV+GTVKVMGD LGWDS KR  E + A EYIKTFGV
Sbjct: 593 RTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/596 (72%), Positives = 501/596 (84%), Gaps = 14/596 (2%)

Query: 49  PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKM 108
           P+R +LL KL KTNQFDVL+I          LDA+TRGLNVAL+EMNDFASGTSSKSTKM
Sbjct: 55  PTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALVEMNDFASGTSSKSTKM 114

Query: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168
           AHGGVRYLEKA WELSKAQLDLV+EALNERAH+LYTAPHLCK+LPIMIPVY +WQ PYFY
Sbjct: 115 AHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFY 174

Query: 169 VGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228
           VG KMYD FAGSQN             EVAPMLDASKLKAGLVYHDGSFNDSRMNAT+AV
Sbjct: 175 VGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAV 234

Query: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288
           TA+E GATVLNYMEVK+LIKN + GKVEGAVA DRETG+ + ++AKVVVNATGPFSDR+L
Sbjct: 235 TAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRIL 294

Query: 289 QMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDA 348
           QMD   +GLPDD++L + N ++TI+++VAVANP+MVVPS+GVHI+LPS+YCPK +GLLDA
Sbjct: 295 QMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDA 354

Query: 349 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDV 408
           +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+P NPTATEADIQDILKELQHYIKFPVKREDV
Sbjct: 355 KTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDV 414

Query: 409 QSAWAGIRPLVKDPRKNL---------SDTQGLVRSHLVFTSKNGMVTISGGKWTTYREM 459
            SAWAGIRPLVKDPRK +         S TQ LVRSH +FTS N +VTI+GGKWTTYREM
Sbjct: 415 LSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREM 474

Query: 460 AEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYG 519
           +EET+NEVVKVGKF NAKPCITRKLKL+GAE++D NLPA+L+ +Y++   +AE+L+ NYG
Sbjct: 475 SEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYG 533

Query: 520 TKAAQVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGELKFTMTHEYARTP 575
           T+A  +CELF+DD  N LP++    +  +    +D+++FRYP+TIGELK+++ +EY RT 
Sbjct: 534 TRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTA 593

Query: 576 LDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           LDFLMRRTRYAFLDAKQAL AVDGTVKVMGD L WDS +R  E + A E+IKTFGV
Sbjct: 594 LDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/642 (66%), Positives = 504/642 (78%), Gaps = 12/642 (1%)

Query: 1   MF-RHTSRRLLPWXXXXXXXXXXXXXXSRPSLVNEVPTELKLERRAPAPPSRSELLEKLQ 59
           MF R  SRR+L                   S  NEV   + L+  APA PSRSELL+K+ 
Sbjct: 1   MFARTVSRRVLAGATLAAGGYAAFALQRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMA 60

Query: 60  KTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKMAHGGVRYLEKA 119
           KT+QFDVLVI          +D +TRGLNVAL+EMNDFASGTSSKSTKMAHGGVRYLEKA
Sbjct: 61  KTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120

Query: 120 VWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAG 179
            WELSKAQLDLVIEALNER H+L TAPHLCKVLPIMIPVY +WQVPYFYVG KMYD FAG
Sbjct: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180

Query: 180 SQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAVTAIENGATVLN 239
           SQN             EVAPMLDAS LKAGLVYHDGSFNDSRMNA +AVTAIE GATVLN
Sbjct: 181 SQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240

Query: 240 YMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLLQMDNHPEGLPD 299
           YMEV RL+KN + G+VEGA+A DRETGKE+ + AKVVVN+TGPFSDR+LQMDN  +GLP 
Sbjct: 241 YMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPR 300

Query: 300 DKILDAINKD-STIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAETSDGRVMFF 358
           + ++   N+   +I + VAV+NP+MVVPS+GVHI+LP++YCPK +GLLDA+TSDGRVMFF
Sbjct: 301 NDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFF 360

Query: 359 LPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPL 418
           LPWQGKVLAGTTDIPMKQVP NPTATEADIQDILKELQHYIKFPVKREDV SAWAGIRPL
Sbjct: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPL 420

Query: 419 VKDPR-----KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVKVGKF 473
           V+DPR      ++S TQGLVR+H +FTS NG+VTI+GGKWTTYREMAEET++EVVK G F
Sbjct: 421 VRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHF 480

Query: 474 VNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELFEDDR 533
             AKPCIT+K+KL+GAE WD N  A+L+ +Y++   +AEHL+ NYGT++  +CE+F  D 
Sbjct: 481 -QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDE 539

Query: 534 ANMLPVSLAADKPTS----IDYNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLD 589
            N LPV+    +  +    +++++FRYP+TI ELK+++ +EY RT LDFLMRRTR+ FLD
Sbjct: 540 KNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLD 599

Query: 590 AKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           AKQAL+AV GTV +MGD LGWD  KR++E + A ++IKTFGV
Sbjct: 600 AKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/609 (67%), Positives = 492/609 (80%), Gaps = 11/609 (1%)

Query: 33  NEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALL 92
           +EV     L+  APA P+RSELLEK+ KT QFDVL+I          +DA+TRGLNVAL+
Sbjct: 34  SEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALV 93

Query: 93  EMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVL 152
           EMNDFASGTSSKSTKMAHGGVRYLEKA WELSKAQLDLVIEALNER H+L TAPHLCKVL
Sbjct: 94  EMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVL 153

Query: 153 PIMIPVYKWWQVPYFYVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVY 212
           PIMIPVY +WQVPYFYVG KMYD FAGSQN             EVAPMLDAS LKAGLVY
Sbjct: 154 PIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVY 213

Query: 213 HDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVR 272
           HDGSFNDSRMNA +AVTAIE GATVLNYMEV +L+KN + G++EGA+  DRETG+E+ ++
Sbjct: 214 HDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIK 273

Query: 273 AKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKD-STIATEVAVANPKMVVPSSGVH 331
           AKVVVN+TGPFSDRLLQMD   +G P + ++   N+   +I + +AV+NP+MVVPS+GVH
Sbjct: 274 AKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVH 333

Query: 332 IILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDI 391
           I+LP++YCPK +GLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQVP NPTATEADIQDI
Sbjct: 334 IVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI 393

Query: 392 LKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-----KNLSDTQGLVRSHLVFTSKNGMV 446
           LKELQHYIKFPVKR DV SAWAGIRPL++DPR      ++S TQGLVR+H ++TS NG+V
Sbjct: 394 LKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLV 453

Query: 447 TISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNI 506
           TI+GGKWTTYREMAEET++EVVK GKF  AKPCIT+K+KL+GAE WD N  A+L+ +Y++
Sbjct: 454 TIAGGKWTTYREMAEETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512

Query: 507 PPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGE 562
              +AEHL+ NYGT++  +CE+F+ D  N LPV+    +  +    +++++FRYP+TIGE
Sbjct: 513 SSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGE 572

Query: 563 LKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYA 622
           LK++M +EY RT LDFLMRRTR+ FLDA+QAL AVDGTV VMGD LGW   +R AE + A
Sbjct: 573 LKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQA 632

Query: 623 IEYIKTFGV 631
            E+IKTFG+
Sbjct: 633 SEFIKTFGL 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/596 (70%), Positives = 488/596 (81%), Gaps = 15/596 (2%)

Query: 49  PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKM 108
           P+R ELL+KL +TNQFDVL+I          LDA+TRGLNVAL+E NDFASGTSSKSTKM
Sbjct: 57  PTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVEKNDFASGTSSKSTKM 116

Query: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168
           AHGGVRYLEKA WE+SKAQLDLVIEALNERAHLL TAPHLCK+LPI+IPVY +WQVPYFY
Sbjct: 117 AHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPIIIPVYNYWQVPYFY 176

Query: 169 VGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228
            G KMYD FAGSQN             EVAPMLD S LKAGLVYHDGSFND+RMNAT+AV
Sbjct: 177 AGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHDGSFNDTRMNATLAV 236

Query: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288
           TAIEN ATVLNYMEVK+L+K+ +DGKV GAV  DRETGK Y+VRAKVVVNATGP+SDRLL
Sbjct: 237 TAIENSATVLNYMEVKQLVKD-KDGKVAGAVVEDRETGKTYSVRAKVVVNATGPYSDRLL 295

Query: 289 QMDNHPEGLPD------DKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKN 342
           QMD +P+GLPD      + I+D      +I ++VAV  P MVVPS+GVHIILPS+YCPK 
Sbjct: 296 QMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPSAGVHIILPSFYCPKE 355

Query: 343 MGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFP 402
           MGLLDA+TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NPTATEADIQDILKELQ YIKFP
Sbjct: 356 MGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEADIQDILKELQPYIKFP 415

Query: 403 VKREDVQSAWAGIRPLVKDPRKNL---SDTQGLVRSHLVFTSKNGMVTISGGKWTTYREM 459
           VKREDV SAWAGIRPLV DPRK       TQGLVRSH +FTS +G+VTI+GGKWTTYR M
Sbjct: 416 VKREDVLSAWAGIRPLVTDPRKKSKADGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAM 475

Query: 460 AEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYG 519
           AEET++EVVK GKF +AKPCITRKLKL+GAE+WD NLPALL+ +Y++   ++ +L++NYG
Sbjct: 476 AEETIDEVVKNGKF-DAKPCITRKLKLAGAENWDPNLPALLAQKYHLSQKMSHYLAENYG 534

Query: 520 TKAAQVCELFEDDRANMLPVSLAADKPT----SIDYNAFRYPYTIGELKFTMTHEYARTP 575
           T+A  +CE+F +D  N LP+ LA  + T     +D+++FRYP TI ELK+ + +EYART 
Sbjct: 535 TRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDFDSFRYPITIAELKYAIKYEYARTA 594

Query: 576 LDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           LDFLMRRTR+AFLDAKQAL AV+GTV++MGD+LGWD  +R  E +Y+ E+IKTFGV
Sbjct: 595 LDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQDEIRYSTEFIKTFGV 650

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/622 (68%), Positives = 498/622 (80%), Gaps = 28/622 (4%)

Query: 27  SRPSLVNEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRG 86
           S+PS V+   T+++L       PSR++LL KL+KT QFDVL+I          +DA+TRG
Sbjct: 47  SKPSPVDT--TDVRL-------PSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRG 97

Query: 87  LNVALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAP 146
           LNVAL+E ND+ASGTSSKSTKMAHGGVRYLEKAV++LSKAQLDLVIEALNERAHLLYTAP
Sbjct: 98  LNVALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAP 157

Query: 147 HLCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKL 206
           HLCK+LPIMIPVY++WQVPYFYVGTKMYD FAGSQN             E+APMLD+SKL
Sbjct: 158 HLCKILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKL 217

Query: 207 KAGLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETG 266
           KAGLVYHDGSFNDSRMNAT+A++AIE GATVLNYMEVK+L+K+ +  K+ GA+  D ETG
Sbjct: 218 KAGLVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETG 277

Query: 267 KEYAVRAKVVVNATGPFSDRLLQMDNHPEGLPD-----------DKILDAINKDSTIATE 315
           + Y ++AKV+VNATGP+SD +LQMDN+  GLPD              L+ I  +S I+ E
Sbjct: 278 ETYQIKAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPES-ISKE 336

Query: 316 VAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMK 375
           VAV NP MVVPS+GVHIILPSYYCP  MGLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK
Sbjct: 337 VAVQNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMK 396

Query: 376 QVPANPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-KNLSDTQGLVR 434
            VP NPTATEADIQDILKELQHYIKFPVKREDV SAWAGIRPLV+DPR +    TQ +VR
Sbjct: 397 TVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGGATQEVVR 456

Query: 435 SHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDA 494
           SH +FTS NG+VTI+GGKWTTYREMAEET++EVVK GKF NAKPCITRKLKL+GAE+WDA
Sbjct: 457 SHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDA 515

Query: 495 NLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTSID---- 550
           NL ALLS +YN+   +AEHL+ NYGT++  +CE+ ++   N LPV+LA  +  SI     
Sbjct: 516 NLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHV 575

Query: 551 -YNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALG 609
            Y++FRYPYTI ELK++M +EY RT LDFLMRRTRYAFLDAK+AL AV+GTVK+MGD L 
Sbjct: 576 GYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLN 635

Query: 610 WDSAKRVAETKYAIEYIKTFGV 631
           WD+ +R  E  YA +YIKTFGV
Sbjct: 636 WDNDRREREKVYATDYIKTFGV 657

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/592 (68%), Positives = 486/592 (82%), Gaps = 14/592 (2%)

Query: 49  PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKM 108
           PSR +LL KL KT+QFDVLVI          +DA+TRGLNVAL+EM+DFASGTSSKSTKM
Sbjct: 57  PSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVEMHDFASGTSSKSTKM 116

Query: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168
           AHGGVRYLEKAV++LSKAQLDLVIEALNER H+L TAPHLCK+LPIMIPVY +WQ+PYFY
Sbjct: 117 AHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIMIPVYTYWQIPYFY 176

Query: 169 VGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228
           VG KMYD FAGSQN             ++APMLD + LKAGLVYHDGSFNDSRMN  +AV
Sbjct: 177 VGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDGSFNDSRMNTALAV 236

Query: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288
           TAIENGATVLNYMEVK+LIK+ E GKV+GA+  +RETG+++ V+AKV VNATGP+SD+LL
Sbjct: 237 TAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKVTVNATGPYSDKLL 296

Query: 289 QMDNHPEGLPD-DKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLD 347
           QMD + +G PD  K L     ++TI+T+VAV NPKMVVPS+GVHIILPS+YCP+ MGLLD
Sbjct: 297 QMDENKDGKPDPTKPL----PNATISTKVAVENPKMVVPSAGVHIILPSFYCPREMGLLD 352

Query: 348 AETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKRED 407
            +TSDGRVMFFLPWQGKVLAGTTDIPMKQVP  PTA E+DIQDIL+ELQHYIKFPVKRED
Sbjct: 353 VKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQELQHYIKFPVKRED 412

Query: 408 VQSAWAGIRPLVKDPRKNLSD----TQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEET 463
           V SAWAGIRPLV DPRK+  +    TQGLVRSHL FT+ NGMVTI+GGKWTTYREMAEET
Sbjct: 413 VLSAWAGIRPLVIDPRKSQGNTGGSTQGLVRSHLCFTTDNGMVTIAGGKWTTYREMAEET 472

Query: 464 VNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAA 523
           +NEVVKVGKF N KPCITRKLKLSGAE+W+ NL ALL+ +Y++   ++ HLS+NYGT+A 
Sbjct: 473 INEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAALLAQKYHLSGAMSNHLSENYGTRAP 531

Query: 524 QVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGELKFTMTHEYARTPLDFL 579
            +CE+F++D  N LPV+    +  +    +++++FRYP+TIGEL +++ +EY RT LDFL
Sbjct: 532 LICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIGELNYSVDYEYTRTALDFL 591

Query: 580 MRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           MRRTR+AFLDA+QAL AV+GTV VMGD L WDS +R  E + + E+I+TFGV
Sbjct: 592 MRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSKEFIRTFGV 643

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/589 (68%), Positives = 484/589 (82%), Gaps = 10/589 (1%)

Query: 49  PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKM 108
           P+RSEL+  L+ T+QFDVL+I          LDA+TRGLNVAL+E +DFASGTSSKSTKM
Sbjct: 62  PTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALVEKDDFASGTSSKSTKM 121

Query: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168
           AHGGVRYLEKAV++LSKAQLDLVIEALNERAHLLYTAPHLCK+LPIMIPVYK+WQVPYFY
Sbjct: 122 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYFY 181

Query: 169 VGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228
            G KMYD FAGSQN             E+APMLD SKLKAGLVYHDG+FNDSRMN+T+A+
Sbjct: 182 AGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLAI 241

Query: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288
           TAIENGATVLNYMEVK+L+K+P   ++ GA+  D ETG++  + AKV+VNATGP+SD++L
Sbjct: 242 TAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKIL 301

Query: 289 QMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDA 348
           QMDN+  G PD+    A   +++IAT+VAV NP MVVPS+GVHIILPS+YCP+ MGLLDA
Sbjct: 302 QMDNNKNGKPDEFTQSA---ETSIATKVAVQNPHMVVPSAGVHIILPSFYCPREMGLLDA 358

Query: 349 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDV 408
            TSDGRVMFFLPWQGKVLAGTTDIPMK VP NPTATEADIQDILKELQHYIKFPVKREDV
Sbjct: 359 NTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDV 418

Query: 409 QSAWAGIRPLVKDPRKNLSD--TQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVNE 466
            SAWAGIRPLV+DPRK   +  TQ LVRSH +FTS +G+VTI+GGKWTTYREMAEET++ 
Sbjct: 419 LSAWAGIRPLVQDPRKTPKEGATQELVRSHFIFTSDHGLVTIAGGKWTTYREMAEETIDT 478

Query: 467 VVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQVC 526
           VVK GKF N KPC TRKLKL+G E++D NL ALL+ +Y++P  L+EHL+ NYGT++  +C
Sbjct: 479 VVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPSKLSEHLANNYGTRSPLIC 537

Query: 527 ELFEDDRANMLPVSLAADKPT----SIDYNAFRYPYTIGELKFTMTHEYARTPLDFLMRR 582
           ++F  D  N LP+ LA  +      ++D+++FRYPY+I E+K+ + HEYART LDFLMRR
Sbjct: 538 DMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRYPYSIAEVKYCVHHEYARTTLDFLMRR 597

Query: 583 TRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           +R+AFLDAKQALK+V+GTVK+MGD L WD  +R  ET Y+IEYIKTFGV
Sbjct: 598 SRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/612 (66%), Positives = 491/612 (80%), Gaps = 22/612 (3%)

Query: 41  LERRAPAPPSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASG 100
           L++R+   P+R++L+ KL KTNQFDVLVI          LDA+TRGLNVAL+E  DFASG
Sbjct: 50  LDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASG 109

Query: 101 TSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYK 160
           TSSKSTKMAHGGVRYLEKA WELSKAQLDLVIEALNERAHLL TAPHLCK+LPIMIPVY 
Sbjct: 110 TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYN 169

Query: 161 WWQVPYFYVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDS 220
           +WQ+PYFY G KMYD FAGSQN             +VAPMLD +KLKAGLVYHDG+FNDS
Sbjct: 170 YWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDS 229

Query: 221 RMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNAT 280
           RMN+T+AVTAIENG+TVLNYMEVK+L+K    GK+EGA+  D ETGK+Y ++AKVV+NAT
Sbjct: 230 RMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINAT 289

Query: 281 GPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCP 340
           GP+SD +LQMD +P GLPD   ++ +  ++ IAT+V+V+NPKMVVPS+GVHIILPS+YCP
Sbjct: 290 GPYSDAILQMDQNPTGLPDPLNVN-LKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCP 348

Query: 341 KNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIK 400
           K++GLLDA+TSDGRVMFFLPWQGKVLAGTTD+PMKQ+P NPTATEADIQDILKELQHYI+
Sbjct: 349 KDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIR 408

Query: 401 FPVKREDVQSAWAGIRPLVKDPR---KNL-SDTQGLVRSHLVFTSKNGMVTISGGKWTTY 456
           FPVKREDV SAWAGIRPLVKDPR   KN    TQGLVRSH +FTS +G+VTI+GGKWTTY
Sbjct: 409 FPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTY 468

Query: 457 REMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQ 516
           R MAEETV+E +KVGKF N KPCITR +KL+G E+W+ NL ALL+ +Y++   L++HL+ 
Sbjct: 469 RAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLAD 528

Query: 517 NYGTKAAQVCELFEDDRANMLPVSLAADKPTSID-----------------YNAFRYPYT 559
           NYGT+A  +CE++  DR N LP++LAA+     D                 +  FRYP+T
Sbjct: 529 NYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFT 588

Query: 560 IGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAET 619
           +GE+K+++ +EYA T LDFLMRR+R+AFLDAK+A+ AV+GTVK+MGD L WD ++R  E 
Sbjct: 589 VGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEI 648

Query: 620 KYAIEYIKTFGV 631
           +  I+YIKTFGV
Sbjct: 649 ENTIKYIKTFGV 660

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/596 (66%), Positives = 474/596 (79%), Gaps = 14/596 (2%)

Query: 49  PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKM 108
           P+RS+LL++L++  QFDVL+I          +DA+TRGL VAL+E NDFASGTSSKSTKM
Sbjct: 60  PTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKM 119

Query: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168
           AHGGVRYLEKA ++LSK+QLDLVIEALNERAHLL TAPHLCK+LPI+IPVY +WQVPYFY
Sbjct: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179

Query: 169 VGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228
            G K+YD FAG+QN             E+APML+A+ LKA LVYHDGSFNDSR+NAT+A+
Sbjct: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239

Query: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288
           TAIE GATVLNY+EV++L+K+ E G + G    D ETG    V +KVVVNATGPFSD++L
Sbjct: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299

Query: 289 QMDNHPEGLPDDKILD--AINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLL 346
           QMD +P GLPDD  L+   IN +  I++++AV NP MVVPSSGVHIILPSYYCPK MGLL
Sbjct: 300 QMDKNPTGLPDDMNLNPKMINPED-ISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLL 358

Query: 347 DAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKRE 406
           D  TSDGRVMFFLPWQGKV+AGTTDIPM QVP  P A EADIQDILKELQHYIKFPVKRE
Sbjct: 359 DVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRE 418

Query: 407 DVQSAWAGIRPLVKDPR-------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREM 459
           DV SAWAGIRPLV+DPR       K L  TQGLVRSH +FTS NG+VTI+GGKWTTYREM
Sbjct: 419 DVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREM 478

Query: 460 AEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYG 519
           AEET++EVVK G FV+AKPCITR+LKL+GAE WD N+ ALLS +YN+P ++A +LS NYG
Sbjct: 479 AEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYG 538

Query: 520 TKAAQVCELFEDDRANMLPVSLAADKPTSI----DYNAFRYPYTIGELKFTMTHEYARTP 575
           T++  +CELF +D  N LPV LA ++   I    D+N FRYP TIGELK++M +EYART 
Sbjct: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598

Query: 576 LDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           LDFLMRRTR+AFLDAK+AL+AV GTVK+MGD   W S +R  E +  I++IK+FGV
Sbjct: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/610 (64%), Positives = 478/610 (78%), Gaps = 11/610 (1%)

Query: 30  SLVNEVPTELKLERRAPAP-PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLN 88
           +L NEVP    ++ R     PSR +LL  LQKT++FDVL+I          LDA+TRGLN
Sbjct: 37  ALSNEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLN 96

Query: 89  VALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHL 148
           VA +E NDFASGTSSKSTKMAHGGVRYLEKAV+ELS+AQLDLVIEALNER H+L TAPHL
Sbjct: 97  VACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHL 156

Query: 149 CKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKA 208
           CK+LPIMIPVY +WQVPYF+ G K+YD+FAG QN             E+APMLD SKLKA
Sbjct: 157 CKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKA 216

Query: 209 GLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKE 268
           GLVYHDGSFNDSRMN+T+A++AIE+GATVLNY++V +L+K+    KVEGA+  D+ETGK+
Sbjct: 217 GLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQ 276

Query: 269 YAVRAKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSS 328
           Y V+AKV VNATGP+SD +LQMD +  GLPD +     N   +IATEVAV  P MVVPS+
Sbjct: 277 YQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPAN--VSIATEVAVNKPNMVVPSA 334

Query: 329 GVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADI 388
           GVHIILPSYYCPK +GLLD +T+DGRVMFFLPWQGKVLAGTTDIPMK VP NPTATEADI
Sbjct: 335 GVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADI 394

Query: 389 QDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPRKNL---SDTQGLVRSHLVFTSKNGM 445
           QDIL+ELQHYIKFPV+REDV SAWAGIRPLV DPRK       T+GLVR+HL+FTS+ G+
Sbjct: 395 QDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGL 454

Query: 446 VTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYN 505
           +T++GGKWTTYREMAE+T++EVVK G F + KPCITRK+KL+G E+W  NL ALL+  Y 
Sbjct: 455 ITLAGGKWTTYREMAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYK 513

Query: 506 IPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIG 561
           +   +++HLS NYGT+A  +CELF++D  N LPV+    +  +    +++++FRYP+TIG
Sbjct: 514 LSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIG 573

Query: 562 ELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKY 621
           E  +++ HEY+R   DFLMRRTRYAFLDA  AL AV+GTVKVMGD L WDSA+R  E + 
Sbjct: 574 EFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEE 633

Query: 622 AIEYIKTFGV 631
             E+IKTFGV
Sbjct: 634 CTEFIKTFGV 643

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/602 (65%), Positives = 469/602 (77%), Gaps = 21/602 (3%)

Query: 48  PPSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTK 107
           PPSRSELL  L+KT +FDVL+I          +DASTRGLNVAL+EMNDFAS TSSKSTK
Sbjct: 67  PPSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTK 126

Query: 108 MAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYF 167
           MAHGGVRYLEKAV++LSKAQLDLVIEALNER H+L TAPHLCK+LPIMIPVY +W+VPYF
Sbjct: 127 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYF 186

Query: 168 YVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIA 227
           Y G KMYDFFAGSQN            G++APMLD  KLKA LVYHDGSFND+RMN ++A
Sbjct: 187 YAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLA 246

Query: 228 VTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRL 287
           VTAIENGATVLNYMEV++LIK+P+ GK++GA   DRET K+Y V AKVVVN+TGPFSD +
Sbjct: 247 VTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNI 306

Query: 288 LQMDNHPEGLPDDKILDAINKDSTI--------ATEVAVANPKMVVPSSGVHIILPSYYC 339
           LQMD +  G PD  I D  N D++          + +AV NPKMVVPS+GVHIILPSYYC
Sbjct: 307 LQMDRNKSGYPD--IFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364

Query: 340 PKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYI 399
           PK+MG+LD +T+DGRVMFFLPWQ KVLAGTTDIPMK+VP NP ATEADI+DIL ELQHY 
Sbjct: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424

Query: 400 KFPVKREDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTSKNGMVTISGGKW 453
           KFPVKREDV SAWAGIRPLV+DPR      K    TQGLVRSH +FTS+N +VTI+GGKW
Sbjct: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484

Query: 454 TTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEH 513
           TTYR MAEET++E +KVG+  N KP +T+ L LSG E+W  N  ALLS +Y+IP  L+++
Sbjct: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543

Query: 514 LSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTSI----DYNAFRYPYTIGELKFTMTH 569
           LS+NYGT+A  +CEL + D+ N LPV+LA  +   I    D+ A RYPYT+ E+K+ + +
Sbjct: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDN 603

Query: 570 EYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTF 629
           EY+RT LDFL+RRTR+ FLDAK+A+ AV+GTV +MGD L WDS KR  E K + EYIKT 
Sbjct: 604 EYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTL 663

Query: 630 GV 631
           GV
Sbjct: 664 GV 665

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/597 (65%), Positives = 470/597 (78%), Gaps = 14/597 (2%)

Query: 49  PSRSELLEKLQ-KTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTK 107
           PSRS+L  +L  K +QFD+L+I          LDA+TRGLNVAL+E +DFASGTSSKSTK
Sbjct: 57  PSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTK 116

Query: 108 MAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYF 167
           MAHGGVRYLEKA  + SK+QLDLVIEALNERAHLL TAPHLCK+LPI+IPVY +WQ+PYF
Sbjct: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176

Query: 168 YVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIA 227
           Y G K YDFFAG QN             E+APMLDA+ LKA LVYHDGSFNDSR+N++IA
Sbjct: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236

Query: 228 VTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRL 287
           +TAIENGATVLNY+EV++L+K+P   K+ G    D+ETG+   V++KV+VNATGP+SD +
Sbjct: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296

Query: 288 LQMDNHPEGLPDDKILDAINKD-STIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLL 346
           LQMD +  GLPD   +D    D + I++++AV+NPKMVVPSSGVHIILPSYYCPK MGLL
Sbjct: 297 LQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLL 356

Query: 347 DAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKRE 406
           DA T+DGRVMFFLPWQGKV+AGTTDIPM QVP  P A E DIQDILKELQHYIKFPV+RE
Sbjct: 357 DARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRE 416

Query: 407 DVQSAWAGIRPLVKDPR-------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREM 459
           DV SAWAGIRPLV+DPR       + L  TQGLVRSH +FTS NG++TI+GGKWTTYREM
Sbjct: 417 DVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREM 476

Query: 460 AEETVNEVVKVGKFVN-AKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNY 518
           AEET++EVVK G F N AKPC T+ LKL GAE+WD NL ALLS ++N+  ++A++LS+NY
Sbjct: 477 AEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENY 536

Query: 519 GTKAAQVCELFEDDRANMLPVSLAA--DKPT--SIDYNAFRYPYTIGELKFTMTHEYART 574
           GT++  +C+LFE +  N LPV LA   DKP   ++D+N FRYP TI ELK+ M +EYART
Sbjct: 537 GTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYART 596

Query: 575 PLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           PLDFLMRRTR+A+LDA QAL AV GTVKVMGD  GWDS +R  E K A  +I++FGV
Sbjct: 597 PLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/619 (61%), Positives = 464/619 (74%), Gaps = 16/619 (2%)

Query: 28  RPSLVNEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGL 87
           RP + N+    ++    AP   SR +LL++L KT+QFDVL+I          LDA+TRGL
Sbjct: 32  RPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGL 91

Query: 88  NVALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPH 147
           NVAL+E  DFASGTSSKSTKM HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPH
Sbjct: 92  NVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPH 151

Query: 148 LCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLK 207
           LC VLPI+IP+Y  WQVPY Y+G K YDFFAGSQN             E APML    LK
Sbjct: 152 LCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLK 211

Query: 208 AGLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGK 267
           A LVYHDGSFNDSR+NAT+A+TA+ENGATVLNY+EV++LIK+P  GKV GA A D ET +
Sbjct: 212 ASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNE 271

Query: 268 EYAVRAKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPS 327
              + AK VVNATGP+SD +LQMD +P GLPD  + D     ST   ++AV +PKMV+PS
Sbjct: 272 LVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTF-NQIAVMDPKMVIPS 330

Query: 328 SGVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEAD 387
            GVHI+LPS+YCPK+MGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEAD
Sbjct: 331 IGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEAD 390

Query: 388 IQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTS 441
           IQDILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS
Sbjct: 391 IQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTS 450

Query: 442 KNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLS 501
            NG++TI+GGKWTTYR+MAEETV++VV+VG F N KPC TR +KL+GAE W  N  ALL+
Sbjct: 451 DNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLA 510

Query: 502 HQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLA---------ADKPTSIDYN 552
             Y++   ++ +L QNYGT+++ +CE F++   N LP+SLA         +++   ++++
Sbjct: 511 QNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD 570

Query: 553 AFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDS 612
            FRYP+TIGELK++M +EY RTPLDFL+RRTR+AFLDAK+AL AV  TVKVMGD   W  
Sbjct: 571 TFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSE 630

Query: 613 AKRVAETKYAIEYIKTFGV 631
            KR  E +  + +IKTFGV
Sbjct: 631 KKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/602 (62%), Positives = 456/602 (75%), Gaps = 16/602 (2%)

Query: 45  APAPPSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSK 104
           AP   SR +LL++L KT+QFDVL+I          LDA+TRGLNVAL+E  DFASGTSSK
Sbjct: 49  APPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSK 108

Query: 105 STKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQV 164
           STKM HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPHLC VLPI+IP+Y  WQV
Sbjct: 109 STKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQV 168

Query: 165 PYFYVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNA 224
           PY Y+G K YDFFAGSQN             E APML    LKA LVYHDGSFNDSR+NA
Sbjct: 169 PYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNA 228

Query: 225 TIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFS 284
           T+A+TA+ENGATVLNY+EV+RLIK+P  GKV GA A D ET +   + AK VVNATGP+S
Sbjct: 229 TLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYS 288

Query: 285 DRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMG 344
           D +LQMD +P G P+  + D     ST   ++AV +PKMV+PS GVHI+LPS+YCPK+MG
Sbjct: 289 DAILQMDRNPSGQPNSPLNDNSLIKSTF-NQIAVTDPKMVIPSIGVHIVLPSFYCPKDMG 347

Query: 345 LLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVK 404
           LLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEADIQDILKELQHYI+FPVK
Sbjct: 348 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 407

Query: 405 REDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYRE 458
           REDV SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS NG++TI+GGKWTTYR+
Sbjct: 408 REDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 467

Query: 459 MAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNY 518
           MAEETV++VV+VG+F N KPC TR +KL+GAE W  N  ALL+  Y++   ++ +L QNY
Sbjct: 468 MAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNY 527

Query: 519 GTKAAQVCELFEDDRANMLPVSLA---------ADKPTSIDYNAFRYPYTIGELKFTMTH 569
           GT+++ +CE F++   N LP+SLA         +++   ++++ FRYP+TIGELK++M +
Sbjct: 528 GTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQY 587

Query: 570 EYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTF 629
           EY RTPLDFL+RRTR+AFLDAK+AL +   TVKVMGD   W   KR  E +  I +IKTF
Sbjct: 588 EYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTF 647

Query: 630 GV 631
           GV
Sbjct: 648 GV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/619 (60%), Positives = 462/619 (74%), Gaps = 16/619 (2%)

Query: 28  RPSLVNEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGL 87
           RP + N+    ++    AP   SR +LLE+L KT+QFDVL+I          LDA+TRGL
Sbjct: 35  RPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGL 94

Query: 88  NVALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPH 147
           NVAL+E  DFASGTSSKSTKM HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPH
Sbjct: 95  NVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPH 154

Query: 148 LCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLK 207
           LC VLPI+IP+Y   QVPY Y+G K YDFFAGSQN             E APML    LK
Sbjct: 155 LCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLK 214

Query: 208 AGLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGK 267
           A LVYHDGSFNDSR+NAT+A+TA+ENGATVLNY+EV++LIK+P  GKV GA A D ET +
Sbjct: 215 ASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNE 274

Query: 268 EYAVRAKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPS 327
              ++AK VVNATGP+SD +LQMD +P G PD  + D  +K  +   ++AV +PKMV+PS
Sbjct: 275 LIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDN-SKAKSAFNQIAVMDPKMVIPS 333

Query: 328 SGVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEAD 387
            GVHI+LPS+YCPK+MGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEAD
Sbjct: 334 IGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEAD 393

Query: 388 IQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTS 441
           IQDILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS
Sbjct: 394 IQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTS 453

Query: 442 KNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLS 501
            N ++TI+GGKWTTYR+MAEET+++VV+VG F N  PC TR +KL+GAE W  N  ALL+
Sbjct: 454 DNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLA 513

Query: 502 HQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLA---------ADKPTSIDYN 552
             Y++   ++ +L QNYGT+++ +CE F++   N LP+SLA         +++   ++++
Sbjct: 514 QNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFD 573

Query: 553 AFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDS 612
            FRYP+TIGELK++M +EY RTPLDFL+RRTR+AFLDAK+AL +V  TVKVMGD   W  
Sbjct: 574 TFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSE 633

Query: 613 AKRVAETKYAIEYIKTFGV 631
            KR  E +  + +IKTFGV
Sbjct: 634 KKRQWELEKTVNFIKTFGV 652

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/594 (62%), Positives = 452/594 (76%), Gaps = 18/594 (3%)

Query: 49  PSRSELLEKLQKTNQFDVLVIXXXXXXXXXXLDASTRGLNVALLEMNDFASGTSSKSTKM 108
           P R+++L++LQ T +FDVLV+          LDAS RGL VAL+E  DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168
           AHGGVRYLEKAV+ELSK QLDLV+EALNERAHLLY APHL K+LPI+IPVY++W+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 169 VGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228
            G KMYDFFAG+QN              +APMLD  KLK GLVYHDG FNDSR+ AT+A+
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288
           +A+E GATV NY+ V++LIK+   G + GA   D+ETG  + V AK+VVNATGP+SD++L
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 289 QMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDA 348
           QMD +P+GLP+ +   A  +++ I    AV NPKMVVPS GVHI LPS+YCP  MGLLDA
Sbjct: 298 QMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353

Query: 349 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDV 408
            TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+REDV
Sbjct: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413

Query: 409 QSAWAGIRPLVKDPR-----KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEET 463
            SAWAGIRPLV+DPR          T+GLVRSH +FTS   +VTI+GGKWTTYREMAEET
Sbjct: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473

Query: 464 VNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPL---LAEHLSQNYGT 520
           V+EV+KVGKF   KPC TRK KL GA+HW+ N  A L  +Y   PL   LAEHL+ NYG 
Sbjct: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRY--APLEDSLAEHLANNYGD 531

Query: 521 KAAQVCELFEDDRANMLPVSL---AADKPTSIDYNAFRYPYTIGELKFTMTHEYARTPLD 577
           +A  +CE+FE D+++ LPV L     DK  ++D NAF YP+TI ELK+ +  EY RT LD
Sbjct: 532 RAPIICEMFEADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYVRTALD 591

Query: 578 FLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           FL+RR+R+AFLDA++AL AVD TV ++GD LGWD+ KR AE+     YIKTFGV
Sbjct: 592 FLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/539 (61%), Positives = 407/539 (75%), Gaps = 16/539 (2%)

Query: 108 MAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYF 167
           M HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPHLC VLPI+IP+Y  WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 168 YVGTKMYDFFAGSQNXXXXXXXXXXXXGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIA 227
           Y G K YDFFAG QN             E APML    LKA LVYHDGSFNDSR+NAT+A
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 228 VTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRL 287
           +TA+ENGATVLNY+EV++LIK+P  GKV GA A D ET +   + AK VVNATGP+SD +
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 288 LQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLD 347
           LQMD +  G P+  + D  +K  +   +VAV +P+MV+PS GVHI+LPS+YCPK++GLLD
Sbjct: 181 LQMDRNASGQPNSPLNDN-SKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLD 239

Query: 348 AETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKRED 407
             TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEADIQDILKELQHYI+FPVKRED
Sbjct: 240 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 299

Query: 408 VQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAE 461
           V SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS NG++TI+GGKWTTYR+MAE
Sbjct: 300 VLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAE 359

Query: 462 ETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTK 521
           ET+++VV+VG F N KPC TR +KL+GAE W  N  ALL+  Y++   ++ +L +NYGT+
Sbjct: 360 ETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTR 419

Query: 522 AAQVCELFEDDRANMLPVSLAADKPTSI---------DYNAFRYPYTIGELKFTMTHEYA 572
           ++ +CE F+D   N LP+SLA  +  +I         +++ FRYP+TIGELK++M +EY 
Sbjct: 420 SSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYC 479

Query: 573 RTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631
           RTPLDFL+RRTR+AFLDAK+AL +V  TVKVMGD   W   KR  E +  + +IKTFGV
Sbjct: 480 RTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538

>Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR410W
           (REAL)
          Length = 1144

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 333 ILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPA 379
           +L  + CPK  G+LDAE  D  ++  LP   ++L    D+  ++ PA
Sbjct: 935 VLFDFICPKEYGILDAEKLDIGLLTSLPLAKQILNDIGDMKNRETPA 981

>TPHA0D04030 Chr4 (850344..858032) [7689 bp, 2562 aa] {ON} Anc_3.443
            YPR117W
          Length = 2562

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 11/57 (19%)

Query: 442  KNGMVTISGGKWTTYREM----------AEETVNEVVK-VGKFVNAKPCITRKLKLS 487
            ++G  +I+ GK TT REM           EE++NE+VK  G ++N K    +K+ +S
Sbjct: 2369 RSGADSITSGKTTTVREMRKVSSTFIRPTEESINEMVKRSGTYINIKSVTIKKMMMS 2425

>TBLA0E00740 Chr5 complement(152407..154503) [2097 bp, 698 aa] {ON}
           Anc_7.8 YOR372C
          Length = 698

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 60/151 (39%), Gaps = 21/151 (13%)

Query: 354 RVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDVQSAWA 413
           R++   P+  K+L        KQ      +   D Q++ KE Q+ +    K     S   
Sbjct: 346 RLLSLTPYGRKILNELGTPFAKQSGTTSNSALIDFQNLKKEQQNNLANNFKYS--PSINT 403

Query: 414 GIRPLVKDPRKNLSDTQGLVRSHLVFTSKNGMVTISG-----------GKWTTYREMAEE 462
            I+ L+K P KNL+D +      L   +K+ ++++             G   T  ++   
Sbjct: 404 SIKKLIKTPNKNLTDNK------LSLGNKDDLLSLPHPSTIDNEPDIYGSSPTTIQLNSS 457

Query: 463 TVNEVVKVGKFVNAKPCITRKLKLSGAEHWD 493
                 K+   +N  P +T KLK SG  H D
Sbjct: 458 ATKSTTKLD--INKVPNLTNKLKRSGFPHHD 486

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,792,083
Number of extensions: 2466176
Number of successful extensions: 6389
Number of sequences better than 10.0: 26
Number of HSP's gapped: 6471
Number of HSP's successfully gapped: 26
Length of query: 631
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 515
Effective length of database: 40,180,143
Effective search space: 20692773645
Effective search space used: 20692773645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)