Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR294W5.710ON34034013790.0
Ecym_40115.710ON4224247477e-96
KLLA0A00440g5.710ON3553794363e-50
SAKL0E15092g5.710ON3523573762e-41
KLTH0E00858g5.710ON3242823569e-39
Kwal_55.196555.710ON3242473367e-36
NCAS0G001905.710ON4432283234e-33
NDAI0F002305.710ON4862183245e-33
TDEL0B021005.710ON3402723141e-32
Suva_9.345.710ON3202773113e-32
Smik_9.155.710ON3442763011e-30
Skud_9.145.710ON3512772984e-30
YIL154C (IMP2')5.710ON3462752959e-30
KAFR0D021805.710ON3872222952e-29
ZYRO0B16500g5.710ON3422752861e-28
CAGL0H06677g5.710ON3383212702e-26
KNAG0L021805.710ON4392212471e-22
Kpol_1043.765.710ON3722982371e-21
TBLA0E017405.710ON3752132221e-19
TPHA0E001605.710ON4404001753e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR294W
         (340 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic ho...   535   0.0  
Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON} s...   292   7e-96
KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON...   172   3e-50
SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some...   149   2e-41
KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}...   141   9e-39
Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}...   134   7e-36
NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}...   129   4e-33
NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}...   129   5e-33
TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {O...   125   1e-32
Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641...   124   3e-32
Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON} Y...   120   1e-30
Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 3...   119   4e-30
YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}  IM...   118   9e-30
KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {O...   118   2e-29
ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} simi...   114   1e-28
CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} simila...   108   2e-26
KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5....   100   1e-22
Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON} (1644...    96   1e-21
TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.7...    90   1e-19
TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}...    72   3e-13

>AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL154C (IMP2')
          Length = 340

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/340 (83%), Positives = 283/340 (83%)

Query: 1   MDEPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPIGVTIKIEEPPEQRGRT 60
           MDEPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPIGVTIKIEEPPEQRGRT
Sbjct: 1   MDEPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPIGVTIKIEEPPEQRGRT 60

Query: 61  RNKQSGAAFXXXXXXXXXXXXXXXXXXDQEFLRWTILRADPSERLHLGAXXXXXXXXXXX 120
           RNKQSGAAF                  DQEFLRWTILRADPSERLHLGA           
Sbjct: 61  RNKQSGAAFSSSRSRTKSRSRSRVSVTDQEFLRWTILRADPSERLHLGAVEDEEDDDELS 120

Query: 121 XXXXXXXXXNDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVD 180
                    NDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVD
Sbjct: 121 DEEQLSDVENDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVD 180

Query: 181 VLQDTCTRAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLY 240
           VLQDTCTRAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLY
Sbjct: 181 VLQDTCTRAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLY 240

Query: 241 IFVLCDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRP 300
           IFVLCDAVDVESHLNRVAEQVAF                   QHAYPRHLLTETIHAFRP
Sbjct: 241 IFVLCDAVDVESHLNRVAEQVAFLLDCSAAALDDLDVVVLALQHAYPRHLLTETIHAFRP 300

Query: 301 AGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
           AGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD
Sbjct: 301 AGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340

>Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON}
           similar to Ashbya gossypii AFR294W
          Length = 422

 Score =  292 bits (747), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 217/424 (51%), Gaps = 86/424 (20%)

Query: 1   MDEPSRGILNRSGAGTTF-----------------------------GTQGANAGDAGSA 31
           MDEP RGILNR+G+   F                                GA A + G  
Sbjct: 1   MDEPGRGILNRNGSSNMFVMPPPQQQQQHQRQNQSAAAAAGPSSEPGSANGAKASN-GII 59

Query: 32  GKEGAGRRTS--SPIGVTIKIEEPPEQRGRTRNKQSGAAFXXXXXXXXXX--XXXXXXXX 87
             +G G  +S  SP+GVTIKIEEPPEQRGR+RNKQS A                      
Sbjct: 60  QTDGKGNSSSMTSPMGVTIKIEEPPEQRGRSRNKQSDATSSFSTSRSRTKLRSLSRVSIA 119

Query: 88  DQEFLRWTILRADPSERLH-------------------------LGAXXXXXXXXXXXXX 122
           + E LRWTILR DPSERLH                           A             
Sbjct: 120 EHELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPAGAAAGIAEDIEDVLSDE 179

Query: 123 XXXXXXXNDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYR----ASQPAGAAR 178
                  NDY+VDA LDYDLGARVLPNFA SIQQ LD Q TWLA YR      Q     +
Sbjct: 180 EQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQ 239

Query: 179 VDVLQDTCTRAVRHFARHS----------------------GAPGPAGKTFLAYLEDLNV 216
           VDVL++ C RA++H A+ +                          P  K FL YLEDLN 
Sbjct: 240 VDVLEN-CKRAIQHIAKRALSPAPAGAAGQAGHAPLAGSAAAHECPQKKAFLLYLEDLNT 298

Query: 217 SAAEKLYALTYTFGAVLANHDTLYIFVLCDAVDVESHLNRVAEQVAFXXXXXXXXXXXXX 276
           S +EKLYALTYTFGAVLAN DTLYI V CDA DVE+HL +V EQVAF             
Sbjct: 299 SHSEKLYALTYTFGAVLANRDTLYIVVQCDAADVEAHLVKVREQVAFLLDATSAALDHLD 358

Query: 277 XXXXXXQHAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRR 336
                  H YPRHLLTE   AF+P+ LI+PLQIAT SLAGYVS VPTL+VRKKLKR+RR+
Sbjct: 359 IIILTLHHPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTLVVRKKLKRSRRK 418

Query: 337 GIFD 340
           GI+D
Sbjct: 419 GIYD 422

>KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON}
           similar to uniprot|Q753L8 Ashbya gossypii AFR294W
           AFR294Wp and weakly similar to YIL154C uniprot|P32351
           Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
           activator involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 355

 Score =  172 bits (436), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 124/379 (32%), Positives = 172/379 (45%), Gaps = 63/379 (16%)

Query: 1   MDEPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPIGV-TIKIEEPPEQRGR 59
           M+EP RGILN+                     K    +  ++P    TIKIEEP EQRGR
Sbjct: 1   MEEPGRGILNK---------------------KLTDDKHLAAPPAFPTIKIEEP-EQRGR 38

Query: 60  TRNKQSGAAFXXXXXXXXXXXXXXXXXXDQEFLRWTILRADPSERLHLGAXXXXXXXXXX 119
           +R+K                        DQ +L+WTIL  DPSERLHL A          
Sbjct: 39  SRSKTRDTGISSSRSISRSASRVSIK--DQAYLKWTILNKDPSERLHLKAKKGNTRDSVS 96

Query: 120 ----------------------------XXXXXXXXXXNDYDVDAELDYDLGARVLPNFA 151
                                                 N+ ++D  +DYDLG +VLPNF 
Sbjct: 97  PGQENGGDEDEDEDEEEFIEDREDDGEVSEEEQVSDVENEIEIDEHIDYDLGCKVLPNFV 156

Query: 152 ASIQQVLDVQPTWLARYRASQPAGAAR---VDVLQDTCTRAVRHFARH---SGAPGPAGK 205
             I QVLD    WLA+    +     R   ++ +Q    RAV H ++    + A    G 
Sbjct: 157 TPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGH 216

Query: 206 TFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVLC--DAVDVESHLNRVAEQV-- 261
           +F+ YL+ ++ S AEK+YAL Y+FG+V  N DTLYI   C  D  D+   +NR+ + +  
Sbjct: 217 SFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDY 276

Query: 262 AFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSSV 321
            F                    H YP+ LLTE  H+ +P+ +I+PLQ    SL  +++SV
Sbjct: 277 LFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSV 336

Query: 322 PTLIVRKKLKRARRRGIFD 340
           P L++RKKLKR++RRGI D
Sbjct: 337 PMLVIRKKLKRSKRRGIAD 355

>SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some
           similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 352

 Score =  149 bits (376), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 170/357 (47%), Gaps = 28/357 (7%)

Query: 3   EPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPIGVTIKIEEP-PEQRGRTR 61
           EP R IL  +GA  +         +A  AG+  A   T + I +   +E P P  RGR+R
Sbjct: 5   EPGRSILLTNGANPSIHVSEYGENNA-QAGRTPASSNTRNNIQI---VESPLPRGRGRSR 60

Query: 62  NKQSGAAFXXXXXXXXXXXXXX-XXXXDQEFLRWTILRADPSERLHLGAXXXXXXXX--- 117
            K+S                       D+ +L+WT+LR DPSERLH              
Sbjct: 61  EKRSSVGGGTSNTRSLSTRSISGSRIEDESYLKWTVLRRDPSERLHKNEENDRDESAIDD 120

Query: 118 ------XXXXXXXXXXXXNDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRAS 171
                             ND ++D+ELDYDLGARVLPNF+ SI  VL+    W  +Y  +
Sbjct: 121 DDYDEDDVSDEEQISDIENDQEIDSELDYDLGARVLPNFSTSISNVLESNKPWTKKYLQT 180

Query: 172 QPAGAARVDVLQDTC----TRAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTY 227
               A R  +  D+      RA+    R  G     G +++ Y  DL   ++E +YALTY
Sbjct: 181 VDQKAERAKIKLDSLPGGYMRAMSLVTRGKGGSSTHGSSYILY-ADL---SSESMYALTY 236

Query: 228 TFGAVLANHDTLYIFVLCDAVDVESHL----NRVAEQVAFXXXXXXXXXXXXXXXXXXXQ 283
           T GAV+ + DTLY+ V  ++   E+ L    +++ +Q AF                    
Sbjct: 237 TLGAVVNSGDTLYV-VHVESSTTETRLLQNIDKLTQQTAFLLDCTSGVVNDLSVVLLSLS 295

Query: 284 HAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
           H YP+HL+ + IH  +P  L+V L +   SL  YV ++PTL+VRKKLKR++RRGI++
Sbjct: 296 HPYPKHLVNQMIHGLKPLLLVVSLSLVLTSLQNYVCNIPTLVVRKKLKRSKRRGIYE 352

>KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}
           some similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage
          Length = 324

 Score =  141 bits (356), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 134/282 (47%), Gaps = 16/282 (5%)

Query: 56  QRGRTRNKQSGAAFXXXXXXXXXXXXXXXXXXDQEFLRWTILRADPSERLHLGAXX---X 112
           +RGR+R K+  +A                      +L+WT+L+ DPSERL LG       
Sbjct: 36  ERGRSREKKGSSANTAVQHRSRTSSRLRGDVGS--YLKWTVLQHDPSERLLLGTKEGAEA 93

Query: 113 XXXXXXXXXXXXXXXXXNDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQ 172
                            N+ D+DA L YDLGARVLPNF +S+  V+  Q  W+A++  S 
Sbjct: 94  SDDDEDVSDEEQVSDVENEIDIDAALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSV 153

Query: 173 PA--GAARVDVLQDTCTRAVR--HFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYT 228
                  +++ LQ    RA++  H     GA    G++++ YL DL     E  YAL Y 
Sbjct: 154 EGKDSGVKLEDLQGGYARAIKIVHGKPQQGAEAREGRSYIIYL-DLT---PESFYALLYV 209

Query: 229 FGAVLANHDTLYIFVLCDAVDVE---SHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHA 285
           FGAVLA++DTLY+  +   V  E   +++ R+  + A+                    H 
Sbjct: 210 FGAVLASNDTLYVVHISQRVPNEQLRANVERLEAEAAYLLDASSAALNAVNVVLLSVSHP 269

Query: 286 YPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVR 327
           YP+HLL E + A +P  L VPL +   SL  YV  +PT+++R
Sbjct: 270 YPKHLLNELVIALKPMALCVPLSLVLSSLQNYVCPIPTVVIR 311

>Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}
           YIL154C (IMP2') - transcription factor [contig 159] FULL
          Length = 324

 Score =  134 bits (336), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 120/247 (48%), Gaps = 14/247 (5%)

Query: 91  FLRWTILRADPSERLHLGA---XXXXXXXXXXXXXXXXXXXXNDYDVDAELDYDLGARVL 147
           +L+WT+L  DPSERL L A                       N+ ++DA L YDLGARVL
Sbjct: 69  YLKWTVLHHDPSERLQLSAQDGKDSSDDEEDVSDEEQVSDVDNEINIDAALGYDLGARVL 128

Query: 148 PNFAASIQQVLDVQPTWLARYRAS--QPAGAARVDVLQDTCTRAVR--HFARHSGAPGPA 203
           PNF  S+  VL  +  W+A+Y  +  +     ++D LQ    RA++  H A+        
Sbjct: 129 PNFTNSLWDVLQTEKPWIAKYNETVDENNTDVKLDELQGGYARAIQVMHSAKSQKTELKP 188

Query: 204 GKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVLCDAV---DVESHLNRVAEQ 260
           G +++ YL DL     E  YAL Y FGAVL+ +DTLY+  +   V    + S++ R+  Q
Sbjct: 189 GASYIVYL-DL---TPESFYALLYVFGAVLSPNDTLYVVHISPRVPSDQLRSNVARLRAQ 244

Query: 261 VAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSS 320
            A+                    H YP+HLL E + A +P  L VPL +    L  YV  
Sbjct: 245 TAYLLDASSAALDSVSVVILSVSHPYPKHLLNEMVLALKPMALCVPLSLVLSVLQNYVCP 304

Query: 321 VPTLIVR 327
           +PT+++R
Sbjct: 305 IPTVVIR 311

>NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}
           Anc_5.710 YIL154C
          Length = 443

 Score =  129 bits (323), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 117/228 (51%), Gaps = 21/228 (9%)

Query: 130 NDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRAS---QPAGAARVDVLQDTC 186
           ND ++D   +YDLG +VLPNF +SI  +LD    W+A+Y  S   +      +  L    
Sbjct: 220 NDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENDNVEIGRLDGGY 279

Query: 187 TRAVRHFARHSGA---------PGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHD 237
            RA++   +  GA         P PAG+ ++ Y  DL   ++E  YALTYT GAV+ N D
Sbjct: 280 LRAMQLLTKGKGAYLNTESTATPTPAGRCYILY-TDL---SSESTYALTYTMGAVINNGD 335

Query: 238 TLYIF-----VLCDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLT 292
           TLY+       + D   +  ++ R+ + V                      H YP+HLL 
Sbjct: 336 TLYVVHSENSNIFDEPLMLKNVGRIRKHVMHMFDCISAVVDDVDVVALSLTHPYPKHLLN 395

Query: 293 ETIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
           E IH  +P  L VPL I   SL  +V SVPTL++RKKLKRA+R+GI D
Sbjct: 396 EMIHGLKPVALCVPLSIMLSSLQNFVCSVPTLVIRKKLKRAKRKGITD 443

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 88  DQEFLRWTILRADPSERLH 106
           ++EFL+WT+LR DPS RL 
Sbjct: 135 EEEFLKWTVLRQDPSMRLQ 153

>NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}
           Anc_5.710 YIL154C
          Length = 486

 Score =  129 bits (324), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 107/218 (49%), Gaps = 18/218 (8%)

Query: 130 NDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRAS---QPAGAARVDVLQDTC 186
           ND ++D   +YDLG +VLPNF +SI  +LD    W+A+Y  S   +         L    
Sbjct: 273 NDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDGGY 332

Query: 187 TRAVRHFARHSGAP------GPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLY 240
            RA++   +  GA        PAG+ ++ Y  DL   ++E  YALTY  GAVL N DTLY
Sbjct: 333 IRAMQLLTKGKGASMDFDPMKPAGRCYILY-TDL---SSESTYALTYMMGAVLNNGDTLY 388

Query: 241 IF-----VLCDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETI 295
           I       + +   ++ ++ RV + V                      H YP+HLL E I
Sbjct: 389 IVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMI 448

Query: 296 HAFRPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRA 333
           H  +P  +   L I   +L  +V SVPTL++RKKLKR+
Sbjct: 449 HGLKPVSIACSLTIILSTLQNFVCSVPTLVIRKKLKRS 486

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 88  DQEFLRWTILRADPSERLH 106
           ++EFL+WT+LR DPS RL 
Sbjct: 178 EEEFLKWTVLRQDPSMRLQ 196

>TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {ON}
           Anc_5.710 YIL154C
          Length = 340

 Score =  125 bits (314), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 123/272 (45%), Gaps = 27/272 (9%)

Query: 88  DQEFLRWTILRADPSERLHLGAXXXXXX---------------XXXXXXXXXXXXXXNDY 132
           D+EFL+WT+LR DPS RL L                                     ND+
Sbjct: 73  DEEFLKWTVLRRDPSMRLQLNQKDDKKSRDEQSDDEDSEELDLEDDVSDEEQVTDVDNDF 132

Query: 133 DVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDVLQDTCTRAVRH 192
           D+D E  YDLG +VLPNF  S+  VLD    W+  +RA+       +  L     RA+  
Sbjct: 133 DIDEEFHYDLGMKVLPNFVQSLNDVLDSSKQWIREFRANTQEPEIPLATLAGGYKRAMLP 192

Query: 193 FARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVLCD--AVDV 250
            ++  G+         + L       +E  YALTY  GA+++N DTLY+    +  + D 
Sbjct: 193 LSKGKGSTTDRSYILCSDL------TSESQYALTYVMGALVSNGDTLYVVHWDNQSSSDA 246

Query: 251 ESHLNR----VAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGLIVP 306
           ++ L +    + E V                     QH +P+ LLTE IH  +P  L   
Sbjct: 247 DAKLQKNILTIRENVEHMFDSIGAVIEDFDVVVLSLQHPFPKQLLTEMIHGLQPVALCCS 306

Query: 307 LQIATRSLAGYVSSVPTLIVRKKLKRARRRGI 338
           L +   +L  YV SVPTL++RKKLKRA+++GI
Sbjct: 307 LSMILSTLQNYVCSVPTLVIRKKLKRAKKKGI 338

>Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641)
           [963 bp, 320 aa] {ON} YIL154C (REAL)
          Length = 320

 Score =  124 bits (311), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 125/277 (45%), Gaps = 28/277 (10%)

Query: 88  DQEFLRWTILRADPSERLHL-------------------GAXXXXXXXXXXXXXXXXXXX 128
           +++FL+WT+LR DPS RL +                                        
Sbjct: 48  EEQFLKWTVLRQDPSMRLRVVDQDSEEDEDNDNNNNNDDDGPNDDDVDDEESDEEQVSDV 107

Query: 129 XNDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDVLQDTCTR 188
            ND ++D E  YDLG +VLPNF  SI  VLD    W+A+Y          ++ L     R
Sbjct: 108 DNDLEIDEEFHYDLGMKVLPNFCTSINDVLDSAKPWIAKYEMGHENDGVSLERLAGGYVR 167

Query: 189 AVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIF-----V 243
           A++   + +GA   A + F+ Y  DL   ++E  YALTY  GAVL   DTLYI       
Sbjct: 168 AMQLLTKGAGAEPGAQRCFILY-TDL---SSESTYALTYLMGAVLNQGDTLYIVHWEPST 223

Query: 244 LCDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGL 303
             D   + +++ R+ + V                      H YP+HLL E IH  +P  L
Sbjct: 224 PVDDAQMLANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMIHGLKPVAL 283

Query: 304 IVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
              L +   +L  +V SVPTL VRKKLKRA+R+GI +
Sbjct: 284 CCSLSVILGTLQNFVCSVPTLAVRKKLKRAKRKGICE 320

>Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON}
           YIL154C (REAL)
          Length = 344

 Score =  120 bits (301), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 129/276 (46%), Gaps = 28/276 (10%)

Query: 88  DQEFLRWTILRADPSERLHL--------------GAXXXXXXXXXXXXXXXXXXXXNDYD 133
           ++EFL+WT+LR DPS RL +                                    ND +
Sbjct: 74  EEEFLKWTVLRQDPSMRLRVVDVDSEEEGEGNDDDGDDGDDVDEEESDEEQVSDVENDLE 133

Query: 134 VDAELDYDLGARVLPNFAASIQQVLDVQPTWLARY----RASQPAGAARVDVLQDTCTRA 189
           +D E  YDLG +VLPNF  SI +VL+    W+A+Y    R  +  G + ++ L     RA
Sbjct: 134 IDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIRGHEDEGVS-LEQLDGGYVRA 192

Query: 190 VRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVL----- 244
           ++   + +GA     ++F+ Y  DL   ++E  YALTY  GAV+   DTLYI        
Sbjct: 193 MQLLTKGAGAEPGNQRSFILYT-DL---SSESTYALTYLMGAVVNQGDTLYIVHWEPSKP 248

Query: 245 CDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGLI 304
            D   + +++ R+ + V                      H YP+HLL E IH  +P  L 
Sbjct: 249 TDDAQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMIHGLKPVALC 308

Query: 305 VPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
             L +   +L  +V SVP L VRKKLKRA+R+GI +
Sbjct: 309 CSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGICE 344

>Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 351
           aa] {ON} YIL154C (REAL)
          Length = 351

 Score =  119 bits (298), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 125/277 (45%), Gaps = 30/277 (10%)

Query: 88  DQEFLRWTILRADPSERLHLG------------------AXXXXXXXXXXXXXXXXXXXX 129
           ++EFL+WT+LR DPS RL +                                        
Sbjct: 77  EEEFLKWTVLRQDPSMRLKVADADSDEEEEGEGGDDDDDDEDGDDMDEEESDEEQVSDVE 136

Query: 130 NDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRAS---QPAGAARVDVLQDTC 186
           ND ++D E  YDLG +VLPNF  SI +VL+    W+A+Y  S          ++ L    
Sbjct: 137 NDAEIDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIRGHENEGVSLEQLDGGY 196

Query: 187 TRAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVL-- 244
            RA++   + +GA     ++F+ Y  DL   ++E  YALTY  GAV+   DTLYI     
Sbjct: 197 VRAMQLLTKGAGAEPGNQRSFILYT-DL---SSESTYALTYLMGAVVNQGDTLYILHWEP 252

Query: 245 ---CDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPA 301
               D   + +++ R+ + V                      H YP+HLL E IH  +P 
Sbjct: 253 SKPTDDSQMFANVARIRKHVMHLFDCAAGVLDDLDVVVLSLTHPYPKHLLNEMIHGLKPV 312

Query: 302 GLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGI 338
            L   L +   +L  +V SVP L VRKKLKRA+R+GI
Sbjct: 313 ALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGI 349

>YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}
           IMP2'Transcriptional activator involved in maintenance
           of ion homeostasis and protection against DNA damage
           caused by bleomycin and other oxidants, contains a
           C-terminal leucine-rich repeat
          Length = 346

 Score =  118 bits (295), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 87/275 (31%), Positives = 124/275 (45%), Gaps = 28/275 (10%)

Query: 88  DQEFLRWTILRADPSERLHL----------------GAXXXXXXXXXXXXXXXXXXXXND 131
           ++EFL+WT+LR DPS RL +                                      ND
Sbjct: 74  EEEFLKWTVLRQDPSMRLRVVDVDSEEEGEGNDEDDDDGDGDDMDEEESDEEQVSDIEND 133

Query: 132 YDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRAS---QPAGAARVDVLQDTCTR 188
            ++D E  YDLG +VLPNF  SI +VLD    W+A+Y  S          ++ L     R
Sbjct: 134 LEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDGGYVR 193

Query: 189 AVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVL---- 244
           A++   + +GA     ++F+ Y  DL   ++E  YALTY  GA +   DT+YI       
Sbjct: 194 AMQLLTKGAGAEAGNQRSFILYT-DL---SSESTYALTYLMGAAVNQGDTVYIVHWEPSK 249

Query: 245 -CDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGL 303
             D   + +++ R+ + V                      H YP+HLL E IH  +P  L
Sbjct: 250 PTDDSQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMIHGLKPVAL 309

Query: 304 IVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGI 338
              L +   +L  +V SVP L VRKKLKRA+R+GI
Sbjct: 310 CCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGI 344

>KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {ON}
           Anc_5.710 YIL154C
          Length = 387

 Score =  118 bits (295), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 118/222 (53%), Gaps = 15/222 (6%)

Query: 130 NDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYR----ASQPAGAARVDVLQDT 185
           N+ ++D +LD+DLG +VLPNF  SI +VL+ +  W+ +Y     +  P    ++D ++D 
Sbjct: 170 NEVEIDEKLDFDLGMKVLPNFCVSINEVLESRKPWVQQYEKEIESVLPDETTKLDEIEDG 229

Query: 186 CTRAVRHFARHSGAPGPA-GKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVL 244
             RA+    +  G+     G++++ ++ DL   ++E +YALTY  G V+ N DTLYI   
Sbjct: 230 YIRAIDLVTKGEGSSKNGDGQSYILFM-DL---SSESIYALTYVMGCVINNGDTLYIVNW 285

Query: 245 ------CDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAF 298
                  D   + ++L RV +                        H YP+HLL+E I+  
Sbjct: 286 ESTLKHIDETIIYNNLKRVKKMTLHLFDCISGVIDNLDVIIVSLTHPYPKHLLSEMIYGL 345

Query: 299 RPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
           +P  L   L I   +L  +V SVPTL+VR+KLKR++RRG+ D
Sbjct: 346 KPMALCCSLSIMLSTLQNFVCSVPTLVVRRKLKRSKRRGLTD 387

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 16/18 (88%)

Query: 88  DQEFLRWTILRADPSERL 105
           ++EFL+WT+LR DPS RL
Sbjct: 93  EEEFLKWTVLRQDPSMRL 110

>ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154C IMP2'
           Transcriptional activator involved in maintenance of ion
           homeostasis and protection against DNA damage caused by
           bleomycin and other oxidants contains a C- terminal
           leucine-rich repeat
          Length = 342

 Score =  114 bits (286), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/275 (30%), Positives = 121/275 (44%), Gaps = 31/275 (11%)

Query: 90  EFLRWTILRADPSERLH-----------------LGAXXXXXXXXXXXXXXXXXXXXNDY 132
           EFL+WT+L+ DPS RLH                                        ND 
Sbjct: 75  EFLKWTVLKRDPSMRLHKKPHGNGIGNNADDEEEEEEDEDQEDEDLVSDEEQVSDVENDL 134

Query: 133 DVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDVLQDTCTRAVRH 192
           ++D ++ YD+G RVLPN+AASI +VL    +W++ Y + +         L    +R  + 
Sbjct: 135 EIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQETTQDVSFTKLPGGYSRCCQL 194

Query: 193 FARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVLCDAVD--- 249
            +R  GA     +       DL     E  YAL Y  GA+L N DTLYI V  D      
Sbjct: 195 LSRGKGA---TTRRSFVLCTDL---TTESHYALAYVIGALLNNGDTLYI-VHWDGKQPGS 247

Query: 250 ----VESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGLIV 305
               +E  +  + + V                      H YP+HLL+E I+A +P  L  
Sbjct: 248 SKETLEQSVKSLRQHVLHKLDCASASLQDLDVVLLSLSHPYPKHLLSEMIYALQPIALCC 307

Query: 306 PLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
            L +   +L  +V SVPTL++RKKLKR++R+GI D
Sbjct: 308 SLSLVLTTLQNFVCSVPTLVIRKKLKRSKRKGISD 342

>CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154c IMP2
          Length = 338

 Score =  108 bits (270), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 137/321 (42%), Gaps = 49/321 (15%)

Query: 57  RGRTRNKQSGAAFXXXXXXXXXXXXXXXXXXDQEFLRWTILRADPSERL----------- 105
           RGR+R+K++G                     ++EFL+WT+LR DPS RL           
Sbjct: 26  RGRSRDKRTGGNGAGRLSLSRSRSRASSRVREEEFLKWTVLRRDPSMRLTTLKKNKKSGS 85

Query: 106 ----------HLGAXXXXXXXXXXXXXXXXXXXXNDYDVDAELDYDLGARVLPNFAASIQ 155
                                             ND ++D E  +DLG +VLPNF+ SI 
Sbjct: 86  GTGGDDDDDDDEDDDDEDDDDEEESDEERVSDIENDAEIDEEFHFDLGTKVLPNFSTSIN 145

Query: 156 QVLDVQPTWLARYRASQPAGAARVDV----LQDTCTRAVRHFARHSGAPG-PAGKTFLAY 210
            VL+    W+ +Y ++      R  V    L+   +RA+    +  GA   P        
Sbjct: 146 DVLENSKPWIQKYLSTLDMEKERAGVNFETLEGGYSRALELVRKGKGAEAHPETSKNYIL 205

Query: 211 LEDLNVSAAEKLYALTYTFGAVLANHDTLYIF-------------VLCDAVDVESHLNRV 257
             DL   ++E  YALTY  G++++N DTLYI               + +A+ V+ H+  +
Sbjct: 206 CTDL---SSESTYALTYVMGSLVSNGDTLYIVHWDGDSTTSTKDSFIDNALRVKKHVRHL 262

Query: 258 AEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGY 317
            + V+                     H YP+HLL E IH  +P  L   L +   SL  +
Sbjct: 263 MDCVSVIVDDLDVVIISLT-------HPYPKHLLNEMIHGLKPVTLACSLSLILSSLQNF 315

Query: 318 VSSVPTLIVRKKLKRARRRGI 338
           V SVPTL++RKKLKR+R++GI
Sbjct: 316 VCSVPTLVIRKKLKRSRKKGI 336

>KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5.710
           YIL154C
          Length = 439

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 104/221 (47%), Gaps = 15/221 (6%)

Query: 130 NDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDV--LQDTCT 187
           ND ++D +  YDLG + LPNF  SI +V+     W+ +Y A       ++DV  ++    
Sbjct: 224 NDAEIDEKFTYDLGTKTLPNFCVSINEVISSAEPWIRQYDADHGESQEKIDVRDVEGGYV 283

Query: 188 RAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVL--- 244
           RAV    R  GA  P   T++ Y  DL   ++E  YAL Y  G ++ N DT+Y+      
Sbjct: 284 RAVELLTRGKGA-SPQADTYIVY-SDL---SSESNYALLYVLGTLVGNGDTVYVVHWHSD 338

Query: 245 -----CDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFR 299
                    +V S++  +  +                       H YP+HLL E I+A  
Sbjct: 339 RGGGAVTHSEVRSNVRNLRRKALHLFDCLSATVDDLDIVLLSTTHPYPKHLLNEMINALH 398

Query: 300 PAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340
           P  L   L I    L  +V SVPT ++RKKLKRA+R+GI D
Sbjct: 399 PVALCCSLSIVLSLLQNFVCSVPTFVIRKKLKRAKRKGISD 439

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 88  DQEFLRWTILRADPSERLH 106
           ++EFL+WT+LR DPS RLH
Sbjct: 139 EEEFLKWTVLRQDPSMRLH 157

>Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON}
           (164489..165607) [1119 nt, 373 aa]
          Length = 372

 Score = 95.9 bits (237), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 125/298 (41%), Gaps = 52/298 (17%)

Query: 88  DQEFLRWTILRADPSERLHL--------------GAXXXXXXXXXXXXXX---------- 123
           D+EFL+WT+LR DPS RL                GA                        
Sbjct: 78  DEEFLKWTVLRRDPSMRLRTIRKKNQQGLNKKKHGAEEDDDEEEDEEEEEEEEDDDDDEI 137

Query: 124 ----XXXXXXNDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAG---- 175
                     N+ D+D ++ +DLG +VLPN+  SI  +++    W++ Y  S+P      
Sbjct: 138 SDEEQVSDIENENDIDEDITFDLGTKVLPNYCMSINDIMESSKKWISDY-LSRPENLRND 196

Query: 176 AARVDVLQDTCTRAVRHFARHSGAP------GPAGKTFLAYLEDLNVSAAEKLYALTYTF 229
              ++ ++    +A+   ++   +       G  G +++ Y  DL    +E  YAL Y  
Sbjct: 197 NVHIEKMEGGFVKAMELISKKEDSSTSISSSGKEGDSYILY-TDL---TSESTYALAYVL 252

Query: 230 GAVLANHDTLYIFVL-------CDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXX 282
           GA++ N DTLY+               +  ++ R+ + V                     
Sbjct: 253 GALVNNGDTLYVVHWEGNNTHGVTDTRIYDNIFRIRKHVMHLLDCSSAVIDRIDILLISL 312

Query: 283 QHAYPRHLLTETIHAFRPAGLIVPLQI--ATRSLAGYVSSVPTLIVRKKLKRARRRGI 338
            H YP+HLL E IH  +P  L   L +  +   L  YVSS+P L++RKKLKR R++GI
Sbjct: 313 THPYPKHLLNEMIHGLKPKTLCCSLSVVLSPSGLQNYVSSIPMLVIRKKLKRPRKKGI 370

>TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.710
           YIL154C
          Length = 375

 Score = 90.1 bits (222), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 93/213 (43%), Gaps = 16/213 (7%)

Query: 130 NDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDV----LQDT 185
           N+ ++D E  ++ G ++LPNF   I   L+    W+  Y  SQ  G     +    L + 
Sbjct: 165 NEAELDEEFQFEQGNKILPNFCTYINLTLEGGKKWIRNYE-SQVKGKENEGINLIKLDNG 223

Query: 186 CTRAVRHFARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIF--- 242
             RA+  +++  G     GK++L Y  DL   ++E  YAL Y  G+++ N D +Y+    
Sbjct: 224 YARAIEGYSKGKGCSAD-GKSYLLY-SDL---SSESTYALAYLIGSIIKNGDMIYLVHWE 278

Query: 243 ---VLCDAVDVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFR 299
                     +  ++ R+   V                      H YP+H L E IH   
Sbjct: 279 GNNKKIPEKQLSDNVFRMRRHVLHLLDAASTIIDDAEIMMVSLTHPYPKHFLNELIHGLD 338

Query: 300 PAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKR 332
            + L   L +    L  +VSS+P LIVRKKLK+
Sbjct: 339 ISMLCCSLTMILSGLQNFVSSIPMLIVRKKLKK 371

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 88  DQEFLRWTILRADPSERLHL 107
           D+EFL+WT+LR DPS RL L
Sbjct: 66  DEEFLKWTVLRKDPSMRLIL 85

>TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}
           Anc_5.710 YIL154C
          Length = 440

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 102/400 (25%), Positives = 147/400 (36%), Gaps = 92/400 (23%)

Query: 25  AGDAGSAGKEGAGRRTSSPIGVTIKIEEPPEQRGRTRNKQ-----SGAAFXXXXXXXXXX 79
           AGD  SAG   A   +S   GV    E+    RGRTR++      SG             
Sbjct: 45  AGDYFSAG---ANNESS---GVKFDSEQIENDRGRTRSRNNREDSSGTGNSFSYSSNNNS 98

Query: 80  XXXXXXXX-----DQEFLRWTILRADPSERLHL-----GA----------XXXXXXXXXX 119
                        D+EFL+WT+LR DPS RL       GA                    
Sbjct: 99  KSRSRSRASSMVRDEEFLKWTVLRKDPSMRLKFRRANDGAHRDHSNEDLEDDDDEYFDED 158

Query: 120 XXXXXXXXXXNDYDVDAELD---YDLGARVLPNFAASIQQVLDVQPTWLARYRAS----- 171
                     +D + + E+D   +DLG +VLPN+  SI +VL+    W + Y        
Sbjct: 159 DDEISDEEQVSDLENELEIDDFTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNK 218

Query: 172 -QPAGAARVDVLQDTCTRAVRHFARHSGAPG--PAGKTFLAYLEDLNVSAAEK------- 221
             P     ++ L+    +A+   ++++       +G    +   +LN   +E        
Sbjct: 219 IDPNANVLINELEGGFVKAMELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSAT 278

Query: 222 -----------------------LYA-----LTYTFGAVLA----NHDTLYIFVL----- 244
                                  LY       TY    V+     N+DTLYI        
Sbjct: 279 IASSNTNNTTSSSGSSDSGDSFILYTDLSSESTYALTYVMGTLVKNNDTLYIVHWEGSTT 338

Query: 245 --CDAV--DVESHLNRVAEQVAFXXXXXXXXXXXXXXXXXXXQHAYPRHLLTETIHAFRP 300
              DA+   + S+L ++ E V +                    H YP+H L E I+  +P
Sbjct: 339 SNNDAMKKKMTSNLQKIRENVMYLNDCNNSIIDRLDVVVISMTHPYPKHFLNEMIYGLKP 398

Query: 301 AGLIVPLQI--ATRSLAGYVSSVPTLIVRKKLKRARRRGI 338
             LI  L I  +   L  YV S+P L++RKKLKR RRRGI
Sbjct: 399 KSLICSLNIMLSPSGLQNYVCSIPVLVIRKKLKRTRRRGI 438

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,914,394
Number of extensions: 882745
Number of successful extensions: 2989
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2966
Number of HSP's successfully gapped: 36
Length of query: 340
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 230
Effective length of database: 40,868,139
Effective search space: 9399671970
Effective search space used: 9399671970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)